current user: public

If you have questions about the server, please let us know.

Query: PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MKKTIFYSLFSALFMLTSCSMFEIDNYEEPSETIWGEVVDEATGKRVLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGTRRWNYSEPMELast
1 -88.900PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali  100  1MKKTIFYSLFSALFMLTSCSMFEIDNYEEPSETIWGEVVDEATGKRVLTDQGSEGIRVRLTELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDEYLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVFVRAAARINYDTPVGSGTRRWNYSEPME 267
2 -13.700PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  13  1MKRNYFFTMLAAVLLAVAGANAQ-ESAEFRPAELAGQLCHYVSEIPDVPGILKPSNTFKVL----------------SDDGRIVNFTMIPGTYQQLTDNSYKESIEKNIHLPDHKDNILEFEIGDDG............................................................................................................................................ 123
3 -9.860PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  10  1MKTGIVTVYALLAMILFSCEHKELCFHHPHMVTLRVDFDWKNAPQADP-----EGMCVYFYP-----EEGESPIRFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPEDERVVICPDMMWGSCARNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPSMLFANEELDRECVTVPFETELHLESSKMTGK.......... 252
4 -8.590PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1MKIKFLSFIASFFMVSFVITSCLDDDNNSPDATIHAFALDTAGLGSYKFTIDQLSREI------------------------YNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWNHVGKMQDEIIGEQKTIEFNNKILTYSVVEGKNLKVYQNSNYSNGTNTTGDLTSTLPNSILPLNGIILA------TANNKVYESTDGVAWTIS.. 242
5 -8.300HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  10  1MKTLKITFVMLMTALFLVLPSCSKDD-VNVTLTPSEEVVNAPDVKNVKWEILVGAYEAEFIYSG--VLDKVEAQAYITQGGKWVRSE--PRAVRETIAAKGKKVDDVKLFDWSDRNDYFYVEFDEPDS........................................................................................................................................... 152
6 -7.990PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  17  1MKKLLCMWMVVCGLLLIPGNMKGQSLKDILNSSAVKNAVTSVTGGKAVTFENLQGT--ALKNVAGSLAATEVFNYVFNSDSTFTSAGSLKGTYSVSPEDKTVTLRYTVGNKKLTSTLTAHVVLSGNETLLFNADKLLKFLSTVSSISSNTTLKAINKLAS........................................................................................................... 194
7 -7.300PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  1MKKVLVALTMVMGMGSAVAFAQEPVKLPAMEQVVKSTLSKDYEGTIVKEKENGKVYKIIV-TAIKEDQSTEEITVLLNEKGEP........................................................................................................................................................................................ 106
8 -6.820PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIERLFIYCLLAGTSLLASCNSEDMTDNPVETL------SEGMYPLTFTAMQGEVVAT---SDYDDTDGKHKSKWDGGEGVKIGTDGAVGSYTLDSDGKPYWQSTASQTVYGWYPNTADISLTGQDNTGNKFPYVLKGVSSKQYSYKEN---VQLNLEHQLVKFRVK---------NGDVPNLSDAKVFFYGYPTCKNEY--GTVIPQGDKTYLATRKVGDYYTAMLAPDTKTSNNFVKIEVYGLT-NPDIELVKGTVYTYT.... 259
9 -6.650HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  1MRKLVILLCLIAYPIISIVSSCSEEE-MNARPMMQCYLYKIDGETELPLRYTADSTVLVFHYSKDVKIKKDTIVIRQKNTPYFLSMDC--GKQSIT-----------GRSYSRHLLDSIYIEVSIYGTENLKL...................................................................................................................................... 162
10 -6.520HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  15  1MKKLLLAMIAVALISFAACDHNEADQRDRELDSIN-KVINEAEFEKRFEARKAGDKAVK----LTDTDPNNNEYVLFESNGIY-MQVINDGC---------------GDYIAKGKTQNVLCRFTEYC............................................................................................................................................ 117

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.