current user: public

If you have questions about the server, please let us know.

Query: PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKTVFNIVLVLCAAALIYICYSSIMGPINFEKAKKEREQAVIARLIDIRKAQQEYRSLHHGMYTEHFDTLIDFVKNQKLPFVMKVGQLTDDQLESGLTEKKAMAIINKAKKTGKYDEVKKNGLENFKRDTMWVAVMDTIYPKGFNADSMKYIPYGNGAIFEMNVKNDTAKSGAPVYLFEVKAPYETYLGGLDRQEIINLKDLNEKLGRYSGLMVGSIDNPNNGAGNWLast
1 -116.000PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali  100  1MKTVFNIVLVLCAAALIYICYSSIMGPINFEKAKKEREQAVIARLIDIRKAQQEYRSLHHGMYTEHFDTLIDFVKNQKLPFVMKVGQLTDDQLESGLTEKKAMAIINKAKKTGKYDEVKKNGLENFKRDTMWVAVMDTIYPKGFNADSMKYIPYGNGAIFEMNVKNDTAKSGAPVYLFEVKAPYETYLGGLDRQEIINLKDLNEKLGRYSGLMVGSIDNPNNGAGNW 227
2 -5.790PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1MRKLGFTLVAALAFSVSAFAKAKLTKYLQLSSQQNEQVASIQEQMKVANSSKKNSDQKVRNAVYGNLKLMKNTLTEKQY.................................................................................................................................................... 101
3 -5.350PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  12  1MKRIVSMMVIFTLLLGG----------MTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVL.................................................................................................................................................. 71
4 -5.320PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  12  1MK--IKFLSFIASFFMVSFVITSCLDD---DNNIEYSPDATIHAF--------ALDTAGLGSYKFTIDQLSREIYN------------EDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVN------------VHQHDPDSLRWNHVGKMQDEIIGEQKTIEFNNKILTYSVVEGQNSNYSNW 196
5 -5.260HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  16  1MKTLKITFVMLMTALFLVLPSCSKDDVNVTLTPSEEVVNAFQQKYPDVKNVK----EILVGAYE------AEFIYSGTYSENGQHIVLDKVEAQAYITQGGKWVRSEFDVTKDYQD---------SSSLVVPRAVRETIAAKGKKVDDVKLFDWSDRNDFYVEFDE............................................................. 149
6 -5.200PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  1MHKIKQMIKYIATLLLT-VLFVACNNGKGQQPSEENEDPKAKEILQGIDETETPLMRIIGDTYSDAQSAPVYFILKDTLYT.................................................................................................................................................. 86
7 -4.680HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  12  1MKKLLLAMIAVAAL----ISFAACDHNETYADQRDRELDSINAFLRN--EFEKRFEARKAGDKAVK-NEYVLFESNGIYMQVINDGC............................................................................................................................................ 97
8 -4.470PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  11  1MKTMKFILACVLLLSPLVYISKAMMELNPNLFMKDLYIGKVAEHLNSVQVREEMAKDIRSLVQSSKYELLMKQKSTVSGSEVYVNRK............................................................................................................................................ 115
9 -4.410PB011130 gi|88806557|ref|ZP_01122074.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]gi|88783389|gb|EAR14561.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]  ali follow..  14  1MNKTVNINLANMLFHIDENAYQKLLRYLEAVKRSFAGTAGSDEIIADIRIAELFYEKMENERQVITQKEVDAVIAI....................................................................................................................................................... 78
10 -4.100PB076697 gi|160881556|ref|YP_001560524.1| hypothetical protein Cphy_3432 [Clostridium phytofermentans ISDg]gi|160430222|gb|ABX43785.1| conserved hypothetical protein [Clostridium phytofermentans ISDg]  ali follow..  3ITAILFILFIMAIRDIKKSINKTLSVNVNQDLDEEDILD---ENIEQKPVSSTTSISAKLGTVFSKTESVISIPGRLSL--IDWNGLAQRILQKRMIPESNDNNTVYKMDNGQLTYTYPDIGVRIAHKNFT--VLDKYLKSVGTKL--YVQAPYKVNR--QLPYGLKDYPNKNADKLLEGLNKLKIDYIDFREVFANNFLDYPSLFFNTDH--------------HW 222

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.