current user: public

If you have questions about the server, please let us know.

Query: PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MDPPVCSPWGRFGCYLLLFACPIIFASIMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVRQVLast
1 -118.000PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali  100  1MDPPVCSPWGRFGCYLLLFACPIIFASIMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVRQV 263
2 -6.110PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  1...............................................MKTMKFILACVLLLSPLLCQAQKNLFVYISKAMMELNKDLYIGKVAEHLNSVQSTHDNKVREEMAKDIRSLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYM................................................................................................. 137
3 -4.710PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  1...............................................MKRIVSMMVIFTLLLGGMTHVQAQ----------SKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVLEANSVQPLNGRVYYVNSNTNFVSL----NDGQAMVQIASNSPYPGPNGLGGITVQGSASNVQVKQENNGNVYLSSVQGIFISATVNLVLYSGTNNAMVTVD................................... 169
4 -4.340PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  1...............................................MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELA-ILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESMLDHKDNILEFEIGDDGVMYLKYFIAKDLNGNELNTWFHETWKRVGMPAKFPE................................................................................. 159
5 -3.910PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  18  14..PP--RKW-RFTVWRRSWAAP-----TIKNEFINEKRKMRMNLPKVKMLQVSKCLIGLAVMMLQS..................................................................................................................................................................................................... 90
6 -3.900PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  1MHRSICGP------------TP----TSSTLPLTPYTPAMPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTPTTANDEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFFDTRYGGGPNGSNFLRTVTNA-----ETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHYT-RQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFQW--KRFANSL 256
7 -3.740PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1..........................................MKIERLFIYCLLAGTSLLASCNSEDMTDNPVETLSEGMYP----------LTFTAMQGEVVATPQTRVSDYDDTDGKHKSKW-----DGGEVIGVKI---DGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYPNTADISLTGQDNTGNKFPYVLKGVSSKQYSVQLNLEHQLVKFRVKLN................................... 174
8 -3.670HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  1..............................................MMRRKNITWVWLLGAAFMVG--------QVPENI---IQPDRMENIL----------------------YDYHLSISMGNNLSYSDNYQKEAYKNY------VFEKHHITEAEFDSSMVWYTRHTEEL-----------ASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTVDVWYDRKLYWLTDVPLANKVTFEIPADSNFKAKDAFLWSA 170
9 -3.630HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  11  33YDNEVAYGFG-YGLSYTTFTQEIQGQPEISVNIDSETGAP--------QAYATFNVKVTNTGKVPGKTSVQIYGQAPYT---------EGGLEKVAIQLLNFEKSSELAPGASEIVSVKVDLQYIASMEHDNGDGTTGTYVLDPGTYYFAAGNGAHDALNNILVL.................................................................................................. 181
10 -3.540HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  13  27..................FKVPEGYFENLTSEVMGKLPEKRMKPLLYMAAMFIGAALIIRVASSNHQPTTAGDHLTANEAATEVVSDEYIDVALDRSMLDDYSLSVYLSD......................................................................................................................................................... 133

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Godzik A, Rychlewski L. Novel SARS unique AdoMet-dependent methyltransferase. Cell Cycle. 2006 Oct;5(20):2414-6. Epub 2006 Oct 16.