current user: public

If you have questions about the server, please let us know.

Query: HGC00166 gi|163579340|dbj|BABE01005762.1|1.0 TMP00473;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# E-value Template Links and tools%idFirst MKEHKEVSALLQQAKQERRCCYGTSDAQRRALKRRLHAGELVSPYKNLYADRTLWNTMTREQQSLQVIRALSAIHPQWVFAGLSAACVYGLQHNYSLHDGTVHIASKSGIGGGDEARLNRIYINRIPTRKHNGILLTTPARTLLDCAVFPFPQALPIYDSALRKSLTTIEEVQSLMIQSVCDEVSVTKLLKYANPLSENGGESLMRGQITELSFGSSCWQCSSLast
1 7.000e-56UniRef50_A0A0M4LIW9 CTP synthase (UTP-ammonia lyase) n=7 Tax=Bifidobacterium bifidum TaxID=1681 RepID=A0A0M4LIW9_BIFBI  ali  39  2................DGRCCSASSPAERQAMLRRTRCGDVVRPFRSVYARREYWDGLNPIEQASHVIREMARRHPERVFAGLSAAVIYGFEHSWTLHDEPYVYIATDGKSRRSYHRLRRISVRRSDIREDCHVRVTSPARTLVDCALLPFEHVLSMFDSALRRGLVTREEIVAVCDGLRVDCGPVFRLLHYADARSENGGESFCRAVSIEEGFVPPQLQ... 252
2 8.000e-55UniRef50_A0A239J218 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Rhodococcus kyotonensis TaxID=398843 RepID=A0A239J218_9NOCA  ali  21  4...........DTSGFITRAAALEAGYTDNELARMCRDGLLHKVAPGLFVPAETFTPLDERGRHVVRAHALTRRHKSGVVSHQSAAAVHGLDLWDTDLTRVHLTVPRATGGSRKTDR-HIHCRHNIQAIQVKGIPTSSPADTVVDCARLDLDHAVVIGDSALRKTSLIKPQLVDRLAAGMTGIDAAKRAVDLMDGLSESPGESLSRLRFLQHGIPMPVLQHS. 216
3 3.000e-54UniRef50_UPI000933B45A hypothetical protein n=1 Tax=Rhodococcus yunnanensis TaxID=278209 RepID=UPI000933B45A  ali  19  7..............PLLLRRDLVRNGRSDSDIRSAKAAGSIASLRRGAFVSTRTLKDMRPEDRHVLNVRAHLAAASTLVVSHQSAAAVHGFEMWAPDLSVHFTVDRNSGGRTTKTRHVHANPIADRDITEVDGIPVTTADRTIADLLRLPFEAGVCVGDSALHAGSATVTGIDEALVRGGRGIVTARRSLEFCDAKSESVGETRTRVLLHRAGMPVPRLQVE. 218
4 1.000e-53UniRef50_A0A117J4X2 Uncharacterized protein n=2 Tax=Olsenella TaxID=133925 RepID=A0A117J4X2_9ACTN  ali  26  5..ARARLMNQVNRAAAGLAFFSPDAEKDERVASRMAAAGDLVRVCPRVYASPSDWEGLRPDAQHLWLARALQDKHPSWVFCGTTAALIHGLSVSYYQLDR-IMLAVGPHGHSGRMGTLRRMETSASNVAAIDGLRVTPILQTVFDCMRMPFSEGLVVADSALRAGLVEKDQLIEYVLSRGRGVRGAAQAALHADGRAENGGESLSRATMLELGFACPELQVE. 227
5 1.000e-53UniRef50_A0A2A9EIF0 Putative AbiEi antitoxin of type IV toxin-antitoxin system n=1 Tax=Georgenia soli TaxID=638953 RepID=A0A2A9EIF0_9MICO  ali  19  7.............SGLVLSADLTAQGLGPGEIRRAVRDNDLTRVRRGAYVPATAWNSARPESRYRYLVHAVAATRTPVVLSHESAAVLHGFPRIGSWPTVVHAVRERTTGGRSSTTVIRHGVPRMPEVVTVDGLHTTSVARTVIDLARTSFLNGVVAADHVLANGLATREELEVSLLRRMHGHRRAERVLRFADGRAQSVGESLSRVRMHELRLPVPDLQVE. 219
6 9.000e-53UniRef50_A0A260U7I5 Uncharacterized protein n=5 Tax=Rhodococcus TaxID=1661425 RepID=A0A260U7I5_9NOCA  ali  21  4...........RRDPLLLRSALIRTGSTDNDIRSAKSAGTITSLRRGAFAPTAALVTMRPEEQHVLAVRAHLAARSELVVSHQSAAAVHGFAMWAPDLTVHVTTNRTSGGRKTSKSHVHAAPLTEDDVTVVNGIPVTSADRTVADLLRLPFEAGVCVGDAALHSGSVTVTGIAAALARSGRGVVSARRTLAACDARSESVGESRTRVLLRASNIELPDLQV.. 217
7 9.000e-53UniRef50_A0A2A9DZA7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Microbacterium agarici TaxID=630514 RepID=A0A2A9DZA7_9MICO  ali  23  5.RKNHGVNREESEPKLIRRADYVAAGGSLNEITRRVKSGEIVKVAPGVYAPSAIWAPAFPELKHTLRVHAQQRRLKSPTFSHYSAAGVHVFSLLGPWPDKVHVTECRRGGRSEGAVVRHRAPLSAEETTIVDGISVTTVPRTAYDLACLPFTDAVAMLDSVRRRPLASIAELTEAFESGRPGRPRALKALEFSTDRSDSVQESRSRVLIHQLGFPPPQLQFS. 233
8 2.000e-52UniRef50_A0A087DTQ8 Uncharacterized protein n=1 Tax=Bifidobacterium subtile TaxID=77635 RepID=A0A087DTQ8_9BIFI  ali  43  88MRNHKGVIALVARSESEGRCCYGLGEAQNRALRRRRDSGELISPYPGVYARSEYWHALNPPEQSRHLIKALAMMHPQWVFAELSAATVLRFEHWGLHADGCVHIATNGSVRVHGHDKLRRLSVHNAAIWRCDGVRITSPARTLVDCARYPFERGLPIFDSALRSKMVSRDEVRVACHGLRVNLDSVERLLRYANPLSENGGESLCRAIIIDAGFALPILQEE. 310
9 2.000e-52UniRef50_L8DQD4 Uncharacterized protein n=16 Tax=Rhodococcus TaxID=1661425 RepID=L8DQD4_9NOCA  ali  21  4...........DRHGLITRTAAMGAGYTNTELQRLCARGELIRIVPGMYAQRELCSTLDPQGMHRLTAIAATATNAEAVVSHVSAAVLHGLDLWNTDLHRVHLTIPGGKGRTTSRLHVHSASLPAPFVTVEQGISVTALDRTVVDCARLDLDHAVVIGDSALRSKKVSMDRLRAALEVSARGIGAARRAVAAMSGLSESPGESLSRLRMKQYGFPDPVLQ... 216
10 3.000e-52UniRef50_I3WG19 CTP synthase (UTP-ammonia lyase) n=21 Tax=Bifidobacterium TaxID=1678 RepID=I3WG19_BIFBI  ali  27  1MGTHHSLDRLFAVARQERRCAIPSTNTDIQAIRRRVKTGAVLRVFRGLYAEPAYWESLDPHEQVRHIVRALAIQHPDWVFCGPTAAIMHGLDCSYR-LAFPICIVASPGAHHQDTRHISHHAITHPDITVVQGVKVISLLQTLFDLAACPLRYALGPADCALRNGLVSEYTLRAYPSSYSRNRAAVERAFALADRRAENGGESEARGMLHDAGCPPDDIQVE. 224
