current user: public

If you have questions about the server, please let us know.

Query: PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst LQEEVNQKVISLSIQGVKITASVLKAAVRKFLEMDNRRKQKATQVKMAEKTGRAQEKGREKARKKIEKKKPHGKQTIKQLNAQGVQLSNIKITDENIKSFDRVARKYGIDYSLKKEVGADPPKYLVFFKAKDVDVMTAAFREYAGVELKKKQVKKPSVRKKLQKSVERKAKHRQRVKQRQKSRGQELast
1 -75.000PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali  100  1LQEEVNQKVISLSIQGVKITASVLKAAVRKFLEMDNRRKQKATQVKMAEKTGRAQEKGREKARKKIEKKKPHGKQTIKQLNAQGVQLSNIKITDENIKSFDRVARKYGIDYSLKKEVGADPPKYLVFFKAKDVDVMTAAFREYAGVELKKKQVKKPSVRKKLQKSVERKAKHRQRVKQRQKSRGQE 186
2 -5.020PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali follow..  9..............................................................FGLGIAVCLFSATNSIAQVKTHSSLRAENLEVILVKD-KSSYKILHVNFMLVSSDPSVTGYKSVMMRLIDPH.................................................... 96
3 -4.250HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  22..................................................................GKQVPENIIQPDRMENILYDYHLSI-NYQKEAYKNYVFEKHHITEAEFDSS--------MVWYTRHTEELASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTVD........... 131
4 -3.020PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali follow..  90....................................................................SSVDGSRDIETIAHRVSGRFGREVSADNVRYLEQKLDPLGV............................................................................. 131
5 -3.000PB022815 A4DEQ0_LISMO/1-452 PB022815; Pfam-B_22815;  ali follow..  13  362..........................................................................KQASDLLTEGKALSH--VGGSNY--IKQHIEGKTTIIFVRDKQDLEKSLYTLEYKNGQIKDVQMAANKWAKLLKSKTKVLQN.............................. 452
6 -2.940PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  5............................................................................................EGELLDEAVDFCRKRGLEFYAVNSNRSRKVSADMYIDDRNLGVIYEMVHNRWSYNRYLNEIHDFERSQKVSWWKRLINKK.............. 101
7 -2.870PB044863 Q5LB69_BACFN/1-105 PB044863; Pfam-B_44863;  ali follow..  12  1............................................................................MYTIQANPSGTRSMEISEENLVTIEK--------YSLFQHLIDSNG----IVDEAVLEKLKLNIRSLIASQEEDSKD................................. 65
8 -2.800HGC00928 gi|162868028|dbj|BABB01001979.1|3.0 TMP01255;  ali follow..  13  8......................................................................PMARTATEKLEMRGQSVTVENIGKTVTDGFEKVSNN--VNDFISSDKPRNFFQKLADVFVLVIGFILKFFIILAG......................................... 80
9 -2.800HGC00762 gi|162641591|dbj|BAAX01018014.1|1.0 TMP00997;  ali follow..  13  9...........................................................................QLKKLNNSSS--KNMTMEENTVHPARKLLL................................................................................. 39
10 -2.790PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  21  154.........................................................................KRAMDFLKMAGENLPFFKIDNAFAEEYKRFLLT................................................................................ 187

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.