current user: public

If you have questions about the server, please let us know.

Query: PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKTMKFILACVLLLSPLLCQAQKNLFNKYNDMKGVSSVYISKAMMELNPNLFMKDLYIGKVAEHLNSVQVLSTHDNKVREEMAKDIRSLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYMEGDMTTDDIKKLMLYQSTSQNFIISGDLFYANNKPVTYFKKGNSDNQKDMAELSGTYNLNSIDTNYKEELSTLNDKLKRIDQGLKNMNILast
1 -76.600PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali  100  1MKTMKFILACVLLLSPLLCQAQKNLFNKYNDMKGVSSVYISKAMMELNPNLFMKDLYIGKVAEHLNSVQVLSTHDNKVREEMAKDIRSLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYMEGDMTTDDIKKLMLYQSTSQNFIISGDLFYANNKPVTYFKKGNSDNQKDMAELSGTYNLNSIDTNYKEELSTLNDKLKRIDQGLKNMNI 226
2 -7.460HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  12  1MKKLLLAMIAVAALISFAACDHNETYADQRDR---------------------ELDSINAFLRN-ENIKVINEAEFEKRFEARKAGDKAVKLTD-NEYVLFESNGIYMQVINDGCGDYIA------KGKTQNVLCRFTEYC..................................................................................... 117
3 -6.770PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  1MKRIVSMMVIFTLLLGGMTHVQAQ--SKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNLEANSVQPLNGRVYYVNSNTNFVSLND--QVKQENNGNVYLSMSVQGIFISATVNLVLYSGTNNAMVLTMNGTLLPYSDSNVFQ........................................................................... 193
4 -6.590PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1MRKLGFTLVAALAFSVSAFANNANDTINVAGKWDGTINK--AKLTKYLQLSSQQNEQVASICDYQEQMKVANSSKKNSDQKVRNLMKNTLTEKQYSDYLRLMAL.......................................................................................................................... 110
5 -6.290PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  1MKRNYFFTMLAAVLLAVAGANAQE----------------------------SAEFRPAELAGIWQLCHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFTMIPGKDAI--YQQLTDNSYKESIEKNIHLPMLD-FEIGDD...................................................................................... 122
6 -6.180PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  13  1MKKVLVALTMVMGMGSAVAFAQEPVKLP-DKFTKITVKELPQVVKSTLS-------------KDYEGTIVKEAFVAEKENGKVYKII---------TAIKEDQSTEEITVLLNEKGEPVNE......................................................................................................... 109
7 -6.100PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  48FSGCIFGSVLPAWSQEIVAGELERCF-----------LAMPESVLPIV-----TMEERNDLCRRAGHLS--GFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDF......................................................................................... 166
8 -5.760HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  1MKTLKITFVMLMTALFLVLPS-------CSKDDVNVTLTPSEEVVNAFQQKYPDVKNVKWEILVGAYEAEFIYSGTYSENGQHIVLDKVEAQAYITKWVRSEFD-RAVRETIAAKGKKVDDV-VEFDEPDSELLINFDGTL..................................................................................... 162
9 -5.320PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  11  1MKIFIYCLLAGTSLLASCNSEDMTDNPVETLSEGMYPLTFTAMQGEVVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYDNTGNKFPYVLKGVSSKQY-FRVKLNGDVPNLSDAKVFFYGYPTCKNEYGTVIPQGDKTYLATRKVGDYYTAMLAPDTKTSNNFVKIEVYGLTYYYNPDIELVKGTVYTYTVNK 262
10 -5.040PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  11  1MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLR--------VDFDWKNAPQADP--------EGMCVYFYPEEGESPIRFDFAGKDIKEGRYR-ILCYNNDTESLLF.................................................................................................................... 98

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.