current user: public

If you have questions about the server, please let us know.

Query: PB032242 Q8FLW6_COREF/1-257 PB032242; Pfam-B_32242;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MAITSAPPVTTPAPTAQSVAADAAMSRFETQTSRYGSLTMTAGLILSLLGPAYLVFFADLQITAGMVWVAFLAVAAIFGVLWFVEPLTYFPILGSAAMYQAFMIGNISNKLVPAAIVAQSSIGAKAGSKRGDLAAVMAIGGAATMHLLSLLIFVGFLGTWLVSLVPVEVIEVARLYIMPSLMGAVLVQAIVSMRNVRATVVALGLAVVIQLLVVPAFPQLGMFATAVVVISSIIINWVVRDRRGQVTIQSEAAPEPNLast
1 -111.000PB032242 Q8FLW6_COREF/1-257 PB032242; Pfam-B_32242;  ali  100  1MAITSAPPVTTPAPTAQSVAADAAMSRFETQTSRYGSLTMTAGLILSLLGPAYLVFFADLQITAGMVWVAFLAVAAIFGVLWFVEPLTYFPILGSAAMYQAFMIGNISNKLVPAAIVAQSSIGAKAGSKRGDLAAVMAIGGAATMHLLSLLIFVGFLGTWLVSLVPVEVIEVARLYIMPSLMGAVLVQAIVSMRNVRATVVALGLAVVIQLLVVPAFPQLGMFATAVVVISSIIINWVVRDRRGQVTIQSEAAPEPN 257
2 -3.210PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  10  1...................................................................................MDPPVCSP--GRFGCYLLLFA-------CPIIFAS---------IMKKEFIGRTASLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIV............................................................................ 84
3 -3.060PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali follow..  22  72.................................................................................................................AATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFLLP.............................................................................. 137
4 -2.840PB069407 _HOMD.0084606_ pint_c_2_12 Prevotella intermedia 17 [3585 - 4295] ORF  ali follow..  92......................................................................................................FVNQKTGKPAKVWIRT-----ADVNYQSPRYFIAVKSLCYFVMVVLLITVLVLSFKLIARFRNSENIFLMRNLKLIRIMAFSILAYYIIWWGITLVEVYFIQQSFSLAGQPIDIAGSLDFPNGLFEIPFIFIIYEIFAIGVRMREENQ....... 234
5 -2.730PB006205 Q3F123_BACTI/1-181 PB006205; Pfam-B_6205;  ali follow..  1........MKEKESKSIIVYCFGSYMNYMRRQYEIMGYRLPRAVAAVEAGLVAFRFLPPFKWIFGDMIDQVWLMYYGVIPLFLVWGADKYKTDGKS-SWITFR.......................................................................................................................................................... 108
6 -2.450PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  10  1...........................................................................................................................MNEGIPE-QLIRRLSDASRLVPLALLAVVAAVI-------------------YVWRPLFHGLIYRVAYSPSLLILVGTTVVAGIALVFWPRMGEDPLESAVTKWSILGTIVVAALVL................. 97
7 -1.940PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  1............................................................................................................................................................................ASYISVPRDLTKVKSKVMFNLTKRQLICFGMAVLIGVPSFFLMKTVMKTNTAVMGMMVIMMPFFFLAMYE............... 70
8 -1.870HGC00962 gi|162759780|dbj|BAAZ01005693.1|3.0 TMP01305;  ali follow..  19  76..................................................................................................YCGRLHAERTGAYLPRALQGVLEGTLGVFGERGRLLLKLAVEHNMTNHLLGGDMDM....................................................................................................... 132
9 -1.860PB053359 gi|153891307|ref|ZP_02012332.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]gi|151582630|gb|EDN46158.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]  ali follow..  14  1...........................................................................................LIAPDGSFPPV--GRSIAYRCGAALRRELPEGVAPAQVRGALTAVIRDNDTGNDGAGWLRIGLAGHQPGLGEVYISTCTTAFLPLGLPA............................................................................. 108
10 -1.830PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  12  31.AATSKPPSGNLPKSGETRKQPTIKNEFINEKRKMRMNLPKVKMLQVSKCLIGLAVM........................................................................................................................................................................................................ 86

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.