current user: public

If you have questions about the server, please let us know.

Query: PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;, from HGM_OVER

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFYDDDNIGGSYYNKSLDLCSRPWADTFYDADGNYCYQELNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVYGPGDVSYLDDVWIRGNVLSGYLDGHDNYVDFTGVLast
1 -14.200[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  17  2VK----KAIVTAMAVISLFTLMGCNNRAEVDTLSPA-----QAAELKPMPQSWRGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTW---ARTADKLVLTDSKGEKSYY.......................... 110
2 -12.300[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  14  1MK----NVFKTLAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKKVDSQTQSTMPDKNDRATGDGPSQVNY............................................................................ 67
3 -11.800[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  11  7.RIKNNRIPVSITVLTLAMSLAACGGQQGSDNTATQDGSSGTAKDATASSASWFTDLNKKYPNL---QINYQSVGSGAGVEQFIQGTVDFGASDVAMK-EIQKVQRGVLLLPVTAGGIVLAYNL-LPRVVYTDILLGKIKTWDAPEI 180
4 -11.200[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  13  1MRK-----GCFGLVSLALLLLVGCRSHPEIPVNDEQ---SLVMESSLLAAGISAEKPVLSTSD-------------IQPSASSTLYNERQEPVTVHYRFYWYDARGLEMSVTIPAHSAVTLYGSANFLGAHKVRL............ 121
5 -10.600[S] COG4259 Uncharacterized protein conserved in bacteria  ali follow..  18  1..MMNPKTLSRLSLCAAVLALTACGGNGEGLKNDDTSLGKQTEKMEKYFVEAGNKKMNAAPGAHAHLGLLLSRSGDKEGAFRQFEEEKRLFPESGVF.................................................. 110
6 -9.110[S] COG4939 Major membrane immunogen, membrane-anchored lipoprotein  ali follow..  17  1MKLKKV-AMGITVVMASSLLLVGCGSSDDSSKDKKSTDTKQTETKKT------KTDGTMTDGTYKLEEKNFDDKG-WKGFMSIEVKDGKITKANY.................................................... 88
7 -8.870[S] COG5510 Predicted small secreted protein  ali follow..  4.VKFMRSALITSILVAVAFLTSACNTMQGAGQDIQVAGKKLKDSAESNKPQK............................................................................................... 54
8 -8.840[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  2KPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVASTATVAASVAQSTVHGTNIRERVALPPDAVVTVTLDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQ------PNARVIVSAAITRNGQLL................ 131
9 -8.500[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  10  5MKAFN-KLFSLVVASVLVFSLAGCGDKEESKKNGTEIAITYVYKGDKVLKQSSETKIQEDAAKTLEPLSAKYKNIAGVEEKLTYT----------------DTYAQENVTIDMEKVDFKALQGI--AKKGIT--MAQMELVMKAAGF 153
10 -8.370[M] COG3017 Outer membrane lipoprotein involved in outer membrane biogenesis  ali follow..  13  1..MTLPDFRLIRLLPLASLVLTACTLPGHKGPGKSPDSPQWRQHQQEVRHNQYQ----------TRGAFAYISDDQKV---------------YARFFWQQTGQDRYRLLLTNPLGS.............................. 91

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.