|
current user: public |
|
Query: PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF, from HGM_OVER |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . | |||||||
# | Score | Template | Links and tools | %id | First | MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAP | Last |
1 | -26.100 | 2key_A mol:protein length:112 Putative phage integrase | ali model follow.. | 16 | 1 | ........................................................................................................................MNNPSDFKSFHDFVASYMKTYSRRLEIGTFRHHKSCMRKFKEYC-EGLQFHELTEDFLRDYLIYMKKT. | 67 |
2 | -11.500 | 3nrw_A mol:protein length:117 Phage integrase/site-specific recombinase | ali model follow.. | 12 | 2 | ..........................................................................................................................TERPSLSPREARDRYLAHRQTDAADASIKSFRYRLKHFVEWAEER-AMRELTGWKLDEYETFRRGS. | 69 |
3 | -10.600 | 2kiw_A mol:protein length:111 Int protein | ali model follow.. | 8 | 1 | ................................................................................................................................TFKQVADDWLKQYANDVKVSSVRAREKAIQHAIERFN-TKPIQTIKKHDYQRFVDDISAQ. | 59 |
4 | -10.600 | 3lys_A mol:protein length:112 Prophage pi2 protein 01, integrase | ali model follow.. | 16 | 2 | ...........................................................................................................................DPIKQEISEYFKDWMELYKKNADEMTYKGYEQTLKYLKTYMP-NVLISEITASSYQRALNKFAET. | 66 |
5 | -9.560 | 2khq_A mol:protein length:110 Integrase | ali model follow.. | 13 | 2 | ...............................................................................................................................ITFADYFYQWYEVNKLPHSESTKRHYESAYKHIKDHFR-HKLLKDIKRTEYQKFLNEYGLT. | 62 |
6 | -9.130 | 2kd1_A mol:protein length:118 DNA integration/recombination/invertion protein | ali model follow.. | 10 | 2 | ...........................................................................................................................EPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDE. | 66 |
7 | -7.800 | 2oxo_A mol:protein length:103 Integrase | ali model follow.. | 6 | 1 | ...............................................................................................................................MTLHSWLDRYEKILASRGKQKTLINYMSKIKAIRRGLP-DAPLEDITTKEIAAMLNGYIDE. | 61 |
8 | -7.430 | 2cr7_A mol:protein length:80 Paired amphipathic helix protein Sin3b | ali model follow.. | 8 | 14 | ..................................................................................................................................LTYLDQVKIRFGSD------ATYNGFLEIMKEFKSQSIDTPGVHPDLIVGFNAFL---P | 74 |
9 | -7.250 | 2czy_A mol:protein length:77 Paired amphipathic helix protein Sin3b | ali model follow.. | 7 | 6 | ................................................................................................................................DALTYLDQVKIRFGSDPA-----TYNGFLEIMKEFKSQSIDTPGVHPDLIVGFNAFL.... | 67 |
10 | -7.210 | 2rmr_A mol:protein length:71 Paired amphipathic helix protein Sin3a | ali model follow.. | 10 | 9 | ..................................................................................................................................LSYLDQVKLQFGSQPQ-----VYNDFLDIMKEFKSQSIDTPGVHPDLIMGFNTFL---P | 69 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98. |