current user: public

If you have questions about the server, please let us know.

Query: PB012386 gi|82541244|ref|XP_724876.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii str. 17XNL]gi|23479680|gb|EAA16441.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst FDIYIFNDSTNIPIGTVFSFVSKYDYICNKAVQDISEDLIKIELNQNVSINKIFNILKASQASENTQNLRKKHAPIKVLINRKNFNLYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFDTNESDKIKGDKNYYNSLENFEGYSYKKIYKCDFCDDIYDNLREATKHENSHFQHDEEILFHSSDANTNKESLYELTENELKNIKKKLast
1 -116.000PB012386 gi|82541244|ref|XP_724876.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii str. 17XNL]gi|23479680|gb|EAA16441.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii]  ali  115  1FDIYIFNDSTNIPIGTVFSFVSKYDYICNKAVQDISEDLIKIELNQNVSINKIFNILKASQASENTQNLRKKHAPIKVLINRKNFNLYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFDTNESDKIKGDKNYYNSLENFEGYSYKKIYKCDFCDDIYDNLREATKHENSHFQHDEEILFHSSDANTNKESLYELTENELKNIKKK 206
2 -2.860HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  10  3..EYILREIFLSVIAFLAGAGVSAGVFAFVLVIGVVPRILRCSRIENIILIENVMICGV................................................................................................................................................... 59
3 -2.800HGC00552 gi|162599220|dbj|BAAV01006262.1|2.0 TMP00636;  ali follow..  33..............GDVAGAVESTWSTASTQIKSVVDNVVFPAIDLILAVFFFAKLGTAYFEYRKSGQFEWAAPAI.................................................................................................................................. 94
4 -2.480HGC01215 gi|162843249|dbj|BABA01001460.1|3.0 TMP01713;  ali follow..  11  7...............................VEGFSVDVFIVHIREICFPVLFFCHFSVSDTFANKAASGGNVVSENTIAVHEQ.......................................................................................................................... 59
5 -2.310HGC00870 gi|163286116|dbj|BABD01024572.1|2.0 TMP01154;  ali follow..  12  80.TLFVFAFFSDNRLNQALAALRK------SGAGTFPYKAILTPTNQNWNALQCFSEIRREHETIQKQLKGNKEQAEE................................................................................................................................. 149
6 -2.300HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  8...............................FDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSSKDNMGLTSFKGVKVRRGDVTVAKNYMTHEEISTLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGREV---------LENFGTVKREVAEKLALEQYEQYDTHRRALEAADDVDELTADVKRLKR. 200
7 -2.170HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  12  94.................................................................................................................................................KGVATCGDCLD-LERCPTVGEILENNPSALKNL............................ 125
8 -2.160PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  10  22......................NSEDMTDNPVETLSEGMYPLTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDG-------EVIGVKIGTDGAVGSYTLDSDGKPTT------------------STSNIPAY--WQSTASQTVYGWYP-------NTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVKFR.. 170
9 -2.000PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  9LEILNYAEFATIGLGDIHIRAVKDGFFAEAMGHVRTQEEITLILNDNLL---------SKDWVTDSWEMCEVEAPKDSVKYQFNLTREQQATNRSKLREAKLLRENRIESYYDEALAENVPDAKEILHLAKGNFMEIYRF-----LTVDGNNVDSNQDRLALLKTLKVKDYKDVTASVLEDHLKVRESSYKYRPVYKDNI...... 209
10 -1.890PB000119 Q6KIT1_MYCMO/1-381 PB000119; Pfam-B_119;  ali follow..  16  194.....INFFSSIFLSFISIFALTITFAYNSTFLNLAQ-INTIRPNPNPNPNEIFNLTVEAIWFLQSKMELTDTATVIIINNTAYVNINKNSVKHNNFAVNYLKSEEN------------------------NWYLTGRDFPGLFVEKFFKDDV--EVFSPKIPALYFVVNNSTKNIFSSVGISSLSTNNPKL.............. 370

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.