11 5.000e-52UniRef50_UPI000D1EAE93 hypothetical protein n=1 Tax=Nocardia suismassiliense TaxID=2077092 RepID=UPI000D1EAE93  ali  18  7..................RRDVRLGGVSDGELRAGRRRGELEWVRRGVYVERAEFERLDGGARLALGVRAALSLGGDVVVSHQSSAIVRGLPLWNVELGRVHVSTCARGRSRTDRLHVHSAPFDETEVTNVDGMRVLSAARTVVDLARVPFEEAVVIGDAAMHNYRLTTNDLLEALDRRRPGAAKARRAIAFMDARSESPGESRSRVRMHLAGLPEPELQH.. 214
12 5.000e-52UniRef50_A0A1G6TD73 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Rhodococcus tukisamuensis TaxID=168276 RepID=A0A1G6TD73_9NO  ali  20  1.........MRRMSIVFRRPDALQRGATDRELQRMCTTGRWRRLRPGSFTDSTEYDALDAVAQHRMRAEALRAASADAVLSHQSAAVLHGLDLWHTPLRAVHLTRDRRTGGSRSALRVHSAGLDRSEVVEVAGRRVTSLARTVVDLARLPFEQALVAGDHALHGTALTPDLLEDTLRAGRPGSRRARRVVDHLDGRAESVGESRSRAMFIRKHLPLPELQ... 216
13 1.000e-51UniRef50_A0A1G8PQH6 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A1G8PQH6_9NOCA  ali  21  8.................TRESARSRGLSDREIRRLVDSGTWVRVIRGVYVPRSAYTALDVVERHRLLCEATVSVGGDLVLSHVSAAILHGFTVWNVPLERAHVIRDPTGNSISNSRIVHAGRLAPGDVTDLRGTAVTTPARTVADLATLPFEQALVIGDHALRTAHLVPEDIAHALHPSHPGSRKACRVARFLEPGSESVGESRSRAAFIREQLPLPVTQ... 212
14 1.000e-51UniRef50_A0A177YFZ8 Uncharacterized protein n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A177YFZ8_9NOCA  ali  18  7..............PLLLRRDMVRDGSSDSDIRIAKADGSITPLRRGAFVPTTTLKDLRPEERHLLNVRAHLAAATSAVVSHQSAAVVHGFAMFAPDLGVHFTVDRESGGRTTKTRHVHANTLTEADVTVVDGIAVTSADRTVADLLRLPFEAGVCVGDAALRAGSATVAGIEEALARGKRAAVKARRTLAFCDARSESVGESRTRVLLHRAKMPPPLLQIE. 218
15 2.000e-51UniRef50_K0EII9 Uncharacterized protein n=23 Tax=Actinobacteria TaxID=201174 RepID=K0EII9_9NOCA  ali  19  1MVGGGRSDEHVAMGEIQRRQNALVDGYTDHDIRRRYRGSRWHRLRRGCYVEAAEFDGLDSIDRHRLLIDTLPALAHDAIVSHQSAAVLYGLPLWATPLDLVHVTRDRCNGGRVRHAMKVHCAPISDGVVEIDGYWVTTPARTVVDLARLPCEQAVVVGDAAMRTLGITPTELATALAARRRGITQAHRTIGLLDGHSESVGESRSRVMFHRNGLSIPAQQ... 224
16 2.000e-51UniRef50_F6EJE7 Uncharacterized protein n=2 Tax=Hoyosella TaxID=697025 RepID=F6EJE7_HOYSD  ali  23  16.....................LLVRDLSANERRQNTRTGELLRVRRGTYVPNDVWKTLNHEEQHLLRAIVVAARRSDCVLSHVSAALLHGLPAWNVPLQIHLTRASRTGGGVKNRLVVHSASLDSGDFEVVDGIPVTRTARTVVDVARTPFEQAVVIGDAALHREIVTKDELALSLERARKGIAAARRAVAFMDRRSESVGESRSRVLFHAQGVASPQLQAE. 222
17 3.000e-51UniRef50_A0A1Y4E2I5 Uncharacterized protein n=2 Tax=Collinsella TaxID=102106 RepID=A0A1Y4E2I5_9ACTN  ali  30  4.RKQACADRLLDEAEHAYRLAFASSHTEVMALKRRRDAGRVVEPAKGYFARSDVYKSLSKRAQAMYLIRAVAQKHPTWIFASFSAALVYGLQVSHRYLDTVHIVVGSHERKYKPGGFITCHQMGDVEPMVVAGIRVTSLFQTLLDCACSSFRYGLAVVDSAVHWNLTTVSELKVYFDSRKRGIATARKVLQWVDGKSENGGESVARAVMIELGFVVPELQ... 226
18 3.000e-51UniRef50_A4E9T1 Tat pathway signal sequence domain protein n=5 Tax=Coriobacteriaceae TaxID=84107 RepID=A4E9T1_9ACTN  ali  26  20MTANQRLTSHIKACEQQMSCVYARTAAEAKQIERRVAAGSLEAVMPGLYARPDYWSELKFRQRYLHRVRALAQKHPDWTFCSYTAAVIHGLSVSHANLT-HIHIAAAPAQSTTPGSRVIRHRYARQTRAIQMDIAVTDIDQTITDCLDASFVEGLIIADSALHEQLLSKEHLVEALGLNRRGVVTARSVARCADGLSESGGESKARALMIERGWQTPELQVE. 244
19 5.000e-51UniRef50_V9XN04 Uncharacterized protein n=89 Tax=Nocardiaceae TaxID=85025 RepID=V9XN04_9NOCA  ali  19  7................LTTATLTESGMSDNDIRRATRAGDLVRLGRGMFLHRSDVEALGEVGVHRVRARHLGRLSAGTVLSHVSAASLHGLDLWKASLEHVHVSRPPHRHGRMTSQIHVHPTEVGDDVVLLDGLPVTSVARTVVDLARLPRDQAVVVGDSALRLYPDAAADLLRVLAGHRHGLAKARAVVPFLDGRSESAGESLSRLRIAEAGLPRPILQYE. 216
20 8.000e-51UniRef50_B6G9H2 Uncharacterized protein n=4 Tax=Collinsella TaxID=102106 RepID=B6G9H2_9ACTN  ali  27  1METKSATDLKLELATRHACLLLPADTPEKRRLDRRVTKGTVCMPYPGAYALAEPYNKLNPRAKARMTLKAIHALHPNWTFCSFSAAVAHGLQVPRALLAPVHIAISPTESRRKNPGHIACHTDHGGSRVITDGMPCTCLLQTLLDCLCTGFRYGLAIVDSALHYHLTTHEKLARHFAKGRRGIRQARQTLAYADGRSENGGESIVRAAIIELGFQTPELQIE. 226
21 1.000e-50UniRef50_F6ES51 Uncharacterized protein n=2 Tax=Hoyosella TaxID=697025 RepID=F6ES51_HOYSD  ali  21  1..........MTPDQHLTRKSAHARGITDDELTARCRSGQLTRLHRGLYVPASVHNSMSPAARHVVAARQVLSAREGAVLSHSSAALIHGLPVWGVPLDRVHLTADAASGGKVSKHRVHISPLPPEHLTYVDGHLATTIARTVVDIARTGFEAAVVVGDAALRRG-TSRDELRSVLARRWKGLPVARKVVGFLDGRSESVGESRSRVALDQFPLPPIEVQY.. 215
22 1.000e-50UniRef50_A0A0D5ACW1 Uncharacterized protein n=25 Tax=Nocardiaceae TaxID=85025 RepID=A0A0D5ACW1_9NOCA  ali  21  3..............RIVSRSDALSRGISDAELQRYCRTRAWRRLRPGRFVSRDEFDALPREDKHRVIAEAVATIAPDAVVSHVSAAIFHGLDVWNADLSRVHITRNRARGGGRSSAVVHTSPYTDEEIVDLGGVRVTGPARTVADCARLPFETAVCIGDFAARTRGLTSEDVVAALDPNHPGNRMARRVAEFMDGRSESVGESRARVVLHQLGY-TPQLQV.. 215
23 1.000e-50UniRef50_A0A2V1HTN2 Uncharacterized protein n=1 Tax=Amnibacterium sp. M8JJ-5 TaxID=2173173 RepID=A0A2V1HTN2_9MICO  ali  23  15..................TRDLERIGGDDREIRRLRDKDELVRVRRGSYMPKSDWLALDAEGRHRARIHAVAAARIEPVFSHFSAAALHGIPIIGLPVDVHVTIARGSRRRGQPEIRTHSLALAPHEIDRVDGLLVTGLERTLIDLATTSFESAVASLDWGLANG-ASRQSIHEELERMSPRRKAAEKAIEFADSRSGSPGESLSRARMHILGFPAPQLQV.. 221
