current user: public

If you have questions about the server, please let us know.

Query: PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst METIKFNSEAHELFYKEMLARTNQTDVYYKAFFYCMGICETTRKHIEDLFDFKEGGIMPEHLHQPYQTGTSYKVTRMAYNLWNGYVEEGTESLTTPSSLFACEYAAEFHQAIKIRFSEYYRERDFEKSSLRKQIKDLTEKNVIESTNAKEHSEIELast
1 -110.000PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;  ali  100  1METIKFNSEAHELFYKEMLARTNQTDVYYKAFFYCMGICETTRKHIEDLFDFKEGGIMPEHLHQPYQTGTSYKVTRMAYNLWNGYVEEGTESLTTPSSLFACEYAAEFHQAIKIRFSEYYRERDFEKSSLRKQIKDLTEKNVIESTNAKEHSEIE 155
2 -4.760PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  10  41...........KDKYKRLVKGTDGKNIE-----------SVLMQHIEKVEEAQVEVEKVHKRLDIINNRMSFCIQKVGMVRYNAFADMG-SDLSYSYALLDENNNGMIITGIYGRSETVTYAKPVKDGKSNYSLSVEELQALQRAKENTIDT... 169
3 -3.470HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  62......EQSRNSKKHQANVKTARLYISHFIQVLNLAVIRMEIKESHKALYGLPVDNFSVPDL------SSEASLAEWGQKIIEGERKRTSQ---------GIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQRVQADRLILDIWNQVE 200
4 -3.250PB006205 Q3F123_BACTI/1-181 PB006205; Pfam-B_6205;  ali follow..  14  131.........................................................................................................HVCVQHDVKDLPIVHSFSEEENDIHAYDVTFLPQKEEVEYVEKDEQTTIK 180
5 -2.850HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;  ali follow..  13  89...............................................................ALTYFKKRFSLTLAMNNPFMDNYRIGCENWNRRAGNTSYQYVNETSRMLLVKVT-YGMDFGRKRKTAAKRIQNEDTDTGILKGN........ 171
6 -2.110PB038151 Q8A4A5_BACTN/1-178 PB038151; Pfam-B_38151;  ali follow..  15  1........................................................................................................................................MATQAIDATIFASSHPDIA 19
7 -2.110PB000520 Q9RVX4_DEIRA/1-194 PB000520; Pfam-B_520;  ali follow..  10  43..........................................................................................................VLISGAGT--TRVGRATDRVRGLTSRFKQLVSAEGQNEPLAREEKRLII 95
8 -1.980PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali follow..  2................................AFLLPLEAMEYEINKGA----GNPLEFKGLKSQYLFIFAGGLVAVLLVVVILYIAGVNQWICIPFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGKRHPRYLIHRRRLFRLLTKRRK...... 114
9 -1.910PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  11  118...........................................................................................................AQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQKRQG... 162
10 -1.840HGC00816 gi|163609134|dbj|BABG01026932.1|1.0 TMP01075;  ali follow..  106........RRLLEQDQTHLDRIQVQMATAREFLIMLRLKDEKESDIFPYLSRIEKSLKEQSFSVKRADKED--IKRILAVYYE........................................................................ 178

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.