current user: public

If you have questions about the server, please let us know.

Query: PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst LTETQFKVQAEQQRLEAVTAQVADVEQSLEKTKAAAEKQKKKLEALQKETKAARATALTVQDIEAMGKKATFGNNITLTPDECRTLKDYAVSSFAEKAEKLKYKQKYEQAEKSASVWKRRFEALNEKYLELKKKAQPYLDALEIASEKVRAFLDAVLARGKETRELKIPARKRGQDMLast
1 -91.500PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8]  ali  100  1LTETQFKVQAEQQRLEAVTAQVADVEQSLEKTKAAAEKQKKKLEALQKETKAARATALTVQDIEAMGKKATFGNNITLTPDECRTLKDYAVSSFAEKAEKLKYKQKYEQAEKSASVWKRRFEALNEKYLELKKKAQPYLDALEIASEKVRAFLDAVLARGKETRELKIPARKRGQDM 177
2 -4.960HGC00762 gi|162641591|dbj|BAAX01018014.1|1.0 TMP00997;  ali follow..  1..MTPYKV---SHQLKKLNNSSSLTKKNMTMEENTVHPARKLLLGQLIAYLLQAVAVVVGFESDLLEVGACAEDFVKYQMLMLMEVLTICFIPMALK................................................................................ 93
3 -3.460HGC00928 gi|162868028|dbj|BABB01001979.1|3.0 TMP01255;  ali follow..  5IIVPMARTATEKLEMRGQSVTVENIGKTVTDGFEKVSNNVNDFISSDKPRNFFQKLADVFVLV.................................................................................................................. 67
4 -3.270HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  18  30....AFLVDKVKDELQKVIDLLESGETDTEVIQETLDEAVCGINDLQEEFDENDS------EIETVARDCI.......................................................................................................... 90
5 -2.960PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  10  33........WDGTINKAKLTKYLQLSSQQNEQVASICDYFQEQMKVANSSKKNSDQKVRNAVYGNLKLMKNT------LTEKQYSDYLRLMAL..................................................................................... 110
6 -2.850PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  10  72...............................................................EKSASRKMLMQDYGISESFFKEIDTSIKKNCRTQNDVQAYLFMYQGFSSDLMMLMGNLMQWKFRMPAIFKKARQYKERLGFSEQWMSEYVYNIVLLAKKEPKHKDEEAKA.... 211
7 -2.800PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  10  46...............................................................LDLCSRPWADTFYDADGNYCYQELNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVYGPGDVSYLDDVWIRGNVLSGYLDG...................... 137
8 -2.690PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  16  103.........KDSKTVESLGKELKASAPEYQGLDAAAVKLNEQADWYETHEKSLSKAVRAVVE--SKAAKRLDDAKTNLTADEASKLLADSDGKVADNA............................................................................... 199
9 -2.530PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;  ali follow..  1.......MKLSQQSLSTIESAIQKAAGKYVC-----GCDQTAVTDIHLQPDQTSGQLTIYNDDDEELANVMIEEWATYDGDDFMENVKPNLKSTLCRMKDAGDFDKVTILKPYSFVLVDEDKETVAELLLIDDDT----ELLKGLDKELDEFLKNLLE................... 147
10 -2.470PB022697 Q5LAY4_BACFN/1-165 PB022697; Pfam-B_22697;  ali follow..  12  2.......IEVTDASLQKAAGEGMDEQVFTDKYKEVIGGEAETMPLLTGEQHSLLAYQIFRDEVMFGGFCQLIQNGYLWGAEDFSKLVYKAKKIYDAHRHDLEKERTEDEFM-AMYEQYEAFDDLEEEYLDIEEEVTALV--ASYVDDHLELFAKIV..................... 165

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.