24 2.000e-50UniRef50_UPI000C84338D hypothetical protein n=1 Tax=Enorma phocaeensis TaxID=1871019 RepID=UPI000C84338D  ali  26  15..NDQVLADLFKVAEQEGSCLVSDDAAIRALLNRRVSSGSVVRPMRSLFARPEYWNALRPDQQALHIVRGLQKLHPDMVFCHETAGLVWGLPISYPRLATIHVATTLEKRRRSEGSIARH--IVGDDVQVVDGITVTPLARTTFDCLRTPFTEGLAIADRALALSGSNRRAMHAAFRTHRFGINRAIGIMSYADPRSESWLESAARALMITQGFALPDLQVE. 236
25 2.000e-50UniRef50_A0A143QAF2 Uncharacterized protein n=7 Tax=Nocardiaceae TaxID=85025 RepID=A0A143QAF2_9NOCA  ali  22  4...........RDGELWTRRELLALGTTDDGIRRAVGDGTLVRLRPGVYADAARREGMSPEQRHLDDIRA-AVTGDRSVVSHQSAAVVHRLGLWNPDLTLVHTTVDRPRGGRTTRRHLHAASLPGDHVTTVDGLPVTTVARTVADLGRLSFEAAVCVGDSAVRSGAVTAAEVHDAVAVGSRGRRAATRVVTFLDGLSGSVGESRSRVMLHAMGFPPPRLQV.. 215
26 2.000e-50UniRef50_A0A0D8HYN7 Uncharacterized protein n=5 Tax=Rhodococcus TaxID=1661425 RepID=A0A0D8HYN7_9NOCA  ali  19  2..............GILTRAQAHRDGISDAQLQRAVRCGELHRIAAGIYMRADHYRELDARARHRHTALAAAACGPGAIVSHVSAAVMHGLDCGGLGLNVVHVTRNRSSGGRSATFHLHPVPLVPEEIVLVDGVATTSLARTIVDIARTSFENAVVIGDCALRRGM-RRDDLASVLERGRRGMSRARVVAEFIEPGAESPGESISRVRMRADGWPMPTLQQE. 213
27 3.000e-50UniRef50_C1AZ05 Uncharacterized protein n=15 Tax=Rhodococcus TaxID=1661425 RepID=C1AZ05_RHOOB  ali  21  14..................RRRALADGVTDSEIRHARNSGRLVRVATGAYVSDEYFAGLDAPALHRVRIAAALQSRPGVVVSHASAALLHGMDLGDISLERVHLTRHASGGGRTSGVHVHATPFDADEVVTLGGLPVTAPARTVVDAARSTFDQAVVLGDSALHRRLVTTQEILDAVGRAGPGIATARRAAGFLDGRSESPGESLSRIRIRRHGLPSPELQH.. 221
28 4.000e-50UniRef50_F0HNM8 Uncharacterized protein n=4 Tax=Eggerthellaceae TaxID=1643826 RepID=F0HNM8_9ACTN  ali  27  61MKANDEMAQLFLRAERMRMCAISSCERTRKILRRHVERGEVVRPARGMYARAAYWSGLSKPEKMLHVMRTAQSIHPDWVFCHESAAVAFGLPVSYERLGA-IHVATTRSNRNANSKTVRWHVVAEDESVIVQGLRVTSLQRTVFDCMRMDFGQALAVADFALRLGGGRASAFVSHVRRIGGGAAHAMRTMHYADARSESGGESIARAAMIQHGFALPELQV.. 285
29 1.000e-49UniRef50_A0A0K1F671 Uncharacterized protein n=2 Tax=Olsenella sp. oral taxon 807 TaxID=712411 RepID=A0A0K1F671_9ACTN  ali  30  5.RLDDSIKAQLDEAERTMRCLAPAGDGFQARLARLARQGALARPYPGVYARPSYWNALEPKAQCLHVARTLSGAHPSWVFCATTAAVVHGMAMSYRYIKVPHISVPGKRRGQTRWAVWHHLRDDDDATIRLNGVRVTSFERTAFDCLRLPFDQALAVADSALRIRNADIPWLIHSVCGYWPGAQHARQVAHHANGLAENGGESMARAAMIELGYMLPELQ... 227
30 1.000e-49UniRef50_A0A1Y4HNC4 Uncharacterized protein n=2 Tax=Collinsella sp. An2 TaxID=1965585 RepID=A0A1Y4HNC4_9ACTN  ali  29  8.....ELRHKLLAAQRQGRFAVASSSNERKALDRRVERGELVSPYFGMYAYRDYRQHLSKREFALHVLRTAAFLHPDWTFCSFSAALAWGLDVPNSQLLPLTVGIGPNGHKRRMRGLVQCQCVTDDTPVVMRGVKATSIERTMLDCACHGFRHGLAVCDAALHWKLVTPERFRAYVEHGRHGIDAARMVARYMDGRSENGGESIVRAIIIELGFVIPELQVE. 228
31 2.000e-49UniRef50_A0A1H2IHM7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Jiangella alkaliphila TaxID=419479 RepID=A0A1H2IHM7_9ACTN :  ali  21  7.......ALAARQHGVVVRPQALAAGYDDNEIARRRATGAWTAICRGAYVETTLWNTLDDRQRHLALCQAVLQLTVPAVLSHVSAAVWRGLPTWGADLSTVHVSRRDRHAPREAGVHHHAGRLTDEEFATVRAVLVTQPARTVVDVARTPFEAAVVTADGALAQSLATQSELREALDRDWRGARGAGRVVEFADGRSESVGESRHRVQLDRVGLPRPELQV.. 225
32 3.000e-49UniRef50_A0A1Y4BKC3 Uncharacterized protein n=2 Tax=Olsenella TaxID=133925 RepID=A0A1Y4BKC3_9ACTN  ali  27  6...DREVDIFLREAERRWACLESHPGHLHRLLERRVQNGELVSPLPRLYARADLWHSLNPTMRTIFIAHGLQKLHPDWVFCGTTAAVMHGLSVSWGAQGKIEVVGTSEGRRVRASGIVRRYVRGETPVTSFE-VQVTPLLRTVFDCMRHGFREGLAVADSALHLGLTTGDALCTYVRDMRGGIEQALRTAQFADPRPENGMESIARATMFELGFARPSLQV.. 226
33 3.000e-49UniRef50_A0A1Y3U5X9 Uncharacterized protein n=3 Tax=Coriobacteriaceae TaxID=84107 RepID=A0A1Y3U5X9_9ACTN  ali  25  6...DQELDRLFAEAERSKTCLVAPSERTARLLNQRARAGHVIRPRRSLFARTAYWNALRPDEQALHIVRGLQKLHPSWTFCHESAALVWGLPLTYRRMDAVHVV--NTRAMRRSGGNAIWHVIEGDSETVVEGVRVTSLERTLFDCLRSSFVEGLPLADRGLALLNSGPQRLQDAFARFGKGCARAIGTLSYANARSESWAESVARALMITQGFALPDLQVE. 226
34 4.000e-49UniRef50_A0A177YKV4 Uncharacterized protein n=1 Tax=Rhodococcus kyotonensis TaxID=398843 RepID=A0A177YKV4_9NOCA  ali  17  3..........LDPTRLLSRRDALSMGLADHEIRALRTSGGWRTLHHGNYIGADHSDALDARSTHRLLIDAVLTLSDKAVVSHESAAILHGLPLYGVDLSRVHVTRDRRGGGRTSKGVVTHCS-PLGEVVIVDGFRTTTLARTLVDIARMSLDTAVVLGDVAMRHG-ASLDEVAEELERARRGIASARRVADMVDARSESVAESLSRIRLHQHGFRDVELQVE. 216
