current user: public
If you have questions about the server, please let us know.

Query: PB039305 _Gut.Meta.Jp.0057508_ gi|162726131|dbj|BAAY01002830.1||2 (- 1092:1581~0 complete), from HGM_OVER

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst SVLDGFEAVGEKTTTNKMTMTVMESSVRFSKGVTEALGCPAYVKLLVNDKQKKIAVQACDAXDENAIKFCKTKRSKADGVDSDAAGKASSVTVRTTDVLVAVQKYFTFPPVADDQIAYFAMDGESYPDEKVVIFAVADASKGVSGKRGPRKLast
1 -5.490tr|E9PCV4|E9PCV4_HUMAN Uncharacterized protein OS=Homo sapiens GN=SPHK2 PE=4 SV=1  ali   10  14.LLHGFGSYPARGPR---ALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAY.................................................................................... 78
2 -5.120sp|Q5MNZ9|WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens GN=WIPI1 PE=1 SV=3  ali   10  3...AGYKLFSLSSVEQLDQVHGSNEIPDV--YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGT........................................................................................ 60
3 -5.080sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2  ali   9  48.TITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSV.......................................................................................................... 91
4 -4.960sp|Q9ULV3|CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens GN=CIZ1 PE=1 SV=2  ali   15  21GNLRGYGMASPGLAAPSPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQ.................................................................................................... 74
5 -4.720sp|Q5TEA3|CT194_HUMAN Uncharacterized protein C20orf194 OS=Homo sapiens GN=C20orf194 PE=2 SV=1  ali   9  51DHMNSISFYDGDSTSTVAALLIDFKSSLLPHLPVHFHGSSNFLMIALFPKSKI.................................................................................................. 103
6 -4.670sp|Q86Y34|GPR97_HUMAN Probable G-protein coupled receptor 97 OS=Homo sapiens GN=GPR97 PE=1 SV=1  ali   6  18.....FKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNM................................................................................................. 66
7 -4.630sp|Q9H269|VPS16_HUMAN Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens GN=VPS16 PE=1 SV=2  ali   14  10..................AVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICE........................................................................................... 51
8 -4.290sp|Q9C0H9|SRCN1_HUMAN SRC kinase signaling inhibitor 1 OS=Homo sapiens GN=SRCIN1 PE=1 SV=3  ali   10  2....GMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAYPGAGGLYKRGSVRSL................................................................................................. 51
9 -4.270sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2  ali   9  49...................VAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPS............................................................................. 103
10 -4.270sp|Q2M3C7|SPKAP_HUMAN A-kinase anchor protein SPHKAP OS=Homo sapiens GN=SPHKAP PE=1 SV=1  ali   13  8NSLDGFQNCPQDFLSVQPVSSASSSGLCKSDSCLYRRGGTDHITNMLIHETWASSIEALMRK......................................................................................... 70
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.