current user: public

If you have questions about the server, please let us know.

Query: PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MSIFANLFKKQADADAKVVGNVEDFVSLTRVYFQSVIAVNLGITNIRFLPDVANFKRLFKVATQGGKLGLAEKSASRKMLMQDYGISESFFKEIDTSIKKNCRTQNDVQAYLFMYQGFSSDLMMLMGNLMQWKFRMPAIFKKALRSMTEKTVHDVCTKTVWKADDVHKTAAAVRQYKERLGFSEQWMSEYVYNIVLLAKKEPKHKDEEAKALast
1 -129.000PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali  100  1MSIFANLFKKQADADAKVVGNVEDFVSLTRVYFQSVIAVNLGITNIRFLPDVANFKRLFKVATQGGKLGLAEKSASRKMLMQDYGISESFFKEIDTSIKKNCRTQNDVQAYLFMYQGFSSDLMMLMGNLMQWKFRMPAIFKKALRSMTEKTVHDVCTKTVWKADDVHKTAAAVRQYKERLGFSEQWMSEYVYNIVLLAKKEPKHKDEEAKA 211
2 -4.200HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  1...............................................................MSKKKRGEERMKEEDNILKKFKVPEGYFENLTSEVMGKLPEKE......................................................................................................... 49
3 -3.340HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  1.................................................................................................MKDRLSQWKEFYMIFVPMLHYLQNKNSFSGNEDGMRYLITPGKRSV-GGEEAKKEEAILTVDLWPEPWTLDKTDPALRRREIFPMTEEYLND-HPSILDCEPWTPPAPEPDAET 134
4 -2.940PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  17  156..........SELEGKPRQVNRLAATRIMRVLTFQRLTDVYG-----------------DVPYFD-----AGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTF------GADLFF--GSIEQWK.............................................................................. 250
5 -2.850PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8]  ali follow..  10  64.......................................................................EAMGKKATFGNNITLTPDECRTLKDYAVSSFAEKAEKLKYKQKYEQAEKSASVWKRRFEALNEKYLELKKKA------------------------------QPYLDALEIASEKVRAFLDAVLARGKETRELKIPARKR 173
6 -2.710PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  11  1................................MSNILILIIGVLVLGLVAALTEIRHSHKRRAAEAKGESLPEEPVRVVPPGCCGMHITYYEELDRYAGVLPEEYNTEAVEEFEEILSTEEVPSWIRSLQMRQIQMPISIKEQALFIVSE............................................................. 138
7 -2.640PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  1.....................MQWVLTFVEMYGTYFILGSFLLNLLLVLLLIIYNTTTSNLKDKYKRLVKGTDGKNIESVLMQHIEKVEEAQVEVEKVHKRLDIINN-KVGMVRYNAFAD-----MGSDLSYSY-----------ALLDENNNGMIITGIYGRSETVTYAKPVKDGKSNYSLSVE-------QALQRAKENTIDTLELQGF 175
8 -2.400HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  16  2........................FEYILREIFLSVIAFLAGVLVIGVVPRILRCSRIENIILIENVMICGVSNICGNIIIAIYGLCVGIFAEILHTFPIIYKRMKLRAGLGIIVISMA--IGKALGALYYFLTGF........................................................................... 154
9 -2.260PB014033 A5ZI39_9BACE/1-158 PB014033; Pfam-B_14033;  ali follow..  10  2..............................................................................AMHTWFECKIRYEKVMENGMQKKVT-----EPYLVDALSFTEAEARIIEEMTPFISG-----EFTVSDIKRANYSELFPSDEESADRWFKCKLIFITLDEKSGAEKKTSTQVLVQAADLRDAVKK........ 116
10 -2.100HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  12  185........................................................................RVQADRLILDIWNQVEAKFQDVSPNEKR----LEKCRDYGLIIIIGPEKNRIRRFFKICLSIHIPIFFWKSLQKIT............................................................... 256

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24