35 6.000e-49UniRef50_A0A1Y4FZ55 Uncharacterized protein n=3 Tax=Eggerthellaceae TaxID=1643826 RepID=A0A1Y4FZ55_9ACTN  ali  28  1MRANDEMARLFSRAESRQMCLAPSSEQVRSNLRRRVERGEVVRPARGMFARTTYWNALTRSRQMLHMMRTMQDAHPDWVFCHESAAAAFGLAVPYERLRSVH-VSTSRSVRNASSKGVRWHVVEGDGTAVVRGVRVTSLARTVFDCMRTGFDQALATADSALRVSGMTSASFAACFEHMHTGTAHAVRTMRYADARSESGGESIARAVMIRRGFALPELQV.. 225
36 7.000e-49UniRef50_D4BS91 Uncharacterized protein n=42 Tax=Bifidobacterium TaxID=1678 RepID=D4BS91_BIFBR  ali  39  1MKHHKAVETLLEVSQQERRCAFGRTKAERSALERRASAQELERVFPGLFVKPDFWKSLNPAEKSAHIARTLGLRHGHWVFAGLTAANLHGFEHQWLLHDGTITIATHTQGSDTGNGRIRRLFIPQTDIRHIDGVAVTSEARTVVDCATLEFRYALPIVDSALRRG-VAINDIIGICASMQRDCTAALRLLHYADPTSENGGESLTRGTILEGGYKIPELQ... 223
37 7.000e-49UniRef50_A0A1H0H2U7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1H0H2U7_9MICO  ali  21  43..............................RLRRESSRGRLQRVSRGLYYPSARWDQLRDDERYLIRVRGAALTRRGAVLCHQSAAVLWGLPMLVGWPEVHLLVERASGGRSDPGVRCHALGVDARDVTTTDGLLVTTIERTVVDLATLDLKSAVALVDRALYQTLTTKDALLATLERMFRGSRRARAIIQFATHLSGSPAESASRVNIALSGFPEPELQH.. 245
38 8.000e-49UniRef50_A0A1E8VXP7 Uncharacterized protein n=2 Tax=Olsenella TaxID=133925 RepID=A0A1E8VXP7_9ACTN  ali  26  4.RVANELRLMIEEAEQEERCLVADSQRDRLRLCRLVRQNRMTSPLRGLYCPTELWDRLNPAQRCRRIVRALARQHPYLPFCHVTAALIWDLPVSWQLLGQVHALRSTGGRRQGPASSIRWHQRSDAQVTNHDGVRVTSLDQTVVDCLCLDFTEGLVVADGYLRRTGTTRRQLQNLLGHGVKGVPQARLTASFADGRSESGGESALRATIVKLGFPVPTPQ... 226
39 8.000e-49UniRef50_G5F3M7 Uncharacterized protein n=6 Tax=Olsenella TaxID=133925 RepID=G5F3M7_9ACTN  ali  25  1MPRRERIDARLDEADRDGRFACMLGRTDREAMGRLVHSGMLHSPYPGVFVHSELWQSLGIGEQQLRLARSLGAMHPDWTFCDATAALAHGLPVSHRPLSHVHVCHLGSGRHSH--GLVRWHTTDAGETTFASGIRVTSLERSAVDCLLMDFGDGLAVADATLRRHTDSLDKALGRLGAGRRGIRQARLTLSHADPRSESGGESIARARMIELGFVVPELQVE. 228
40 9.000e-49UniRef50_A0A239E1Z2 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Micrococcales bacterium KH10 TaxID=1945885 RepID=A0A239E1Z2  ali  23  5...................SELHRIGFGASLLARAVREGWLVRPQHGLYVARSVWDRAEPSDRHKLIVGAMSRSHPNSIFCLRSAAAVHGIPLLGKPDQRAQILVNPIRGGRSTRHLYRHQGVPDPAARTIDGVRVTSPARTVVDISRESFASGLMSMDHVLHNDLADMTAISRVIASMRQGVQRARTVARYADPLSESAGESLSRARMIELGYDPPQLQV.. 210
41 9.000e-49UniRef50_A0A143QDC7 Uncharacterized protein n=6 Tax=Rhodococcus TaxID=1661425 RepID=A0A143QDC7_9NOCA  ali  20  5..............PLLTRSQLAKRGVSDSEIRQALRSGSIAAVRRGCFVGRSALLDATPEMRHLLTARAVVTSGGDLVLSHESAAVLWGLPLLGGPPDVHVTATNGRRGRVGPDRYLHCHKLGGDDTTVHAGIRVTSPARTVVDLACYSFEAAVCAGDAA----SLHYSDLAAAVERSRAGIARARRVAAFVDGRSESVGESRSRVYFDRFDVPAPDLQVE. 213
42 1.000e-48UniRef50_UPI00035FE37D hypothetical protein n=1 Tax=Actinopolymorpha alba TaxID=533267 RepID=UPI00035FE37D  ali  18  6....ERLRRLADEQGVFSRAQALALGHSSKEVDWLVRRRAWTRVRHGVYAETDLWQNLDPEAQHLAKVRGVLRCGADLVVSHLSAVILHGWPTWNVNLDNVWVTRKSLSQRSRAEAGVHHAELPAEDVIWIAGVPVTSPERTMVDFARMGYESAVVSCDAALRSG-ANPQVVRQIFDRQWPGARGAIRALAFADARAESVGESRTRVLCYQEGLPTPRLQ... 227
43 1.000e-48UniRef50_A0A0Q6JTA6 Uncharacterized protein n=8 Tax=Nocardiaceae TaxID=85025 RepID=A0A0Q6JTA6_9NOCA  ali  20  3..........LPQTDLFTRADALTFGLTDDDLRRLRRTGELSVLRPGFYVPSAVMQSASPTERHSLLARSYLLSAPGEVLSHVSAAIAWGFDIWQLPLDKVHMTHGLDYASKRRQLRIHGTTLEPTERTTINGFPVTTAARTIVDIARTTVERAVCVGDSALRSGHTDSDALSTAVARFRTGIAAARRAVSLMSGRSESVGESRSRMLFETLPLPTPLL.... 216
44 1.000e-48UniRef50_F9Y0Z7 Uncharacterized protein n=28 Tax=Bacteria TaxID=2 RepID=F9Y0Z7_BIFBU  ali  39  49MKHHKEVDALIAQAEAAGICIYGRTKSHCSALIRRAKELELKRVFPNMYVKPEYWNALKPDERIQHVACTLHLKHPNWVFAGVTAAALHGFEHPWHLHAGSVTIATASQGTNANNANIKRVFVPHCAPEYVNGIPVTNGAQTVVDCGLTDFRFALPIIDSALRKG-TAIADILNICSTMHRDCTPIFRLLHYANPASENGGESLGRGTIVEGGLMVPELQ... 268
45 2.000e-48UniRef50_UPI000B9B8B7C hypothetical protein n=1 Tax=Luteococcus japonicus TaxID=33984 RepID=UPI000B9B8B7C  ali  18  4................FTRAQLAQRGVTDSDIRRLVGEGSLARVRRGDYLDTSTRPVPQFEDRHRILVQATWPRLHSGVLSHHSAAALHGLPLPSHDLGRVHVTRVGDAGGRRASVQVHRARLDDVEVTEVDGLPVTTLERTAADLARLTPDRGLVVVDAALRQGADPVLLAEIVEMQGRTGAPRARAIVALGDPLAESAGESRSRWFMHEFNLPVPVLQF.. 211
46 3.000e-48UniRef50_UPI000371C7F6 hypothetical protein n=1 Tax=Smaragdicoccus niigatensis TaxID=359359 RepID=UPI000371C7F6  ali  21  6..................RRQALRDGTSDEQLQAAVAKGERVRLRNGAYALACEFGELFAEDKHRIMVVAIPRLHKDSVVSHVSAAVLHGLPLWRTDIGRVYVTRPGSTTCETTRVKFIGQPLSSEEIVSIDGIRVTSLNRTLLDVVRLPFEQAVVVGDAALRRGAQLPTNLD-----RRRGNEQARRTLEFLDGRSESVGESRSRVLIDRKSITKPLVQVT. 206
47 3.000e-48UniRef50_UPI0004AEFAF3 hypothetical protein n=1 Tax=Tomitella biformata TaxID=630403 RepID=UPI0004AEFAF3  ali  20  2................LHRRDAILAGITDTDLRRDCHQNNLVHIARGSYLPEPEYRELDVVDKHRARVVAAAHRHGEAVFSHISAAVLHGFDVWNAPLQAVHVTRTGARGRRGPNVHHHPTALEPAEIVEIDGLRVTSPARTITDLARLSLHSAVSTGDHALRLGLAVGDLAASVAATGRHGAAKARHALTLMDGRSESVGESLSRLLIREVGLPTPSLQ... 209
