current user: public

If you have questions about the server, please let us know.

Query: PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MHKIKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAKEILQGIWLDDETETPLMRIIGDTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRYRAYVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICVYEGKKSLYAKDITKQMFVDVIPTDFLQQAILSDMNFIGIDRKGYHYQALVCIPESPVCNLVNLTISFDGKLNITAAKYLast
1 -115.000PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali  100  1MHKIKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAKEILQGIWLDDETETPLMRIIGDTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRYRAYVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICVYEGKKSLYAKDITKQMFVDVIPTDFLQQAILSDMNFIGIDRKGYHYQALVCIPESPVCNLVNLTISFDGKLNITAAKY 272
2 -12.600PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  20  1......MKRNYFFTMLAAVLLAVAGANAQESAEFR-----PAELAGIWQLCHTGYGTYQQLTDNSY--DHKDNILEFEIGDDGVMY.......................................................................................................................................................................................... 126
3 -11.300HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  15  1MKKLLLA---MIAVAALISFAACDHNETYADQRDRELDSINAFLR---DTDPNNNEYVLFESNGIYM-KTQNVLCRFT.................................................................................................................................................................................................. 114
4 -10.800PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  10  1MKLTFKYLKLFLLAVAMINLTSCEIEIDDDNIGGSYYNKSLDLCSRPWADTFYDADGNYCYQELNFYLDRHGEDY..................................................................................................................................................................................................... 80
5 -9.480PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  1...MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLRVD------WKNAPQADPE-----CVYFYPEEGESPIRFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPAKGSEDERVVICPDMM--NVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPSMLFANEELDRECVTVPFETELHLESSKMTGKFYTFGHHEENARPH 266
6 -9.290PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  13  1M-KIKFLSFIASFFMVSFVITSCLDDDNNIEYSPDATIHAFAL-----DTAGLGSYKFTIDSREIYNED--SLPVHADTIIDKI------------------LIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEGISPNQTKEYTIKVNVHQHDPNHVGKMQDEIIGEQKTIEFNNKILTYSVVEGKNLKVYQNSNYSNWTAAGTNTTGDLTSTLPNSILPLNGIILATAN------------KVYESTDGV........ 237
7 -9.180PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  10  1MKI--ERLFIYCLLAGTSLLASCNSEDATPQTRVSDYDDTDGKHKSKWD-----------GGEVIVKIGTDGAVGSYTLDSDKPTTSTSNIPAYWQSTASQTVYGWYPNTADI----SLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVKFRVKLNGDVPNLSDAKVFFYGYPT-----KNEYGTVIPQGDKTYLATRKVGDYYTAMLAPDTKTSNNFVKI---EVYGLTYYYNPDIEL-VKGTVYTYTVNKVDIP......... 266
8 -8.880PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  19TQKKHNLSGTIILVSCLLLAGACDNSDRIETETQANGVLLN----NASTIDATTTETRSFVPIEGFAKNEYIFGMSVTKDNASRGEIFEGSRNLKATMSRPSGDAPWNWEFSNNASGTVVTPRGPEGKPLRVIAYYPAIAGTENFTDGIP-----FDFTQTNNPQQKEILYNTNTSYTIPSSGGSDKVTIPLK--------FQHAYSWISI-KVTKSVDKGSHKLSGVSIDNLSGGWIKNKGKINPATGMA..................... 253
9 -8.180PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  10  7.KQVRGAISFFLVALGICLAVSCTYRKDERILY-------RQVPHGRWQKRDVLDYEILIPDYTRSYSLELLIRHDNRYEYRDLALAYEVSVGERLIFADSVDLTLADKPQQWNGKGVAKQQNRFRLPISARFPYSGLYKIELKHNMRVPTLSGITEVGIRLTEGRDS........................................................................................................ 166
10 -7.830PB004718 Q5LIA4_BACFN/1-189 PB004718; Pfam-B_4718;  ali follow..  16  1......MKVKTSILLLLMIATALPSFGGNGNGNGTDSLQATRYVT----------RATMYGVGYTNVFDTYLSPQEYK.................................................................................................................................................................................................. 62

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.