current user: public |
|
Query: PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;, from HGM_OVER |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . | |||||||
# | Score | Template | Links and tools | %id | First | MSETKERLCIYADFPYEFAVCAPRTDCPKREQCLRASAYDGVLARGLQKITVINPLIPTSEQGCKAFADNTPVLFAHGITHLYDELPHHAVQSLKHRLLTYFGKTTYYRIYRKERYITIQEQDYIRDSFVRAGFSSDLIRYDAMVYMYELQSAMVKS | Last |
1 | -6.820 | [O] COG4759 Uncharacterized protein conserved in bacteria containing thioredoxin-like domain | ali follow.. | 14 | 145 | .................IMVC--DVACSRFGYPIYQNLRQNYAAKSAGQLRVWRCSHI---GGHQF--APTLFDLPTGQ--FWGHIEPEILDVL---VWRNSPVKQLRQFYRGWSGMTKFEQIVEREIWMQHGWE...................... | 255 |
2 | -6.190 | [O] COG0330 Membrane protease subunits, stomatin/prohibitin homologs | ali follow.. | 9 | 53 | ...........................PFIDRIGSKLSVMEQVLDVPTQEVITKDNASVSADAVAFYQVLNAAQAAYQVANLENALLNLTMTNIRSVM----GSMDLDELLSNRDTINDRLLHVVDEAANPWGIKITRIEIKDIAPPKDLVDAMARQ | 178 |
3 | -5.990 | [R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins | ali follow.. | 16 | 219 | ...GKGAACRFVHEPTRKTICFLNGRCNKAEDC-----------------NLSHELDPRRIPACRYFLLGKCNNPNCRYVHI--------HYSENAPICFEFAKYGF--CELGTS---KNQHILQCTDYAMFG........................ | 321 |
4 | -5.910 | [C] COG1146 Ferredoxin | ali follow.. | 9 | 42 | ................DYDKCVTCGIC--FVTC---RRVFDFDKKEGKVIVARPYNCMVACQTCMNLCPTGAISFPDASYIKKLVAQNKIVKKAFEIIKPLLAEDHLSPKET-ETKPEP...................................... | 139 |
5 | -5.880 | [O] KOG1752 Glutaredoxin and related proteins | ali follow.. | 13 | 43 | ..........................................PVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELLLEYGNQFQDALYKMTGERTVPRIFVNGTFIRLHKEGKLLPLVHQCY........................ | 141 |
6 | -5.830 | [W] KOG1574 Predicted cell growth/differentiation regulator, contains RA domain | ali follow.. | 5 | 6 | ..........................................................................NIDGLERSVSGVTDTTTSQIIYALAHATSQRGRFKYRNVERRLAPTDR--PLETLRKWREHAANVTF................ | 75 |
7 | -5.770 | [J] COG0023 Translation initiation factor 1 (eIF-1/SUI1) and related proteins | ali follow.. | 19 | 42 | ...................................................................RKGKGVCLITGIEMNDAEL-----TKLAAELKKKCGCGG--AVKEGIIEIQGDKRDLIKSLLEAKGMKVK.................... | 104 |
8 | -5.700 | [C] KOG2621 Prohibitins and stomatins of the PID superfamily | ali follow.. | 11 | 96 | .................................YTKVDLRTVSFSVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNML----GTRSLSEILSDRETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAE | 215 |
9 | -5.650 | [O] KOG4114 Cytochrome c oxidase assembly protein PET191 | ali follow.. | 19 | 6 | ...........KDQKKAVAICLQRSPCVMIEECLDNPELNKDLPEL---------AQMKAFLDCKRGIVDMTKRF-TGNAPLSTGKYDQQYENLCK------GKFDPREEMEKLKLLNSQQKD.................................. | 108 |
10 | -5.530 | [J] KOG4771 Nucleolar protein (NOP16) involved in 60S ribosomal subunit biogenesis | ali follow.. | 14 | 153 | ..............................................................................................................SNKMLPLSAFEHAYIQRLINKYGTEDESMAKDVKLNSKLFNGSKLKN | 200 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review. |