current user: public

If you have questions about the server, please let us know.

Query: PB034180 _Gut.Meta.Jp.0112129_ gi|163310377|dbj|BABD01000320.1||2 (+ 509:1679~0 complete), from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MNKLQIYTNDWLKIHPYTAVQPSDSYFVNLSNKLYGACTLTTLPDIFRKKLGMYIAAYLEDQISELGLWQSFTAEHKRLYGKYLPFYPTNSNYVADEINEEDIRFIIWNTWQKAASLHEKTYINPNEHAIKEQAGIFYGILEEAYENAPENESLNHYFDHPGTAVEADRKLTWLFGHSYLTEPSMLPYIEQIAPNDRFIVPVGPLALFLHEWISLLTTSDAWKQINGLFTGNPEIPQEIQDKNREIYRNFIEGTNGKRIVYLNGYTELRRFLVNVLKWQDDDNHTLPQMKEYKNFILMTEPEKGVLLAKDICEYIADRENPLYDSERAQANAFRMLTEEMLCPPDLLVHCINNKLIPDAQLPDGTEKELVQQNADFIARHSLLYYYRGLast
1 -121.000PB034180 _Gut.Meta.Jp.0112129_ gi|163310377|dbj|BABD01000320.1||2 (+ 509:1679~0 complete)  ali  100  1MNKLQIYTNDWLKIHPYTAVQPSDSYFVNLSNKLYGACTLTTLPDIFRKKLGMYIAAYLEDQISELGLWQSFTAEHKRLYGKYLPFYPTNSNYVADEINEEDIRFIIWNTWQKAASLHEKTYINPNEHAIKEQAGIFYGILEEAYENAPENESLNHYFDHPGTAVEADRKLTWLFGHSYLTEPSMLPYIEQIAPNDRFIVPVGPLALFLHEWISLLTTSDAWKQINGLFTGNPEIPQEIQDKNREIYRNFIEGTNGKRIVYLNGYTELRRFLVNVLKWQDDDNHTLPQMKEYKNFILMTEPEKGVLLAKDICEYIADRENPLYDSERAQANAFRMLTEEMLCPPDLLVHCINNKLIPDAQLPDGTEKELVQQNADFIARHSLLYYYRG 388
2 -2.830HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  17  11MKEEDNILKKVGKKNSFKVP---EGYFENLTSEVMGKLPEKE.......................................................................................................................................................................................................................................................................................................................................................... 49
3 -2.310PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali follow..  13  26.HSKTVYAFGIAA-----SFTDTVVYFTDIQILDSAKVSKEGF--THRDLYSYQLKNYVEDNGLQQNYFSENRKKLEKEATKILSKYKRNRNTTVTRIDTDKFHF........................................................................................................................................................................................................................................................................................... 128
4 -2.280PB022697 Q5LAY4_BACFN/1-165 PB022697; Pfam-B_22697;  ali follow..  13  3....EVTDASLQKAAGEGMDEFIQVFTDKYKEVIGGELTAETMPLLTGEQHSLLAYQIFRDEVMFGG----FCQLIQNGYGGYIFDNPFAKVM--RLWGAEDFSKLVYKAKKIYDAHRHDLEKERTEDEFMAMYEQYEAFLEEEYLDIEEEALVASYVDDHLELF............................................................................................................................................................................................................................... 161
5 -2.210PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  12  17.KRRKVWRRSWATSKPPSGNLPKS----EFINEKRKM--RMNLPKVKMLQVSKCLIGLAVMMLQSCGNWES............................................................................................................................................................................................................................................................................................................................. 107
6 -1.860PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  12  82.................QCKSEVDQEACIYADEVRKLRQREYDNADLKERLQQNFIGYFREAMYKLVNWKRAMDFLKMYAGENLPFFKIDNAFAEE.................................................................................................................................................................................................................................................................................................... 180
7 -1.800PB005346 A0R807_PELPD/1-258 PB005346; Pfam-B_5346;  ali follow..  17  137.......IRTLLHKAGYKDDADCEGMLLELRSRIGG-------NNSFPHEIGLFIGYPAKDVAA-QRLWKIYPARSLALAEQY................................................................................................................................................................................................................................................................................................................. 217
8 -1.750PB076697 gi|160881556|ref|YP_001560524.1| hypothetical protein Cphy_3432 [Clostridium phytofermentans ISDg]gi|160430222|gb|ABX43785.1| conserved hypothetical protein [Clostridium phytofermentans ISDg]  ali follow..  45.......................DLDEEDILDENIEQKPVSSTTSAKLGTVFSKTESVINESIPGRLSLIDWNGLAQRILQKRVRIAHKNFTVLDKYLKSVGTKLLYVQAPYKVNRDNNQLPYGLKDYPNKNADKLLEGLNKLKIDYIDFREVFANNFLDYPSLF-FNTDHHWTTEAAFF---AYQYMLDYMEKNYEFQYNKQTYNGANYNQVTL---IGSLANRVGKRYAGIDDFTFIYPNFKTKLTYMKFDANGSLYLVRNGTFEESVFYPERMDDPNTPLAYIINHKVQKGKILFVQDSYGKPIASFMALNFHE----IIDLRYFTESYLMDFIKKETTPYDYVVILYNPSALKRS............................. 418
9 -1.720HGC00164 gi|163636082|dbj|BABG01000191.1|4.0 TMP00833;  ali follow..  17  1MNDLIVYERKFIR-----SGLDISPIIMPISQYRNTPYRFLENRTDCFKGLPGLFADSLPD-GEEITPLDRLCYVGKRGMGA-LEFEPSSPINGMNESSVLHIEELT......................................................................................................................................................................................................................................................................................... 141
10 -1.700PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  12  162MNVKNDTAKSGAPVYLFEVKAPYETYLGGLDRQEIINLKDLNEKLGRYSGLMV-----IDNPNNGAGNW............................................................................................................................................................................................................................................................................................................................... 227

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.