current user: public

If you have questions about the server, please let us know.

Query: PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVLEANSVQPLNGRVYYVNSNTNFVSLNDGQAMVQIASNSPYPGPNGLGGITVQGSASNVQVKQENNGNVYLSMSVQGIFISATVNLVLYSGTNNAMVTVDPNFSGNNLTMNGTLLPYSDSNVFQGTLast
1 -97.700PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali  108  1MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVLEANSVQPLNGRVYYVNSNTNFVSLNDGQAMVQIASNSPYPGPNGLGGITVQGSASNVQVKQENNGNVYLSMSVQGIFISATVNLVLYSGTNNAMVTVDPNFSGNNLTMNGTLLPYSDSNVFQGT 195
2 -10.300HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  10  1MKTLKITFVMLMTALFLVLPSCSKDDVNVTLTEEVVNAFQQKYPDVKNVKWEILVGAYEAEFIYSGTYSENGQHIVLDKVEAQAYITQGGKWVRSEFDVTKDYQDSSSLVVPRAVRETIAAKGKVDDVKLFDWSDRNDYFYVEFDEP----DSELLINFDGT................................. 161
3 -9.590HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  1MKKLLLAMIAVAALISFAAC---DHNETYADQRDRELDSINAFLRNENIKVINEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFESNGIYMQVIND---------GDYIAKGKTQNVLCRFTEYCLANRAKICDDAITLTNDVPAWAAMTDEISVKNTSGTFEGYFVDI........................ 161
4 -9.300PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete)  ali follow..  1MKTKLVAVIALIFCAFMAEASKVEGNGNIITKEISVDNYSEIELGGNIEYSGNNFWGNRSNKKFRSASLKITIDESIKSNNGRLAIRIQDG-TRIKPTQYVIEGSS--KYLKTSGPMDFEAQNAFSEDQLEIKISGSSDVKFPHNVKLR--LGEFSVSGSGDLVFADLDCKNLTSKVSGSGDITLKGKADEAR.. 205
5 -8.990PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1MRKLGFTLVAALAFSVSAFANNANDTINVAGKWDGTINKAKKKNSDQKVRNAVYGNLKLMKNTLTEKQYS............................................................................................................................. 102
6 -7.420PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  11  1MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELA----QLCHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFT-----IPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDH------KDNILEFEIGDDG............................................................. 123
7 -7.310PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  9KRTSIFKALALCLFAAVSFTFVSCDDDMDIQQSYPFTVETMPVPNKVTKGQTVEIRCELKKT-FANTLYTI-----------RYFQFEGEGTLKMDNGITFLP------------NDRYLLENEKFRLYYTAQGDEAHNFIVVVEDNGNSYELEFDFNNRNVKDDGVITVVPIGNFKPLT............... 167
8 -7.100PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  12  1MKKLLCMWMVVCGLLLIPGNMKGQSLKDILNSSAVKNAVTSVTGGKAVTFEN---MYVNPALQLEGDNALKNVAGSLAATEAEKKMKEYCAKVGIVEGVFN--YVFNSDSTFTSALKRGSLKGTYS-----SPEDKTVTLRYTVGNKKLTVTLTAHVVLSGNELTLLFNADKLLKFLSTVSSISSNTTLKAYDG. 198
9 -7.040PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIIYCLLAGTSLLASCNSEDMTDNPVETLSEGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASVYGWYPNTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQ--LVKFRVKLNGDVPNLSDAKVFFYGYPTCKNYGTVIPQGDKT..... 207
10 -6.770PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  1MKTMKFILACVLLLSPLLCQAQKN-NKYNDMKGVSSVYISKAMMELNPNLFMKDLYIGKVAEHLNS----VQVLSTHDNKVREEMAKDIRSLVQSSK-------------------------------LLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKF----------VYMEGDMTTDDIKKLML.. 151

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.