current user: public

If you have questions about the server, please let us know.

Query: PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MEGHEEVRTGWSRWDSLWPFLLFYCNFLKGVFLLRIAVVDGQGGGIGKHITARLRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFLLPINRSGVEVIGVTPEPLPHLIEALVNRVKFFYQEGGDKDLast
1 -108.000PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali  100  1MEGHEEVRTGWSRWDSLWPFLLFYCNFLKGVFLLRIAVVDGQGGGIGKHITARLRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFLLPINRSGVEVIGVTPEPLPHLIEALVNRVKFFYQEGGDKD 175
2 -4.060HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  13  22....VGAYASSTEWNYAYGF-LSYTTFTQEIQGQP-------------------EISVNIDSETGAPQAYATFNVKVTNTGKVPGKTSVQIYGQAPYTEGGLEKVAIQLLNFEKSSELAPGASEIVSVKVDLQYI........................................ 139
3 -3.130PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  20  5......VCSPWGRFGCY--LLLFACSIMKKEFIGRTAKS--------LSLALAIFSGCIFGSVLPAWSQEIVAGE.................................................................................................... 68
4 -3.080PB032242 Q8FLW6_COREF/1-257 PB032242; Pfam-B_32242;  ali follow..  22  114.......................................................................AAIVAQSSIGAKAGSKRGDLAAVMAIGGAATMHLLSLLIFVGFLGTWLVSLVPVEVIEVARLYIMP...................................... 179
5 -2.740HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  15  9............................MQEEMMTVLVVEPMKAPYVKHILEDLQQAVGGDIEMTYPFDDEVGILLNGNGKFEGLPLNRALYDDHGQVYDAIAGTFLVVLTEDDFTSLTPEQIEKFKE............................................... 112
6 -2.600PB017124 _Gut.Meta.Jp.0039711_ gi|162659581|dbj|BAAX01000024.1||2 (+ 385:1498~0 complete)  ali follow..  257.....................................................................................AVDSDGNPKHLDHADFIRIQSGVLQQCGWTGETSTEVGRIT................................................. 297
7 -2.240HGC00933 gi|162753228|dbj|BAAZ01012194.1|2.0 TMP01261;  ali follow..  17  2...........STWSGIRNKL-YLCPALRGHIQYFATSYSKSADHEGRAAIRMDGVEV..................................................................................................................... 50
8 -2.200PB012108 A3U600_9FLAO/1-189 PB012108; Pfam-B_12108;  ali follow..  13  1................MLSLLLIEYNSITKRFLIENSIFVNQQNAMAKKEKKQLKKRLLHKYRMVILNEDTFEERVSLK------LTRLNVFILVTLTSLLLIAGTTVLIAFTPLKEYIPGYSSTSLKLKATELTYKTDSLETAL---------AINNQYYESIKKVLSGD.... 143
9 -2.180PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  12  94.......KVGMVRYNAF--------ADMGSDLSYSYALLDENNNGM---IITGIRSETVTYAKPVKDGKSNYSLSVEELQALQRAKENT...................................................................................... 166
10 -2.100PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  110.............FEDTQN----------GDYDYNDLIIHVKNTASNHAYQHPTETWQTIEIQPIALGSTKTIKLGCILSDGSTHMISDDVRTDLFGGRQGFINT...................................................................... 191

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.