48 3.000e-48UniRef50_A0A143QM68 Uncharacterized protein n=12 Tax=Nocardiaceae TaxID=85025 RepID=A0A143QM68_9NOCA  ali  22  8...............LFTRADALTFGLTDDDLKRLRRAGELSVLRPGFYVPTTLMDEASPTERHFLLARSYLMSAPDEVLSHVSAAIAWGFDVWQLPLDKVHMTHGDYASKRRPLRILHGTTLNPAERTTVNGYPVTTAARTVVDIARTSVDRSVCVGDSALRSGHTDSDALAHAVARFRTGIAAARRAVSLMNGRSESVGESRSRVLFETLPLPTPLL.... 216
49 5.000e-48UniRef50_K0F032 Uncharacterized protein n=11 Tax=Nocardia TaxID=1817 RepID=K0F032_9NOCA  ali  20  1..........MDAPQLISRQQALAAGISDSELRRRCLDGSWWRVRAGRYVNAPEP-GLTPAGRHLVLALATCEAMPDAVASHCSAVVLHGVPCWSIPLDRVHLTRNRINGGRVTNLVVHSAQLTPDEITIVNGLQVTTAPRTVVDIARSSFEQAVVIGDNALHQGLTTADELQECLARHRRGARRAAHTIDFLDGRSGSIGESRSRVAFREGGLPAPELQA.. 215
50 5.000e-48UniRef50_A0A0L7BXI7 Uncharacterized protein n=11 Tax=Bifidobacterium TaxID=1678 RepID=A0A0L7BXI7_BIFBR  ali  56  1MKEHKGVISLLKQAEAKQRCALSSSSSALHALRRRVKSCELISPYPTLFARTDYWTQLNAEEQSLHMIRALATLHPQWTFAGLSAACVYGYQHAYSLHDGSVHIAGNSGITGRDHSKLNRIYMPRIPLWKCQGILVTSPARTLVDCSTFSFSSALAIYDSALCSGHVTVEEINTLAIQTNCDEAAVAKLLRYANPASENGGESFTRGQIILCDFAVPLLQVE. 223
51 5.000e-48UniRef50_A0A1Y4CHX1 Uncharacterized protein n=6 Tax=Olsenella TaxID=133925 RepID=A0A1Y4CHX1_9ACTN  ali  32  7....ERIADLLSRSEGEGSCYVPRSGAIRRALQRRVAAGTVVSPAPGLFVSSRTWSGLKKNDQMLLVVRGLQTMHPNWVFCGPTAALVYGIDVSFSLTDNVHLAVAPGERGSDHGLVRRHGVLVPGDVEQHDGIRVTSPEKTVFDCLRWDFPHGLGVVDSALRSGVVRRSELEERASSRLSGKELALTTLSWADPRSENGGESIARGRMLSLGYVCPELQVE. 235
52 6.000e-48UniRef50_A0A177YH18 Uncharacterized protein n=13 Tax=Rhodococcus TaxID=1661425 RepID=A0A177YH18_9NOCA  ali  23  1..........MDFDGLFSRADALASGMSDGQLLRARRRGEVLTIRPGAYVTSEHFGTLDSEQQHLMLARAIALDSP-VVLSHQSAAIAWGIDVWGLPLAQVHTTNGRSTARSSRRWRVHGTALDPDEHTSRDGVGLTTPARTVVDIARTDFEHAVCVGDSALRRGLVTIGELQESVVRHRTGVQNAVDAVAAMTDRSDSVGETRSRLILVDAGFVP....... 209
53 6.000e-48UniRef50_A0A1Y2N614 Uncharacterized protein n=1 Tax=Pseudonocardia autotrophica TaxID=2074 RepID=A0A1Y2N614_PSEAH  ali  21  4........DAVPGAGPFRRADLHAAGLADSGIAAALRAGQLRRVCRGMYVPGPRPTASREPARHLLAVRGVARLGVPAVVSHASAAIAHGLDVWDLPLDLVHLTRRPSGARRGRDLHLHVGPLSATDVTYVGGLAVTTPARTAIDIAREPFAQAIVVADAALRAEHTDRAALTEALAAGRTGVGRAARVVEFADGRSASPGESRSRLLFHRSGLPEPVLQ... 226
54 8.000e-48UniRef50_A0A0D0LC46 Contig_40, whole genome shotgun sequence n=5 Tax=Nocardiaceae TaxID=85025 RepID=A0A0D0LC46_9NOCA  ali  20  2.............ARITSRSEALAQGYTDSELRRMCRTGDLTRLRRGAYASSDDIANLSEQERHLLLARAMLTTGPDAVLSHVSAAIAHGIDLWNVPLSAVHMTRNRRTGGRTGRVRVHASPYDADEVTDAAGFRSTTVSRTIADLACLPFDEAVCAADDAARRLGVTGTQVEEILARRRSGHARAHRVALFMDAGSESVGESRSRVLLRAAGFA........ 210
55 9.000e-48UniRef50_A0A1D8T9L1 Uncharacterized protein n=6 Tax=Rhodococcus TaxID=1661425 RepID=A0A1D8T9L1_9NOCA  ali  20  4...........EPAGLIWRRTMLAHGYTDGELHRSRTCGALVPVRRGAYLRKDDFTQLDTLGQHRVLAQAALASLSDTAVSHASALALHGIELWNVPLAVHLTVNRNRGGKKSRRRHLHAAPFDPDEVTVIDGITVTTVARSIVDFARTPFEQAVVSGDHALRLGFTDRRELAEAVARHRTGARRAERAVSFMDGLSESVGESRSRVLLHRSGMPRPELQ... 217
56 9.000e-48UniRef50_UPI0008317F0C hypothetical protein n=1 Tax=Arthrobacter sp. B6 TaxID=1570137 RepID=UPI0008317F0C  ali  24  7....AVLPALPSTGNLWRTGQLHEKGLNSRAIKLLLRHGKLVRLRYGCYIRGDLWDKQTAATRSKQLIQAHAHSTGDFVYSHTSAARLHGLFLWNVDDLIHLLLRSPSSERLGKDVRGHTQPYTESDVVKIGNLRVTSLERTVVDCAMLSYQQALVLVDHALRLGADTLMEAMAEGLPGRRGIRNLRMALLNADSRSESAGETLTRELLARLNLPMPEPQV.. 231
57 1.000e-47UniRef50_A0A2R3SBG7 Uncharacterized protein n=1 Tax=Rhodococcus hoagii TaxID=43767 RepID=A0A2R3SBG7_RHOHA  ali  22  7..............HALRRRDALARGYTDSEIRTLCRNGGLDRLRPGAYLRGGV--ELDPRQRHVELIRATLGVSVDAVVSHQSAAVLHGLPMWGIPLDRVHVTRDRTGGGRRRHLHSHSAPLPDRNVLVRNGIPLTSLARTVADLCRTSFETAVVIGDAALRVSAVQPDEIRDASAIGPPGYPAALRALEFLNGRSESVGESRSRVALAALGLPAPDLQAS. 217
58 1.000e-47UniRef50_D4BQF8 Uncharacterized protein n=67 Tax=Bifidobacterium TaxID=1678 RepID=D4BQF8_BIFBR  ali  51  1MKTHKEVAALLQTAQREQRCAIGDGGKLYTALRRRTKIGEVVSPYPNLFAATSYWKSLNVEQQSMHLIRALAKVHPTWTFAGLSAACVYQYEHSYSLHNGTVDIVSPKGANCGGASGLNRIYMARCSQYRCQGILVTSPARTLIDCASLPFDKALAIYDSALRLQHVTKLDVETLIVQTDCNETNVKRLLRYANPLRENGGESWAYARIRQLGFAEPLFQTE. 222
59 2.000e-47UniRef50_UPI000464E7FF hypothetical protein n=2 Tax=Tomitella biformata TaxID=630403 RepID=UPI000464E7FF  ali  24  11..................RSDAVLDGATDSQLRSRRRTGELVHLTRGSYLLQTDYGSLNALGRHRARISAVAHRHGDAVISHVSAAAMHGYDLWDVHLDAVHLQAGPANGKRRHGVHRHREQLAPGEIVSVGGILVTSAARTIADLARTSLKSAVVTGDCALRRGLPTAALVAEVAAAGRHGAPNARHALALMDGRSESVGESLSRLKIRELRLPAPELQ... 216
