current user: public

If you have questions about the server, please let us know.

Query: PB014120 _Gut.Meta.Jp.0147711_ gi|163636126|dbj|BABG01000147.1||5 (+ 2345:3428~0 complete), from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst SISAQEKKELDSQTIYVSFDKTKHIVLPAQVSDISYGREDYVKVERVDNVPNVVRITAQEEDFSGTTNLIIVCTNGNVYSYKISYLLPGMTDHCGNIVYAGDVDRSRCYNVIVNNNNTTEMFFPADVLYLKQGNEEVFGVEYYNNMVKVGTTFDAFEPSNLFVIDKDLNTYEITLFKDNALTYSYNFDDGRKYIAHIDVNSIEMDNLINKLHYKKRNIFSLGVIKNKFEMSLANLYVKDDFMFFVFDIKNFSNIDYDVDFIKCFLRDQKKVKNSIQQEVPYDPVEQKDFDKKILGKSQNRFVLAFNKFTIPDDKVFEIEMFERGGGRHMKLSILNEYILSALast
1 -118.000PB014120 _Gut.Meta.Jp.0147711_ gi|163636126|dbj|BABG01000147.1||5 (+ 2345:3428~0 complete)  ali  100  1SISAQEKKELDSQTIYVSFDKTKHIVLPAQVSDISYGREDYVKVERVDNVPNVVRITAQEEDFSGTTNLIIVCTNGNVYSYKISYLLPGMTDHCGNIVYAGDVDRSRCYNVIVNNNNTTEMFFPADVLYLKQGNEEVFGVEYYNNMVKVGTTFDAFEPSNLFVIDKDLNTYEITLFKDNALTYSYNFDDGRKYIAHIDVNSIEMDNLINKLHYKKRNIFSLGVIKNKFEMSLANLYVKDDFMFFVFDIKNFSNIDYDVDFIKCFLRDQKKVKNSIQQEVPYDPVEQKDFDKKILGKSQNRFVLAFNKFTIPDDKVFEIEMFERGGGRHMKLSILNEYILSA 341
2 -87.300PB012954 Q5LF97_BACFN/1-383 PB012954; Pfam-B_12954;  ali follow..  24  18SGRAQKIEELTAVPLQIGYEKTLHLIFPTEVKYYSIGGDY-VIGEKVVNCPGIIRLKAAEENFPGETTLSVVTADTKFYSYSISYNAHPAQSYVRIGG-----EAPTPHTLPVGKEKQLFLIFPAGITYVDYGSTNVEVDEGVDNILAVKAVQPYKEDTNISVVLEGGKFYTFLRYVPAPERFSFVIDKEDTILDEKERSYGQKERIREAVAKRTPLDLGLRDKNSGMEFEVGNIFIDGDVLLLRMTLTNRTQIGYTTDFMRFYIQDAKIRKKTAVQQLEQNILFTFDYPEEIPAHESRTFTVAMNKFTIPDKKRLIIEIQERNGGRHFLYKLKNKSLLTA 359
3 -3.610PB048420 Q64S71_BACFR/1-165 PB048420; Pfam-B_48420;  ali follow..  2...............................................................................................................................................................................................................................................EIQFVIVRSENAEYLCHNVNGTYVDVSDPSTEFVSGEDDFRLVDPDSSLTRKEYEFRGERFYLMP----QFYGNGWLALTLQSVEDETVLSVNLESMDALDL 102
4 -3.490PB022506 Q11RP6_CYTH3/1-298 PB022506; Pfam-B_22506;  ali follow..  6TVRYKLNNSIKDSRFETEHLAKYHL-------SFQVNFELFRICIVDGDSNRCLFLEDYTLADIYTTNDLLEQLDILFEDHILI-------------------KAGFWKSITVGFKNTQFSLIPEALFEKDYLKEYLTLNTTLDREPDEEYHFYKQRQTEANVFATNQRLTSWFNKTYPLKQVRYVHHTASMIEGIMLQKDKNAAEKSVFIQVEQYFLTIIVKQGKKLIFC--TFNTSEDFVYFILFVFDQLELNPEKCPVVVFGEITHDSESFSKLYKYIRHLTFGSKPEFVRFGYQFDEVFDHRYFDL-----YNMHLCQ................... 298
5 -2.980HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  111...............................................................................................................................................................................................................................SASDVTLQLSQSVPVGGSLDFTATIVHEGSGNYLVDGRVLTITSGQETIYKSDV--------ADSRLLLMAKGDKDVQKVTWNTNANATL-VAQLSLKDHPKSDPVTFTVQ....... 240
6 -2.880HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  66........................................................................................................................................................................................................................................SETGAPQAYATFNVKVTNTGKVP---TSVQIYGQAPYTEGGLEKVAIQLL---NFEKSSELAPGASEIVSVKVDLQYIATTGTYVLD----PGTYYFAAGNGAHDALNN 177
7 -2.680PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  170....................................................................................................................................................................................................TQTNNPQQKEILYNTNTSYTIPSSGGSDKVTIPLKFQHAYSW-----ISIKVTKSVDKGVSIDNLSINPATGMAMQGAIQGPIGEVRTAEVLDPSGDTATPIIYDFLVPAF-MDRNVKDDDLVFTLIIDGKKEIFSLGREHLNND 323
8 -2.510PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  43........................................................................................................................................................................................................................................HGRWQKRDVLDYEILIPDYTRSRYEYRDLALAYEVSVGERLIFADSVDLTLADKPQQWNGKGVAKQQNRFRLPISARFPYSGLYKIELKHNSGITEVGIRLTEG..... 163
9 -2.400PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  34..........................IWGEVVDEATGKR--VLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREK------------IQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINGTRRWNYSEP................................................................................ 265
10 -2.380HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  15  96.FHYSKDVKIKKDTIVIRQKNTPYFL------SMDCGYQMKQSITGRSYSRHLLYIQTAEVSIYGTENLKLFYRN.......................................................................................................................................................................................................................................................................... 166

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.