current user: public

If you have questions about the server, please let us know.

Query: PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAPLast
1 -87.500PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali  100  1MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAP 189
2 -5.890PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIERLFIYCLL-PVETLSEGMYPLTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDGG----------------------------EVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYDISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQ----LVKFRVKLNGD. 176
3 -5.500PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  2VCGAKVSLEILVTELYTDEKGCVSITIGLGDIHIRAVKDGFRTQEEITLILNDNLLSKDWVTDSWEMCEVKDSVKYQFNLTREQQATNRSKLREAKLLRENRIESYYDEALAENVPDAKEILAKGNFMEIYRFLTVDGNNVDSN---------QDRLALLKTLKVKDYK--DVTASVLEDH........ 191
4 -3.810PB022697 Q5LAY4_BACFN/1-165 PB022697; Pfam-B_22697;  ali follow..  85...................................................................................................................KVMRLWGAEDFSKLVYKAKKIYDAHRHDLEKERTEDEFMAMYEQYEAFDDLEEEYLDIEEEVTALVASYVDDHL 158
5 -3.470PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali follow..  65.SYKILHVNFMLVSSDPSVTGYKSVMMRL................................................................................................................................................................ 92
6 -2.790PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  21  74.........................................................................................................................................................KQTIKQLNA-QGVQLSNIKITDENIKSFDRVARK.. 106
7 -2.730HGC00816 gi|163609134|dbj|BABG01026932.1|1.0 TMP01075;  ali follow..  12.AEKRLSTRQFIGAKEITYGQGELVYFIVKPTNISVLSESSVGARIYALMTVLKGVAEIEMLCLNS---RESFEDNKRFLKSQMEQEENPVIRRLLEQDQTHLDRIQVQMATAREFLIMLRLKDEKESDIFPYLSRIEKSLKEQSFSVKRADKEDIKRILAVYYEQNVTTEKFED----DGERWI--IP 197
8 -2.680PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali follow..  16  4.....................................................................................................................................................LLPLEAMEYEINKGAGNPLEFKGLKSQYLFIFAGGL.... 39
9 -2.610PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  11  2....................................................................................................................................................SVREGELLDEAVDFCRKRGLEFYAVNSNMPEEEADM..... 37
10 -2.570HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  3..........................................................................................................................................KKKRGEERMKEEDNILKKVGKKNSFKVPEGYFENLTSEVMGKLPE...... 47

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.