60 2.000e-47UniRef50_R6YT89 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6YT89_9ACTN  ali  28  14......LDHILDEAECY-RALALACEDEARAFRRRCENGSIVSPAHGAFARTIYWESLNPREKALHIIRAEAARHPSWIFRSHCAALIWGLDVPYPLLDTTSIIA---ARPPRPCIIAARRPSPRDEIESVDGIKVTSFWQTVSECLRAPFSYGLAIADSALRRTNQTRANLMSHLERGYPGIRQARFIASYADGRSENGGESRVRAFFIAHGYPIPELQV.. 227
61 2.000e-47UniRef50_A0A0Q6JRY3 Uncharacterized protein n=3 Tax=Rhodococcus TaxID=1661425 RepID=A0A0Q6JRY3_9NOCA  ali  18  60..................RAGLRRRGVSDGEVRAAVRSGSIVPVRRGVYVDPATTDLSDDRTRRLLLRAAVLSSDSDLVVSHSSAALVHGIDLWPDIDRRAHLTANRSGGGRGTSRVVHASPLHPDDVTTVDGVRVTSLARTVVDLACRPFESSVCSGDAALRRTSADDLAATLARAHGRRGIDRARRAIAFMDGGAESVGESRSRVYLHRHGLPAPALQ... 264
62 3.000e-47UniRef50_A0A0Q5L7M8 Uncharacterized protein n=2 Tax=Frigoribacterium TaxID=96492 RepID=A0A0Q5L7M8_9MICO  ali  19  10.PSPATIPPEPLVGTLIHRSSIVSAGRDDRALRRAAERGELVRVAPGTYVAATAWSRASPEQRHAVVVRAVARSSADLVVSHRSALAVHGFPLLAPMPSRTHVIHRARRTTQTTSLVVRHAPLADEEVGSVDGLRVVRPLRAATDTARLDLRSSVVVLDHGLRQGAFDDAALRAAVEGAPRGRRRALLALDLADGSSESPGESLSRVVMVEIGVPLPQLQKE. 234
63 4.000e-47UniRef50_Q0S653 Uncharacterized protein n=4 Tax=Rhodococcus TaxID=1661425 RepID=Q0S653_RHOJR  ali  21  2................LRRQEALNRGYSDDEIRRLYTRGEWQRIGRGAYLSASMYSALGEEERHRFLIDTVHAVSDDAVLSHQSAAVVYGLPLWKTPLDRVHVTRNRLGGGRIKRRTTVHCAPIGEHVAVVDGHSLTLPARTVIDLARLPFEQAVVLGDAAVRRFGISREDLDAELARRRHGVDAARRVVRFVSGRSESVGESRSRVMLSSAGLPAPSQQ... 209
64 5.000e-47UniRef50_G1WHQ5 Uncharacterized protein n=1 Tax=Collinsella tanakaei YIT 12063 TaxID=742742 RepID=G1WHQ5_9ACTN  ali  27  7....ERINEILTAARSDGRLATCQDKNLRRACGRLVESGKLVMPYQGLFAEKAYWDELEMRQQAKCMIKSLARMHPSWVFCSHSAAVLHGLEVSTSKLKHVHVV-----GTREPCGIVRFHNNRHAETAMVDGVEVTTLERTVCDCVRAGFRYGLATVDSALRTSQVSPEEFRDRLERVCKAINNVLDVFDYGDGRSENGGESYARAVMIENGVQLPDLQVE. 223
65 5.000e-47UniRef50_UPI00093148AD hypothetical protein n=1 Tax=Collinsella phocaeensis TaxID=1871016 RepID=UPI00093148AD  ali  29  4.RGWEAAERLLDTAEAEARFAFAGGRAEARSLSRACVAGEAVEVSRGYYARASYFEALPQRARAMHLIRAMARKHPEWAFASFSAALVHGLQVTNRLTGIVHLAMGARENRSIRDARIKCHLIRDDSYELVSGIRVTPLRATVLDCLRANFPQGLAIADSALHWNLIDEDDLRRYVEHRRRGIRMARKVLRWADGRSENGGESMARAIMIDLGFVPPDLQVE. 228
66 9.000e-47UniRef50_D2Q902 CTP synthase (UTP-ammonia lyase) n=7 Tax=Bifidobacterium TaxID=1678 RepID=D2Q902_BIFDB  ali  39  1.................................................MENEYWNTLDPAQRTIHQVRALQIQNPRIIFAGPSAVAVYGYEHPWSIHASGIYRACSRGNQKPTNHALGRIYMPRISERIINGIRVTTPERTLLDCSMFPFRKVLPIFDSAMAQDSELSEKITDLIPRIRRNTDALKKLLAYCNPLSDNGGESFTRATMIEEGFQNPLIQ... 173
67 1.000e-46UniRef50_A0A260H9T7 Uncharacterized protein n=9 Tax=Nocardiaceae TaxID=85025 RepID=A0A260H9T7_9NOCA  ali  21  3..............RIVSRSDALSRGISDAELQRYCRTRAWRRLRPGRFVSREEFDALSREDKHRVVAEAVATTAPDAVVSHVSAAVFHGLDVWNADLGRVHITRNRARGGGRGSAVVHTSPYTDEEVVDFDGVRVTGLARTVADCARLPFETAVCIADLAARTRGLTAEDVVAALDPHHPGNRMARRVAEFMDGRSESVGESRARVLLHHLGY-TPQLQVT. 216
68 2.000e-46UniRef50_A0A285EGB9 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=7 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A285EGB9_9ACTN  ali  21  1......MSQLPPWSGLLRRVDALAAGLSDGELARFVRRGELERLQRGAYLDTGT----TVHRHRAVIEATVAGLRRPGVVSHASAAVLHGLPLWRVPTARVHLIRRPPAAGSSARVHLHVARLPEDQVTVVDGLRVTDATRTVVDLARLPFEPAVVTADAALAARLTTRAALTACLAGMGPGARRAARALDFADERSESVGESRSRVLIHRVGLPAPEVQ... 214
69 2.000e-46UniRef50_A0A239JX28 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Micrococcales bacterium KH10 TaxID=1945885 RepID=A0A239JX28  ali  20  15...RTVVDRFFDGAPAVQHRQELLRDFDPDLLARYVKENQLVRIAHGYYAKSTRWQELSKERRHRELAKAVSRQLPHMQFSHSTAAILMGLPWLDPIPTRLHVVVGSQSNNRSTASIMRHRIDLDPRPVRVDGVRTTSPTRTVFDIACSSFANGLACADAALKRRILSVSTLQKLVESTRAGIAKARLVARLVDARAESPGESFCRALIYELGFVMPELQY.. 236
70 2.000e-46UniRef50_UPI000D750B05 hypothetical protein n=2 Tax=Nocardioides daejeonensis TaxID=1046556 RepID=UPI000D750B05  ali  22  1MGTNGHMLQL--PTTPFLRSDALAVGLTPGSLQSALARNEIRRVFHGVYAPTSLTDTID-----LRAACAALVLPPHCVVVERSAAWLHGVDLHAPEPDLEVVSLPGHTTIRRPGVYAGVRDLKDRDLVTLGGIRVTSPLRTALDLACLGVLPALAALDSFMRRFQISREEFEQELPRRRRGVVQLRRLIPLATPLADSPGESWLRGRLIEDGFPPPEPQIE. 223
