current user: public

If you have questions about the server, please let us know.

Query: PB155142 _HOMD.0127537_ bfor_c_1_1790 Tannerella forsythia ATCC 43037 [677748 - 680894] ORF, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst STQTSASVLNLINPEDIESQTILKDAAATALYGSRGANGVVLITTKSGRRGKTHIAFTAEYGTSDFATPHALDYMDAGQYAQYTWESLKNKYLYDRKAMPEQAKADTYESLLPEAERYAYRNLAAASGLYHPDDPFDGTFNYKNMTPEQQKMFITNPRIVNWRDAIFKTGAVQKYDLSLNGGGDKTTYYVSFGYLKNDGLVQGSVFERFSGALSLNLKLHDRVLLKLSEKLSRARQDLast
1 -99.900PB155142 _HOMD.0127537_ bfor_c_1_1790 Tannerella forsythia ATCC 43037 [677748 - 680894] ORF  ali  100  1STQTSASVLNLINPEDIESQTILKDAAATALYGSRGANGVVLITTKSGRRGKTHIAFTAEYGTSDFATPHALDYMDAGQYAQYTWESLKNKYLYDRKAMPEQAKADTYESLLPEAERYAYRNLAAASGLYHPDDPFDGTFNYKNMTPEQQKMFITNPRIVNWRDAIFKTGAVQKYDLSLNGGGDKTTYYVSFGYLKNDGLVQGSVFERFSGALSLNLKLHDRVLLKLSEKLSRARQD 237
2 -4.680PB022815 A4DEQ0_LISMO/1-452 PB022815; Pfam-B_22815;  ali follow..  11  353.....IDNYAFIVPKQASDLKALSHCVGGSNYIKQHIEGTIIFVRDKQDLEKSLYTLEYKNG-NCDPTKDVQMAANK-KLLKSKTKVLQN................................................................................................................................................... 452
3 -2.720PB071107 _Gut.Meta.Jp.0066071_ gi|162701604|dbj|BAAY01026246.1||2 (+ 344:749~0 complete)  ali follow..  13AYGYLKQYAVETEEGSVVRIFPLTEEIENVEW-----PGAIVLLTQD.............................................................................................................................................................................................. 55
4 -2.350PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  10  110........FEDTQNGDYDYNDLIIHVKNTASNHAYQHPTEQTIEIQPIALGS---TKTIKLGCILSDGSTHMISDDVRTDLFGGRQGFINTVNDNDPIRYKLASTNIKNYAMPKKEKTSAAWVVDGKRMYAASSDIDYKSYDMVNKENMPYGLAVSNGNGTFSYPQEKNSLFETYDWINGKVSSIGSFQKELVYKYCSGGIIGEDGKSHKIWDYLD..................... 325
5 -2.270PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis]  ali follow..  17  18.........KNLRTDDGLRLEILSPGWWNNEEGPDFKHAEFFLEGKGLIRGSVEIHVFAS................................................................................................................................................................................. 68
6 -2.260PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  16  82......DIINNRMSFCIQKVGMVRDLSYSYALLDENNNGMIITYAKPVKDGKSNYSLSVE................................................................................................................................................................................. 154
7 -2.180PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  14  8.......SLEILNYAEFASVTELYTDEKGCVSITIGLGDIHIRAVKDGFFAEAMGHVRTQEEIT............................................................................................................................................................................. 64
8 -2.090PB002776 gi|157737147|ref|YP_001489830.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]gi|157699001|gb|ABV67161.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]  ali follow..  10  165........LEVIEQFTYPKYYIAKESYNSSVWGHYGQGGVCLIFETNNEGEIPFLNVYTGLKLKEVNYNGNFEEINFFESLGKIPQPLVESFYIDENKNKSILFDKVLNNQEEWRKLF-----------------------------WDKYEKNKLTKTKDW------------------------------TYEKEYRIVLNRLMDYEIKELKYDFNCLKGVIFGIKTPQNKKDE. 342
9 -2.090PB014033 A5ZI39_9BACE/1-158 PB014033; Pfam-B_14033;  ali follow..  14  56.......TVSDIKRANYSELFPSDEESADRWFKCKLI--FITLDEKSGAEKKTSTQV.................................................................................................................................................................................... 103
10 -1.870PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  14  88.....EGTLKMDNGITFLP---LENEKFRLYYTAQGDE-IVVVEDNFGNSYELEFDFNNR................................................................................................................................................................................. 147

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.