current user: public

If you have questions about the server, please let us know.

Query: PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MGTIVYLSIRLACACYILYKVCGQKKKIREICDLLYTKLPPVKEKELENVLSEPGGESGIMGSTCFVYLDEDAGKSVAPYMSQPLETAADFIGEEEDVAEEEVECKLPLEEMRMLKEEQEELDGTYPAVDAVSRVVTPDDLDNAGNVLFKLNDADKDEEKSLRAALTLHTIRETDLFEIFSSQVENKNVIDSLMGKYLDGNGNPLSVRKTKSVVPVSDGWKQYLast
1 -87.600PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;  ali  100  1MGTIVYLSIRLACACYILYKVCGQKKKIREICDLLYTKLPPVKEKELENVLSEPGGESGIMGSTCFVYLDEDAGKSVAPYMSQPLETAADFIGEEEDVAEEEVECKLPLEEMRMLKEEQEELDGTYPAVDAVSRVVTPDDLDNAGNVLFKLNDADKDEEKSLRAALTLHTIRETDLFEIFSSQVENKNVIDSLMGKYLDGNGNPLSVRKTKSVVPVSDGWKQY 223
2 -55.800PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;  ali follow..  13  1MTKVFLIVSVACNVWFLLMLLSTKFVRFLKGAAGLWRSLGTKSEKQDTLHSEASDEDADIIGKSRFRMAPTRTTAAISTQEAAISEKGIELSEEEAQVPEDKLDETFTSISPEELEYGEDE-PEDDEPGKGQASGSAFEDIDMAVRTIKKDS---PSEAEMRHAGKVMTELDGTELYSRITERLTDEERLAKAMAVFVDTVNTTVAQPKTKLDNIEEFEIRNN 245
3 -52.900PB003564 gi|46242789|gb|AAS83494.1| TraD [Bacteroides fragilis]  ali follow..  12  1MTKAFLIVSVACNVWFLFLLFYTKLIRFFRHIAGLWRSLDSTVAEQGKDKEIPHADTSDIIGKSRFKMASTRTTAAIPTQEAATSEKGIELSEEEAQVPEDKLDETFTSIPPSE-LEYGEDKPEDEEPDKKQASGSSFEDIDMAVHTIWKES---PSDEEMRHAGKVMTELDGTELFTRITERLTDSERLAKAMAVFVDTVNMTVTQQKEKPDNIEEFDFR.. 243
4 -4.550PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  11  1MSNILILIIGVLVLGLVAALTEIRHS----------KRRAAEAKGESLPEEPVRVVPPGCCGMHITCEKDSLLTAVSK---------------SIVYYDDEELDRYAGVLPEEYNTEA-------------------VEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQAL--FIVSEHRIQHR.................................. 144
5 -3.760PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali follow..  10  2..........................................................TLLGDKTASPYDTGTPVPGPGGMAVTYEQVATGGLPVAGLERPVVPRL--------------------SAGLKLHGEYQGSGFTEPKYIARRGDGQ----QLSRLLHLVASSVDGSRDIETIAHRVSGRDNVRYLIEQKLDPLGVTVPEGREEEDISAP...... 145
6 -3.490PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  13  34...........................................................TIGLGDIHIRAVKDGFFAEAMGHVRTQEEITLILNDNLLSKDWVTDSWEMCEVEAPKDSVKYQFNLTREQQATNR----SKLREAKLLRENRIESYYDEALAENV---------PDAKEILHLAKGNFMEIYRFLTVD-GNNVDSNQDRLALLKTLKVKDYKD. 182
7 -3.330PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIERLFIYCLLAGTSLLAS------------------------NSEDMTDNPVETLSE--GMYPLTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYPNTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQ-LNLEHQLVKFR--KLNGDVPNLSDAKVFFYGYPTCKNEY. 197
8 -3.320PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  1MKRNYFFTMLAAVLLAVA---------------------------GANAQESAEFRPAELAGIWQLCHYVSEIPDVPGILKPSNTSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDHKDNILE-------EIGDDGVMYLKYFIAKDLNGNELNTWFHETWKRVGMPAKFPEDL................................. 161
9 -3.190PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  14  1MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGENNAMQAITNRSFVL........................................................................................................................................................... 71
10 -3.170PB019278 gi|154508461|ref|ZP_02044103.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982]gi|153798095|gb|EDN80515.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982]  ali follow..  24..................................AKVELRAMMEDAYADAIASGMTHNEAVGRVITDFGNLQEIAPVLGIADDLTAAEKAPQPEAAPAPAGTEGVGAPSRPRVTLPEAQELAEARRRGAASLGLSVAILVSTGIPLFAFRGLSETGLVPFNEDTATLLTRSRLFTNVKHLVDLFTPDPIVTAWAARLRLEHEDR................... 211

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35