current user: public

If you have questions about the server, please let us know.

Query: PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;, from HGM_OVER

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFYDDDNIGGSYYNKSLDLCSRPWADTFYDADGNYCYQELNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVYGPGDVSYLDDVWIRGNVLSGYLDGHDNYVDFTGVLast
1 -12.8005nf4_A mol:protein length:451 Minor fimbrium tip subunit Mfa3  ali model follow..  1MK----PMSDYDIPTTENLYFQGAMRGVDPQPDPLQPDVYLLRAAHTNGEESINMDAEDFEDRVHSLAMLVFDSNTGEKVAEHFSSSIGSGTSTYVFTVKLKPGQRDFFFVANIPNMQTAMASI....................... 123
2 -11.6004lvq_A mol:protein length:376 Phosphate-binding protein PstS 3  ali model follow..  12  1MKLNRFGAA-VGVLAAGALVLSACGNDDNVTGGGATTGQASAKVDCGGKKTRFVNVFEQACPGQ---TLNYTANGSGAGISEFNGNQTDFGGSDVPLS---RRCGSPAWNLPVVFGPIAVTYNL-LDGPTLAKIFNGSITQWNNPAI 168
3 -10.5005ok8_A mol:protein length:175 LPP20 lipoprotein  ali model follow..  1..MKNQVKKILGMSVVAAMVIVGCSHAPKSGISKSNKAYKEATKGA-----DWVVGDLEKVAKYEKYSGVFLGRAEDLDYSTNQATAKARANLAANLKSTLQKDLENEKTRTVDASGKRSISGTDKISQLVDKELIASKMLARYVG. 148
4 -9.8704jg9_A mol:protein length:174 Lipoprotein  ali model follow..  10  1MK-------KIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKNEIMWYFLDPEMPTGKLS................................... 105
5 -9.4203pmq_A mol:protein length:669 Decaheme cytochrome c MtrF  ali model follow..  14  1MNKFASFTTQYSLMLLIATLLSACGGSDGDDGSPGEPGKPPAMTISSL--NISVDKVAISDGIA---QVDYQSNQENQTFIAAQLLPQGATGAGNSSEWQ-CAASCPGTFVDHKNGHYSY........................... 129
6 -9.1704g68_A mol:protein length:456 ABC transporter  ali model follow..  11SSNNLSKSNTSNSSKTSSSSKKMCSSNNLSKSNTSNSSKT-SSSSKKITLTFWNLFTGEPAKTKVKEIIDWNKENPNVQIVESVTENDAYKT---KIKAAIAANEAPDIFQTWAGGFSQPFVE-YLNDGTKDQLLPGSFDNVTYNG. 161
7 -9.0006anv_A mol:protein length:452 anti-CRISPR protein AcrF1 fused with C-terminal MBP tag  ali model follow..  10  39KSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENPLEKIE------------------EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDIIFWAHDRFGGYAQSGLL............ 158
8 -8.7005cyb_A mol:protein length:152 Lipoprotein  ali model follow..  10  1MKLKRFTL--SLASLASFSLLVACSQRAQQVQQPVAQQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTLDSAN----QRMIIGDDVKIYTVNGNQIVVDDMD. 141
9 -8.1105Z6B Entity 1(prereleased)  ali follow..  15  1MK----KICYVLLSLVCVFLFSGCSAGEEASGKKEDV---------TLRIAWWGGQPRHDYTTKVIEL--------------YEKKNPHVHIEAEFANW---DDYWKKLAPMSAAGDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTI 120
10 -7.9703e78_A mol:protein length:403 High affinity transport system protein p37  ali model follow..  10  1MLKKLKNFILFSSIFSPIAFAISCSNTGVVKQEDVSVSQGQWDKSITFVSEAWLNKKKGGEKVNKEVINTFLENFKKEFNKLKNANDKTKNFDDVDFKVTPIQDFTVLLNLSTDNPELDF........................... 122

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.