current user: public

If you have questions about the server, please let us know.

Query: PB053359 gi|153891307|ref|ZP_02012332.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]gi|151582630|gb|EDN46158.1| conserved hypothetical protein [Opitutaceae bacterium TAV2], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst LIAPDGSFPPVGRSIAYRCGAFQLLAQMALRRELPEGVAPAQVRGALTAVIRRTLGAPGTFDNDTGNDGAGWLRIGLAGHQPGLGEVYISTGSLYLCTTAFLPLGLPASDDFWSQPDAPWTSARVWLast
1 -85.400PB053359 gi|153891307|ref|ZP_02012332.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]gi|151582630|gb|EDN46158.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]  ali  100  1LIAPDGSFPPVGRSIAYRCGAFQLLAQMALRRELPEGVAPAQVRGALTAVIRRTLGAPGTFDNDTGNDGAGWLRIGLAGHQPGLGEVYISTGSLYLCTTAFLPLGLPASDDFWSQPDAPWTSARVW 126
2 -5.620PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali follow..  10  30...............VYAFGIAASFTDTVVYFTDIQILDSAKVKEGFLTHRDLYSYQLKNYVEDNGLQQNSTCMIYFSENRKKLEKEATKILSKYKRNRNTTVTRIDTDKFHFIKPE......... 132
3 -5.270HGC00552 gi|162599220|dbj|BAAV01006262.1|2.0 TMP00636;  ali follow..  16  2............RKFNYKVMLVVVLAITCLMATTAFAAGTGDVAGAVESTWSTASTQIKSVVDNVVFPADLILAVFFFAKLGTAYFEYRKSGQFEWAAPAILVFTLTAPMYLWS............ 111
4 -4.160PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  12  8........IQFSK---IRSRSCPFMQQNKFRKAIVAILMPMILVVSFGNCFGKFAIVKKVYEVNDGFNIGSGLLAKFIKTLVMYF-------SILYFVGFFFDLILFNLIEFWSGNN......... 108
5 -3.440PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  15  254.............................................................LEDRFQPSDSLMT-------ETLARVYVEQKNFSKAKQAYLSLKYPEKSGFFADQIRAIEKLQ.. 311
6 -3.160PB048420 Q64S71_BACFR/1-165 PB048420; Pfam-B_48420;  ali follow..  1..............MEIQFVIVRSENAEYLCHNVNGTYVD------VSDPSTEFVSGEDDFRLVDPDSSLTRKEYEFRGERFYLMPQFYGNGWLA------LTLQSVEDETEYIVLSVNLE..... 95
7 -3.140PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  240...............................................................................DIDYKSYDMVNKENMPYG------LAVSNGNGTFSYPQEKNSLFETY 280
8 -2.390PB007733 A3U921_9FLAO/1-209 PB007733; Pfam-B_7733;  ali follow..  10  67...............VWPYAKLASERLSELNARL-ASIKSKSERRKYTKIVQKYIEEQFAAELKKLTRTEGQILVKLIHRQTQLIKNLRSGWRAFWTTAGLFDIELKSEYN--VNNREDFLIEDI. 181
9 -2.360PB000716 Q60CS7_METCA/1-294 PB000716; Pfam-B_716;  ali follow..  16  17....................................................................................LKQTNAHGAEYWSARELQPLL---GYSQWRRFEQ--AIERA. 52
10 -2.340PB027778 Q5LHJ0_BACFN/1-110 PB027778; Pfam-B_27778;  ali follow..  11  11...............DADDEKTIEFIRNYLPQELKEKFSEDELYYFLDLIDEYYSESGILDVQP---DADGYVDIDLEQVVEFIVKEAKKDEVGEYDPEDILFVV..................... 97

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.