71 2.000e-46UniRef50_A0A2T5LAY5 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2T5LAY5_9NOCA  ali  18  34..............RPLLRRDALARGFTDGELRTLCRSGGWARLRPGSYLSPEAQELLDDRARHRALLTATLGLSRDAVVSHQSAAVLHGLSLWQIPLDRIHVTRDSSGGRRTRHLHSHSAPLSTDDVVELGGARVTTVARTVADLCRTPFERAVVVGDAALANPDLARDAIGSALAAGRPGHPAALRALAFLDGRSESVGESRSRAALDALGLPSPDLQAS. 246
72 3.000e-46UniRef50_I6X564 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=I6X564_PSEPQ  ali  22  18.....................LTTLGLTDAQLKQHLRDGTMVRLRRGVYAPT---QQADVFAEHRRRIQAAAIVHDSSVFSHTSAAVLHGLPVPIESLREVTMTRRTPGHGDHSDLRVRRTAIHDDEVTRIAGLPVTTLSRTVTDLARTPFEWGLAVVDAALGRGL-KRDFLQDELHRHPRGVRQARRVLALGDGRVESPAESLSRFHMMRAGIPAPELQFE. 219
73 4.000e-46UniRef50_UPI0009FC60DB hypothetical protein n=5 Tax=Nocardia TaxID=1817 RepID=UPI0009FC60DB  ali  20  13..........MEALQLISRRQALASGLSDKQLRRLCRTGQWHRLRAGRYLN-SPGSGLGATDRHLLLTLATADTTSDSAISHCSAAVLHGMATWHISLDRVHLTRNRINGGRVSRVVVHSAQLEPDEITLVEGIRVTTPARTVIDIARSGFEQSVALGDSALRRGLTTTAELREHLRRARHRPGRRRQVLDFLDGRSESVGESRSRITLRHCGFPEPEVQ... 226
74 4.000e-46UniRef50_A0A087CH66 CTP synthase n=1 Tax=Bifidobacterium pullorum TaxID=78448 RepID=A0A087CH66_9BIFI  ali  35  1MRISAGIQTIIDQAAKEKRCFYGSTHSQRRAMLNLARDGELKCTYCNTYMTANQWDELVPPDRVLYTARSLGERHEQWVFAGHIAVAAHKLDHPWRIHDNTVVIAASCSPTVRPSSMLRRIYAPRVISCTKSGIAVTTIERTLIDCALTSLQDVLSMFDSALRLELTTKDAILQECDSLRRDAGRVLRALHYADARSENGGESECRAVIIEAGFMVPELQVE. 223
75 4.000e-46UniRef50_A0A0Q4FCA8 Uncharacterized protein n=6 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0Q4FCA8_9MICO  ali  23  4........................TGNSANALTRAVRRDELARIAPGSYMSRQHWDALNEIQRTTQRARAASERWKSAVFSHWTAAAIHGIPLIGAWPTRLHVIVDRASTVRSRGIVRHAIGVDADDVVLIDGMLVTSVARTVLDLADSTFMSAVTAADFALRETRIEKATLAEVWENRFRGHVRARRVLEFATHLAESPLESGSRVNIHLLGFPAPELQVE. 209
76 4.000e-46UniRef50_UPI000687D855 hypothetical protein n=1 Tax=Arthrobacter sp. H14 TaxID=1312959 RepID=UPI000687D855  ali  23  2.........................GFSTRQISDAATHGELVRIRRGVYLHGEDWRSLDRGQRALCKIHAHLSTGGTTVYSHFSAARLHGCFTWNVPETIHVTQLSTKRDAYADDVAVHTRPVTRRDLTAVDGRWVTSLERTVVDCARLEFRKAVIIADHALRLG-ADADLMWQIASAGSRGIRNVRSVLANANGSSESPGETMTRLLIDLIDFPPAELQY.. 201
77 5.000e-46UniRef50_A0A1G9BFP1 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Cryobacterium psychrotolerans TaxID=386301 RepID=A0A1G9BFP1  ali  22  9........DLPTQAELELTRDQALVGLDGRALRRAHQNGEKNRLSRGVYLSARVWDAADDDARYLLRVKSVVLTRARPVLSHFSAARVWGIPILGSWPREVHLMARGGGTRGSKGIVWHHDSLPDDEVTDIDGFLVTSRLRTLVDLARTRFLSAVVSLDAGLRDRDIAKGELVEAVARLGRGCRGARLAAGFADGLSGSPGESASRANIFLSGFPAPLLQVS. 237
78 5.000e-46UniRef50_W9DCL9 Uncharacterized protein n=4 Tax=Corynebacteriales TaxID=85007 RepID=W9DCL9_9ACTN  ali  21  9..................RRSALSTVLGNEELKLRQDEGTLTSVWRGAVHLGPTPDDAT--EKYRLTVIGAATVGGERVVSHQSAAALHGIPLLRPDLTKVHFTTA-KTGRAGAKIHLHRHKLLPEHVTVVDGVRVTTPARTVADIARRGFEQAVCCLDSGLRLG-VDAADLGELAASATRGVACLRRALAVADGRSESVGESFSRATMLTLGIPPPDLQVT. 212
79 6.000e-46UniRef50_A0A255GC53 Uncharacterized protein n=13 Tax=unclassified Propionibacteriaceae TaxID=185283 RepID=A0A255GC53_9ACTN  ali  22  13....................ELAEQGMRPHEIRAQVAAGKLVQVRRSVYRVPEPEGAGDPAEHLQLIEATLGRLRPGACLSHQSAALTHELPIPDKLLGPVHVTRPGSGGKVGSSLHLHRSSVPAEHVVDTARGPVTSLAWTVVDLARLPPIHAVAAIDKALARGLDRAEAMELLDRQPVRGNVSARAVLRFADGRSESVGESHSRWLMHELGLPAPQLQV.. 225
80 8.000e-46UniRef50_A0A1H0IB19 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Nakamurella panacisegetis TaxID=1090615 RepID=A0A1H0IB19_9A  ali  20  10..................RSSLLAGDLTDRDIRQAQRRGELHRFRPGRYADGDRWDRADGAARHRIRALEIGWLGERAVISHTSAATVLGISLPRVEFGRVHATPSAAGRGRTTNINPHRSRLRDVDIAVVDGVLTTSPARTVFDIARLPWEYGIAAADSVLHLGMCTSDDLALEAAARTPGAGRAARIIEFADAGSESVGESICRLRFAQVGLPAPRLQ... 216
81 8.000e-46UniRef50_A0A261EQF4 CTP synthase n=1 Tax=Bombiscardovia coagulans TaxID=686666 RepID=A0A261EQF4_9BIFI  ali  44  1MKHNKRVDALVRQAESQGRCCFGSNNAEYKALHRRLRVGELVSPYPNLYARSAYWVTLDPSRQTVQVAKALGLQHKNWVFAGPTAAAIWGLEHEWSIHHKRIHIARKYGQGAGSKTQLKYVRMKEVSACRVSNLRVTNPARTLVDCGRMTFEEVLPMFDSALRKRLTTAAKVELECCTVRKGRHTILRLLFYANPLSENGGESACRAAIIEAGFQVPQLQCE. 226
82 8.000e-46UniRef50_UPI00068B434D hypothetical protein n=1 Tax=Knoellia subterranea TaxID=184882 RepID=UPI00068B434D  ali  17  1MSTPRR--NPLNPAVLRLAADVRRLGESPKD-KDEAGSPLWQPVRHGVIVPTSTWHRLSADQKHEALVHATALRMDDAVFSRTSATGLWRLPRISPWPAYAEVTTPNKRTRSSGLIRRHH--FVQDTVVEIAGVRVTPLLRTLLDTARFDLLDAVAALDHALHHGMCDVAALEEALESGVKGRARARLALDLADGRSESPGESLSRVQMFRLNLPRPELQVE. 224
