current user: public

If you have questions about the server, please let us know.

Query: PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete), from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MKTKLVAVIALIFCAFMAEASKVEGNGNIITKEISVDNYSEIELGGNIEYSGNNFWGNRSNKKFPVFKYTHGRSASLKITIDENLFPLLSIKSNNGRLAIRIQDGTRIKPTQYVIEGSSKTLKYLKTSGPMDFEAQNAFSEDQLEIKISGSSDVKFPHNVKLRLGEFSVSGSGDLVFADLDCKNLTSKVSGSGDITLKGKADEARYSVLast
1 -73.900PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete)  ali  100  1MKTKLVAVIALIFCAFMAEASKVEGNGNIITKEISVDNYSEIELGGNIEYSGNNFWGNRSNKKFPVFKYTHGRSASLKITIDENLFPLLSIKSNNGRLAIRIQDGTRIKPTQYVIEGSSKTLKYLKTSGPMDFEAQNAFSEDQLEIKISGSSDVKFPHNVKLRLGEFSVSGSGDLVFADLDCKNLTSKVSGSGDITLKGKADEARYSV 208
2 -9.300PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  1MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAI--------TNRSFVLEANS------VQPLNGRVYYVNSNTNVSLNDGQAMVQIAS---PYPGPNGLGGITVQGSASNVQVKQENNGNVYLSMSVQGIFITVNLVLYSGTNNAMVTVDPNFSGNNLTMNGTLLPYSDSNVFQ... 193
3 -6.470PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1MRKLGFTLVAALAFSVSAFANNANDTINVAGKWDGTINKAKLT----------------------YLQLSSQQNEQVASICDYFQEQMKVANSSKKNSDQKVRNAVYGNLKLMKNTLTEKQYSDYL.................................................................................. 105
4 -6.000PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  11  1MKRNYFFTMLAAVLLAVAGAAELAGIWQLCHILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDEFEIGDDGVMY............................................................................................................ 126
5 -5.750PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MKIIYCLLAGTSLLASCNSEDMTDNPVETLSEGMYPLTFTA-MQGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYPNTADISLTGQDN---TGNKFPYVLSKQYSYKENVQLNLEHQLVKFRVKLNDVPNLSDAKVFFYGYPTCKNEYGTVIPQGDKTYLATR. 212
6 -5.740HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  11  1MKTLKITFVMLMTALFLVLPSCSKDDVNVTLTQQKYPDVKNVKWEILVGAYEAEFIYSGTYSENGQHIVLDKVEAQAYITQGGKWVR-SEFDVTKDYQDSSSLV-----PRAVRETIAAKKVDDVKLWSDRNDYFYVEFDEPDSELLINFDGTL...................................................... 162
7 -5.370HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  13  1MKKLLLAMIAVAALISFAACDHNETYADQRDRELDINAFENIKVINEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFE-SNGIYMQVINDGCGDYIAKGKTQNVLCRFTEYCL............................................................................................. 118
8 -5.280PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  11  1MKKTIFYSLFSALFMLTSCSMF------------EIDNYEE-TIWGEVDEATGKRVLTDQGSEGIRVRLTENVQHNPDFYCMMD--TFQNTKIFKGEYNVRIDPFIPLVRENTDGTLLHDGSVNTEISGTTKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREK.................................... 170
9 -4.970PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  1MKTMKFILACVLLLSPLLC----QAQKNLFNKYNDMKGVSSVYISKAMNLFMKDLYIGKVAEHLNSVQVLSTHDNK-SLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYMEGDMTTDDIKKLMLY.................................................................. 152
10 -4.400HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  12  2MRRKNITWVWLLGAAFMVGCGKQVPE-NIIQPDRMENILYDYHLSISMGNNLSYSDNYQKEAYKNYVFEKHHITEA-HTEELASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTVDV-----YDRKLYWLTDVPLANKVTFEIPADSNFK---AKDAFLWSADYIFLSEFDNDSVVGRVKDITCSGVQTLYIKPDSAFAIKSV 223

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.