current user: public

If you have questions about the server, please let us know.

Query: PB062605 Q9F6T7_BACTN/1-105 PB062605; Pfam-B_62605;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKRKVKSIRKTMWGVYWKLHDKRKRLVERLKGYLDGLPPETCRRIVLGMLAAFAVLALYTFGRAAYDIGRNDGSRMETGHAGRVELPTPAETDNHLTPYLYGTEELast
1 -71.100PB062605 Q9F6T7_BACTN/1-105 PB062605; Pfam-B_62605;  ali  100  1MKRKVKSIRKTMWGVYWKLHDKRKRLVERLKGYLDGLPPETCRRIVLGMLAAFAVLALYTFGRAAYDIGRNDGSRMETGHAGRVELPTPAETDNHLTPYLYGTEE 105
2 -4.070PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  19  1.........................MNEGIPEQLIRRLSDASRLVPLALLAVVAAV-IYVWRPLFHGL..................................... 42
3 -3.750PB002770 Q744K2_MYCPA/1-559 PB002770; Pfam-B_2770;  ali follow..  8........................QCVRGNRNTAWPLAARLFPAMFALLMLVIAGTGSAAAQPSPWTARPFGDRLVGWDTYRRLDLPYLSADTQSLQLSSFDRS. 88
4 -3.360PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  15  2.......................................KTVFNIVLVLCAAALIYICYSSIMGPINFEKAKKER-RLIDIRKAQQEYRS............... 57
5 -3.210PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali follow..  20  4.........................................................LLPLEAMEYEINKGAGNPLEFKGLKSQYL................... 32
6 -3.020PB069407 _HOMD.0084606_ pint_c_2_12 Prevotella intermedia 17 [3585 - 4295] ORF  ali follow..  25  1.........................MNKRLNLYC---------TILLCIMSAVILYSFYAVSKDMVS-GFTAGVR.............................. 40
7 -2.920PB027778 Q5LHJ0_BACFN/1-110 PB027778; Pfam-B_27778;  ali follow..  10  15..........................EKTIEFIRNYLPQELKEKFS--LYYFLDLIDEYYSESGILDVQPDADGYVDIDLEQVVEFIVKEAKKDEVGEYD..... 89
8 -2.840PB000520 Q9RVX4_DEIRA/1-194 PB000520; Pfam-B_520;  ali follow..  11  62ATDRVRGLTSRFKQLVSAEGQNEPLAREEKRLIIRQLPRLSRRTRFLMRALQAFYTSVALLVLTSILLGLDGLFDVNTGSL........................ 142
9 -2.820PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  2........................................KIKFLSFIASFFMVSFVITSCLDDDNNIEYSPDATIHAFALDTAGLGSYKFTIDQLSREIYNEDS 66
10 -2.740PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  1...........MHNFKEKIQFSKIRSRSCPFMQQNKFRKAIVAILMPMILVVSFGNCFFAIVKKVYEVNDG.................................. 62

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.