current user: public

If you have questions about the server, please let us know.

Query: PB162065 _Gut.Meta.Jp.0089312_ gi|162832207|dbj|BABA01012502.1||1 (- 0:1326~0 complete), from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst LIGIFFQKTLKALETVCEGAEVGFITITMEDVDLATADALKRAAASMGIGAQLLALESHRLSYEYYALSQRRELWTHDVGLFEYDRRGLRYHHLSVSWKHHPPVVTAETTVLNQYLDGHELADPVPPEMDRQFLEAIKEVSARRMISTYYLMGEGFSGAESGKSWMNLSLKQLCAMKRHVFAGQNLYARGACYHSFDQGSFGRKPGFIAANAGLLTKDIYLRSVHKHAPQKLILAAAGTPWYSAVSRKAIIIDGQEQLIIRMRDPLTNFEQTVVMTLDALPQRPPKTTKLLIETSFQSETDCHIRVTDMGFGEIFAATGKVWLast
1 -113.000PB162065 _Gut.Meta.Jp.0089312_ gi|162832207|dbj|BABA01012502.1||1 (- 0:1326~0 complete)  ali  100  1LIGIFFQKTLKALETVCEGAEVGFITITMEDVDLATADALKRAAASMGIGAQLLALESHRLSYEYYALSQRRELWTHDVGLFEYDRRGLRYHHLSVSWKHHPPVVTAETTVLNQYLDGHELADPVPPEMDRQFLEAIKEVSARRMISTYYLMGEGFSGAESGKSWMNLSLKQLCAMKRHVFAGQNLYARGACYHSFDQGSFGRKPGFIAANAGLLTKDIYLRSVHKHAPQKLILAAAGTPWYSAVSRKAIIIDGQEQLIIRMRDPLTNFEQTVVMTLDALPQRPPKTTKLLIETSFQSETDCHIRVTDMGFGEIFAATGKVW 322
2 -4.140PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1MKIKFLSFIASFFM-------VSFVITSCLDDDNNIEYSPDATIHAFALDTAGL-------GSYKFTIDQLSREIYNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWVGKMQDEIIGEQKTIEFNNKILTYSV---------------------------------VEGKNLKVYQNSNYSNWTAAGTN------------------------------------TTGDLTSTLPNSILPLNGIILATAN---NKVYESTGVAW 239
3 -3.950HGC00166 gi|163579340|dbj|BABE01005762.1|1.0 TMP00473;  ali follow..  10  29.................................................................................................................................RRALKRRLHAGELVSPYKNLYADRTLWNTMTREQQSLQVIRALSAIHPQWVFAGLS----AACVYGLQHNYSLHDGTVHIASKSGIGGGDEARLNRIYINRIPTRKHNGIL---ARTLLDCAVFPFPQALPIYDSALRKSLTTIEEVQSLMIQSVCDEVSVTKLLKYANESLMRGQITELSF........... 214
4 -2.960PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali follow..  12...................................LVLTMCSAFSLKKGHSKTVYAFGIAASF------TDTVVYFTDIQILDSAKVSKEGFLTHRDLYSYQLKNYVEDNGLQQNSTCMIYFSENRKKLEKEATKILSKYKRNRNTTVTRIDTDKFH..................................................................................................................................................................... 127
5 -2.580PB000790 _Gut.Meta.Jp.0111831_ gi|163310496|dbj|BABD01000203.1||3 (- 2591:4589~0 complete)  ali follow..  13  233..................................................................................................................................................ESYFLLAEGWISNITPKEAYELGI-------RSSFEYFGVSEYADQYINSTTRNQEVVYNYPTASKTLYGKAMNDHLTKIITQKYIAQYQVLEIWNDHRRLFEIPANESDLIGSDMVNVLKKDSWKNGQQWDFYPQR----MRYPTTLDNADPENYQKAVELLG-GS--VIITPLW 436
6 -2.540PB031792 gi|154174791|ref|YP_001409041.1| flavodoxin family protein [Campylobacter curvus 525.92]gi|112804021|gb|EAU01365.1| flavodoxin family protein [Campylobacter curvus 525.92]  ali follow..  15  4............................................................................................................................DKGGPEAHFKRYIKEHVKGKKT-GLFITLGADPAGEHGESMLKVGRELLNEGGNEIL--AEFICQGA................................................................................................................................... 67
7 -2.420PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1.....................................................................................................................................MKIERLFIYCLLAGTSLLAS--------------------CNSEDMTDNPVETLSEGVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGKPWYPNTADISLTGQDNTGPYVLKGVSSKQYSYKENVQLN-----EHQLVKFRVKLNGDVPNLSDAKVFFYGYPTCKNEYGTV. 200
8 -2.340PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  10  58.......................................................................................................................................................................NNAMQAITNRSFVLEANSVQPLNG-----RVYYVNSNTNFVSLNDGQAMVQIASNSPYPGPNG-----LGGITVQGSASNVQVKQENNGNVYLSMSVQGIFISATVNLVL----YSGTNNAMVTVD---PNFSGNNLTMN----GTLLPYSDS.. 189
9 -2.150PB000795 Q74Z21_ASHGO/1-280 PB000795; Pfam-B_795;  ali follow..  1........................................................MSSDIVNWDPQFKPVKGIYEDRLRQF---DNGGDYRDLNLPKFYDRQRKRIDSTRVKVQYYQVPYDRHKPPVAPEKRPPWEEVVRRDRAGEIEW-LGQPF-GPSWSTTWFKVELDI------ESWSSSGEQLVGDTLLPKTAFSGNGERTEYLLPLGRSSVSFYIECGNNGM----SINPPDDDRYFHLQKADLVWPNWQARALYI------DFWMLGDAARELPDNSWQKHRA---RELGNLVMNMFDPEDVS............ 257
10 -2.070HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  111..........................................................................................................................................................................................................................................................................SASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGNYLVDGSDSGR-TITSGQETIY 167

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.