current user: public
If you have questions about the server, please let us know.

Query: HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;, from HGM_OVER

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst LEDGDFVKLSNLTIGYTLPIRNNKYMKSLRVYVSGNNLFCITGYSGLDPELDISNVQAPGVEYRDTYPTTRSFTFGVNIGFLast
1 -6.730d2eyqa1 b.34.18.1 (A:466-545) Transcription-repair coupling factor, RRCF, middle domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  25  26...GRYAGMTTLEAGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEE............................... 73
2 -6.650d4eiha_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  25.INGSFLVRESES-QLSISLRYEGRVYHYRINTTADGKVYVTAFSTLAELVHHHSTVADGLVTTLHYPAPK.......... 99
3 -6.120d2z0ta_ b.122.1.6 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  22  34IKPGDIIIFEGGKL--------KVKVKGIRVYSSFKEMLEKEGIENVLPGVKSIEEGVK--VYRQFYDEEREKKYGV.... 100
4 -6.000d1xjva2 b.40.4.3 (A:149-299) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  85LKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGIRVLPESNSDV.............................. 137
5 -5.770d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  29.PLGSFLRVSHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLD............................. 80
6 -5.730d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}  ali model 3D-neighbors follow..  19  61VRTGEVVRIRSATYDETSTQKKVLILSH-------SNIITFIQSSKLAKELRAKIQDDHSVE................... 116
7 -5.600d1kqfa1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  82INNGDRVTVSSKRGFIRAVAVVTRRLKPLNVNGQQVETVGIPIHWGFEGGYIANTLTPNVGDANSQTPEYKAFLVNIE... 163
8 -5.520d1dj7b_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}  ali model 3D-neighbors follow..  16  1MNVGDRVRVTSSVVVYHHPEHKKTAFD----------------LQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHF 65
9 -5.520d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  51.TDGKFLLRPRKEQGYALSLIYGKTVYHYLISQDKAGKYCIPEFDTLWQLVEYLKLKADGLIYCLKEACPN.......... 124
10 -5.490d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  25.LDGSYLLRDSESVVYCLCVLYHGYIYTYRVSQTETGSWSAETFRKIKNLISAFQKPDQGIVIPLQYPVEK.......... 104
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 5 5 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35