current user: public

If you have questions about the server, please let us know.

Query: PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPAKGSEDERVVICPDMMWGSCARNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPSMLFANEELDRECVTVPFETELHLESSKMTGKFYTFGHHEENARPHKLast
1 -117.000PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali  100  1MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPAKGSEDERVVICPDMMWGSCARNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPSMLFANEELDRECVTVPFETELHLESSKMTGKFYTFGHHEENARPHK 267
2 -16.500PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  23HNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLLNFNASTIDATTTETRSMSVTKDNASRGEIFEGSRNLKATMSRPSGDAPWNWEFSNTVVTPRGPEGKPLRVIAYYPAIAGTENFTDG------IPFDFTQTNNPQQKEILYNTN------------------TSYTIPSSGGSDKVTIPLKFQHAYSWISIKVTKSVDKGSHKLSGVSIDNLSGKINPATGMAMQGAIQGPIGEVRTAEVLDPSGD............... 276
3 -13.700HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  1MKKLLLAMIAVAALISFAACDHNE---------------TYADQRDRELDSINAFL-AGDKAVKLTDTDPNNNEYVLFESNGIYMQVINDGCGDYIAKGKTQNV................................................................................................................................................................... 109
4 -12.700PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIELFIYCLLAGTSLLASCNSEDMTDNPVETLS----------EGMYPLTFTAMQGEVVATPQTRVSDYDDTDGKHK---SKWD----GGEVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIP-------QSTASQTVYGWYP------NTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVKFRVKLN--GDVPNLSDAKVFFYGYP-TCKNEYGTVIPQGDKT--YLATRKVGDYYTAML.............. 222
5 -12.600PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  16  1MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELACHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFTMIPGKDAIITG--YGTYQQLTDNSYKESIEKNIHL..................................................................................................................................................................... 105
6 -12.200PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  11  13IFKALALCLFAAVSFTFVSCDDDDIQQSYPQTVEIRCELKKTGDFANTLYTIRYFQFEGEGTLKMDNGITFLPNDRYLLENEKFRLYYTAQGDEAHNFI........................................................................................................................................................................ 127
7 -10.900PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  1MKKYLKLFLLAVAMINLTSCEIEI-GGSYYNKSLDLCSRPWADTFYDADGNYQELNFYLDRHGEDYIRVESVYSFTWNWEDRSQYSLRMVYGPGDVSY......................................................................................................................................................................... 120
8 -10.200HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  12  1MRKILLCLIAYPIISIVSSCSEEEDCMNARPMMQCYLYKIDGETERVVNDTLDSLITAFGTDSIILNNQKRVHGLSLPLRYTALVFHY-KKDTIVIRQKNTPYFLSMDC.............................................................................................................................................................. 124
9 -9.870PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  10  1MKKTI-FYSLFSALFMLTSCSMFEIDNYEEPSETIWGEVVDEATGKRVLEGIRVRLTENVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNV----EFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGT............... 257
10 -9.480PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  4IKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAK--WLDDETETPL--DTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRY------YVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICVYEGKKSLYAKDITKQMFVDVIPTDFLQQAILSDMNFIGIDRKGYHYQALVCIPESPVCNLVNLTISFDGKLNITAAKY. 272
11 -9.370HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  2MRRKNITWVWLLGAAFMVGCGKQVPENIIQPDRMENILYD---------------YHLSISMGNNLSYSDNYQKEAY------KNYVFEKHHITEAEFDSSMVWYTRHTEE--------------------------------ASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTRKLYWLTDVPLANKVTFEIPADSNFKAKDAFLWSAD................................................... 171
12 -9.090PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1MKILSFIASFFMVSFVITSCLDDDNNIEYSPDATIHFALDTAGLGS-TIDQLSREIYNEDS-LPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVN-VHQHDPDSLRWNHVGKMQDEIIGEQKTIEFNNKILTYSVVEGKNLKVYQNSNYSNWT---AAGTNTTGDLTSTLPNSILPLNGIILATANN----------KVYESTDGVAWTI................ 241

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.