current user: public

If you have questions about the server, please let us know.

Query: PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MNRLGKIVFGLGIAVCLFSATNSIAQVKTHSSLRAENLEVILVKDIQHISDTTHHTHAHDPHKSSYKILHVNFMLVSSDPSVTGYKSVMMRLIDPHGVDIYDPAAGGGLFNLNGKETPYTFKVSTKLDGQPLKIDFLYNHPKHFRHGLHIIELYVDGLKIGEEHFVILast
1 -84.000PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali  100  1MNRLGKIVFGLGIAVCLFSATNSIAQVKTHSSLRAENLEVILVKDIQHISDTTHHTHAHDPHKSSYKILHVNFMLVSSDPSVTGYKSVMMRLIDPHGVDIYDPAAGGGLFNLNGKETPYTFKVSTKLDGQPLKIDFLYNHPKHFRHGLHIIELYVDGLKIGEEHFVI 167
2 -6.440HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  15  111................................................................SASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGLVDGSDSGRVLTITSGQETIYKSDV----KGDKDVQKVTWNTNANVNAGTYVAQLSLKDHPKVKSDFTV 239
3 -5.020PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  63........RKKIEKKKPHGKQTIKQLNAQGVQLSNIKITDENIKS-----------------DRVARKYGIDYSLKKEVGADPPKYLVFFKAKDVD....................................................................... 134
4 -4.630HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  45................................LSYTTFTQEIQGQP------EISVNIDSETGAPQAYATFNVKV-TNTGKVPGKTSVQIYGQAP---------YTEGGLEKVAIQLLNFEKSSELAPGASEIVSVKVDLQY-LDPGTYYFAAGNGAHDA....... 174
5 -4.540HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  11  15ISFAACDHNETYADQRDRELDSINA-------LRNENIKVINEAEFEKRFEARKAGDKAVKLTDT--------DPNNNEYVLFESNGIYMQVINDCGDYIAKGKTQNVLCRFTEYCL.................................................. 118
6 -3.500PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  31..................................................................HMVTLRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKD-----------------------------GGSVEIKEGRYRILCYNND.......... 92
7 -3.480PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  2................................................................RKELHNTKVTVRLRKSAYRNEWYLYIES........................................................................... 29
8 -2.980PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  38...........................................XXXXXXXRLAKDAVMGEEAFNNAMQA--SFVLEANSVQPLNGRVYFVSLNDGQAMV-YPGPNGLGGITVQGSASNVQVK-----QENNGNVYLSMSVQGIFISATVNLVLYSGT---NNAMVTV 168
9 -2.890PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  10  11..................................................................................................................EAVDFCRKRGLEFYAVNSNMPEEEADMSALRSRKVSADMYIDDRNLG...... 57
10 -2.670HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  18  1..........................LEDGDFVKLSNLTI--------------GYTLPIRNNKYMKSLRV-YVSGNNLFCITGYSGL-----DPELDISNVQAPGVEYRDTYPTTRSFTFGVNIGF........................................ 81

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.