current user: public

If you have questions about the server, please let us know.

Query: PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MSETKERLCIYADFPYEFAVCAPRTDCPKREQCLRASAYDGVLARGLQKITVINPLIPTSEQGCKAFADNTPVLFAHGITHLYDELPHHAVQSLKHRLLTYFGKTTYYRIYRKERYITIQEQDYIRDSFVRAGFSSDLIRYDAMVYMYELQSAMVKSLast
1 -91.900PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;  ali  100  1MSETKERLCIYADFPYEFAVCAPRTDCPKREQCLRASAYDGVLARGLQKITVINPLIPTSEQGCKAFADNTPVLFAHGITHLYDELPHHAVQSLKHRLLTYFGKTTYYRIYRKERYITIQEQDYIRDSFVRAGFSSDLIRYDAMVYMYELQSAMVKS 157
2 -5.030PB047024 _Gut.Meta.Jp.0098985_ gi|162869273|dbj|BABB01000734.1||6 (+ 5047:5650~0 complete)  ali follow..  10  137.........................................................................................................EYYEKSVDHYMIHPDTKAMLEYLLVMLSVKGEEYTYSYIKKEVLKGHI.... 184
3 -4.960PB008434 gi|121582878|ref|YP_973320.1| hypothetical protein Pnap_4296 [Polaromonas naphthalenivorans CJ2]gi|120596140|gb|ABM39578.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]  ali follow..  10  153.KETKLYQAPFFNVWSQGKVCTGNAAMPVGDN--------------AAIPHMWVDAFFGSNFTHPNFKEKDRLVKGVCPIDFWKAMTEKPLPVFPEGRLVDLPLT--------ADLLAPDLNQKLGNIDRAAG........................ 263
4 -3.350HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  20  94...............KGVATCG---DCLDLERCPTVGEILENNPSALKNLKG......................................................................................................... 127
5 -2.590PB000119 Q6KIT1_MYCMO/1-381 PB000119; Pfam-B_119;  ali follow..  245.......NFDLNNLPIENGLLTVEAIWFLQSKMELTDTATVIIINNTAYVNINKNSVKHNNFAVNYLKSEENNWYLTGLGLFVEKFFKDDVEVFSPKIPAL-----YFVVNNSTK-----------NIFSSVGISSLSTNNPKLIFTFTFDN..... 378
6 -2.590PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  28..KRRAAEAKGESLPEEPVRVVPPGCCGMHITCEK------------------DSLLTAVSKSIVYYDDEELDRYAGVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQALFIVSE.......................... 138
7 -2.590HGC00789 gi|163310627|dbj|BABD01000073.1|7.0 TMP01036;  ali follow..  11  11......................................................................................TLKTKDMIAKTILQQIGGKRFTAMTGSRDFIDMGNGLRMSLARNKTSANRLDIIYDEGADLYN........ 73
8 -2.470PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIERLFIYCLLAGTSLLASCNSEDM-SEGMYPLTFTAMQGEVVATPQTRVSDYDDTDGKHKS---WDGGEVI----GVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYPGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVK. 168
9 -2.450PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  13  8..............PWGRFGCYL--ACPMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEI----------VAGELERCFLAMPESVLPIVRNDLCRRAGNRNFIRIQTSTRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWK........ 172
10 -2.420PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1....MKIKF-LSFIASFFMVSFVITSCLDDDNNIEYSPDATIHAFALDTAGLGSYKFTIDQLSREIYNEDS-LPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWNH..... 153

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.