current user: public

If you have questions about the server, please let us know.

Query: PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;, from HGM_OVER

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFYDDDNIGGSYYNKSLDLCSRPWADTFYDADGNYCYQELNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVYGPGDVSYLDDVWIRGNVLSGYLDGHDNYVDFTGVLast
1 -6.580tr|E7ET22|E7ET22_HUMAN Uncharacterized protein OS=Homo sapiens GN=TMEM177 PE=4 SV=1  ali   10  6IGVPSGHCYKPFTT-PVSAGFPRLPAGAVVGIPASFLGDLVINTNHPVVIHGHTVDWRSPAGARLRASLTLSREAQ---CLAGTWALGVGAKYTLGLHAGPMNLRAASLSAAYACGGVEFYEKLLSGNLALRSLLGKDEKLQMWRG. 177
2 -6.360sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=DSG3 PE=1 SV=2  ali   15  34........LGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPDGSEGTI-HQWGIEGAHPEDKEITNICVPPVTANGADFM.................................................................. 105
3 -5.910sp|Q5T4D3|TMTC4_HUMAN Transmembrane and TPR repeat-containing protein 4 OS=Homo sapiens GN=TMTC4 PE=1 SV=2  ali   16.VLPPFWAKLVVGSVAIVCFARSYDGDDSEAIVNNKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLT............................................................................. 88
4 -5.700sp|A8MWY0|K132L_HUMAN UPF0577 protein KIAA1324-like OS=Homo sapiens GN=KIAA1324L PE=2 SV=2  ali   12  46.............YLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHI-----FKNATFTFTWAFQRTNQG------QDNRRFINDMVKIYSITATNAVDG.......... 159
5 -5.640sp|Q5T1H1|EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens GN=EYS PE=1 SV=5  ali   13  1MTDKSIVILSLMVFHSSFINGKTCRRQLVEEWHPQPSSYVVNTLTENICLDFYRDCWFLG....................................................................................... 61
6 -5.590sp|Q6UXG2|K1324_HUMAN UPF0577 protein KIAA1324 OS=Homo sapiens GN=KIAA1324 PE=2 SV=2  ali   11  45............DFMILTLVVPGFRPPQSVMADTENKEVARITFVFETCSVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYI-----EENTTTSFTWAFQRTTFH------EASRKYTNDVAKIYSINVTNVMNG.......... 160
7 -5.320sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1  ali   21...................GPNVCAVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPG..................................................................................... 63
8 -5.170sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=2 SV=3  ali   17  22PRHNGAYALRLGIGLLLCTRLAGCPEET....................................................................................................................... 53
9 -5.170sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2  ali   19...................GPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPG..................................................................................... 61
10 -5.170tr|F5H628|F5H628_HUMAN Uncharacterized protein OS=Homo sapiens GN=POSTN PE=4 SV=1  ali   19...................GPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPG..................................................................................... 61

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.