83 9.000e-46UniRef50_A0A1Q9UIT4 Uncharacterized protein n=1 Tax=Rhodococcus sp. CUA-806 TaxID=1517936 RepID=A0A1Q9UIT4_9NOCA  ali  20  3..........LDDDPLLLRSQLVRSGSTDGDIRSATNSGSIERLRRGAFAPTAQLNSMSPDDRHRLHIRHAAAARSELVVSHQSAALLHGIPLWSPDLQRVHTVDRPGGGRKSASRHLHPAFLSSKDVVSIQGIAVTSPERTVADLCTLSFEAAVCAADAALNRRLLTVIGVAEALGRSGKKVVKARRVLDFCSDLSESVGESRSRVRMHYAGLPRPAMQV.. 217
84 1.000e-45UniRef50_F1YFN1 Uncharacterized protein n=4 Tax=Gordonia TaxID=79255 RepID=F1YFN1_9ACTN  ali  20  5...........DRHGLVHRDDALQNGISDRRIAAAVRTGELIVAVRGTYLPAAVLVGRDDSEAHRQRCIAAALGPGRPVLSHDSAAAVHGIDLLYPDRSRVHVTNGRSGGSRRPRRVIHNGLLADDDVVELDGVRVTSAARTVADIATTRLPQALTALDSGLRAGLL-VHEIEPRFHTGRRNCGFARHALSFADGDSASPGESWSRAQMIEARLPLPRLQVE. 219
85 1.000e-45UniRef50_A0A1R4JMX6 Uncharacterized protein n=5 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1R4JMX6_9MICO  ali  19  1MRHRIDLPQ--GRMLVRSRSSLCDAGLTDRQIRTAVESGDLLRLHRGAYSSADEWAQLWPEGRHLLKVLAVRSASPGPVFTHASAAVLWGLPLHGVDLPVQVLVDGARHSRITAGVVRRDMRVAEGDIVRIDGIRVTSPNRTVFDVARSMREEGVACADAALRRAAAWHENVMSLALPGLRGVRRARRVIEFADGRAQLPGESVSRLQLDRLGYSNVGLQV.. 235
86 1.000e-45UniRef50_UPI00082ED90E hypothetical protein n=3 Tax=Rhodococcus TaxID=1661425 RepID=UPI00082ED90E  ali  20  9.................RRRDAHARGVTDIEIRRLCRSGIWTRLSRGVYVPTRVYADADERGRHLYRALAAAQARPGTVLGHVSAAIAHGLELWRTPLDDVHLTCGRSGGGRSRGRILHAEHFEADEVVDIDGVAVMSVARTVADLARLPFEQAVVAGDHAMRTAGVAGAEVSAILARSHPGNAKAVRAVRFMCGHSDSVGESRSRVLFVRSGLPIPYTQAE. 218
87 1.000e-45UniRef50_A0A0Q5CPV1 Uncharacterized protein n=1 Tax=Frondihabitans sp. Leaf304 TaxID=1736329 RepID=A0A0Q5CPV1_9MICO  ali  21  11.................RASAYGRDSREARRLSRGADRGDLTLVHAGVYVRTADWSTLSDRDRHVLRVVAARSLGDRLIVSHESALAFHGVPILGRWPESVHVTDPERSRGQSHGVTKHGAPLDDDDVVMRNGLRITSLERTLLDCALRGFSSSVVSLDAELRQSGITVDGLLSALEGRARGRRAAERAIRFASPKSDSGGESWARCRLFELGAPVPILQ... 218
88 1.000e-45UniRef50_J9RFN9 Uncharacterized protein n=50 Tax=Corynebacteriales TaxID=85007 RepID=J9RFN9_9ACTN  ali  21  6..........LDRYGLIRRGAALDAAFSDNLLAAAVSAGDLIRLIPGVFVPASDDFAGHEGDQELHRLKSVAASAPQLPLSHVSAAAVLGIPLLKPYTERVHVTNGKRAGGIATHRHVHAAALTEDELAVVDGILVTRIERTAVDVAAGGFAQALTAFDQALRAG-ADRELMWRILTSRRRGGRVARRALALADGAAESVGESWSRAQMIEAGLPAPGLQHE. 225
89 2.000e-45UniRef50_A0A2Y9A3S6 Uncharacterized protein n=1 Tax=Georgenia satyanarayanai TaxID=860221 RepID=A0A2Y9A3S6_9MICO  ali  21  14..............TLIRTRQAVSRGVDPRR-----NASQYVKVRHGTYLPRTEWEAAGKERRYELYVRAVESLKVSAPLARESAAVLLGLPIVGGWPTVTHVVEEAGSGGRGSAHVARHGTRYVPEVILVDGIAVTSAPRTVVDLARRSFASGLASADYAVRHGLVTTAELEAEVERGTRGIQRARAVVEHADGRAESVGESLSRAQMITLAVPLPVLQEE. 220
90 2.000e-45UniRef50_A0A0Q6VD55 Uncharacterized protein n=5 Tax=Aeromicrobium TaxID=2040 RepID=A0A0Q6VD55_9ACTN  ali  15  2...DDRIRTQALTRGYVTRAQIIDAGYRDRDIKSALRAGLLVRLRHGIYAYADDVARLTEVERHRLTAFAVIRLGDGFVLSHQSACAAHGIDHASPDHDVHVTRLDGRAGRREAGVVHHVGDVPSDDVMRVDGRPVMRPERAVFEAATCTTESGMVAASSALHLGHVTAEGLEDTVGRRWPGARHAALAVRLSDGRCESVGESRSLFMMWRGGIPRPEQQV.. 224
91 2.000e-45UniRef50_A0A1X7JL84 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=7 Tax=Agreia TaxID=110934 RepID=A0A1X7JL84_9MICO  ali  23  12............................DSRLSRLAARGELLQIRRGVYIPSSTWRSMDFDARYRMQVFAVARTRREPVFSSYSAAVLWGLPIVGPWPRDVHVLAERSSGGRSPGIRRHAVGMPSTLVRTAEGLVVTDIARTIVDVAASTFVSGVAAADFALHRGLVTREELRSVLSEPLRGSRQASGVIEFATPLSGSVAESVSLVNMARHRFPRPILQQE. 210
92 2.000e-45UniRef50_D2Q5Y4 Uncharacterized protein n=9 Tax=Bifidobacterium TaxID=1678 RepID=D2Q5Y4_BIFDB  ali  35  11MKNHARVNRLIEEAMAERRCAFSPIESENAALRRRIADGGLLRPARGLYVPSDYWNGLDPFERSMHMARAMARQHPKWVFVGNIAATAHGFEHSWKLHDGTVSIASAYHNGFCRIAKVRRVYIPEMSVEVVDGLPVLDKIRTVLNCSVYDFPYGLPIADSALRQG-IGRRDLSAGCSAMRIGYAQAARVLRYADGASENGGESMCRAVMIDEGFAIPLLQ... 233
93 3.000e-45UniRef50_A0A1R4KEE2 Uncharacterized protein n=1 Tax=Luteococcus japonicus LSP_Lj1 TaxID=1255658 RepID=A0A1R4KEE2_9ACTN  ali  21  4................RTTRELLAEGHSSEYLRRAVEQGNLVRVRRGAYAASA---SPDARQRHRQLIDATLPGLRDAVLSHHSAAVVHGIELPHAVPSRVQVIRTRSSKGGGQRVHTRMVRLPPEDIECVDGLVVTSRARTVVDLARMGFDAAVILLDAALRDPAGQRAAIEAVIRRRVPGIKMARDALAFADGRAESPLESRSRLMMWRHHLPMPVLQ... 217
94 3.000e-45UniRef50_C0ZT69 Uncharacterized protein n=42 Tax=Nocardiaceae TaxID=85025 RepID=C0ZT69_RHOE4  ali  18  9.................RRPEQLSTGRTDSEIRQACASGNWSRIHRGAYVPSDHLSRLDAYGLHRLRVEAVATASAHAAVSHISAAVVHGFELWNTPLEVVHLSRDRRGGGRSARRHVHSVSFTDDEVTHVDGLRVTTPARTVADLARLPFEPALVVGNSALHRSALTKDAVAAALSPNHPRHRHALHALTAMDSRIESVGESRSLALFLQEHLPLPEPQVE. 218
95 3.000e-45UniRef50_UPI00068FC0D9 hypothetical protein n=1 Tax=bacterium OL-1 TaxID=1504822 RepID=UPI00068FC0D9  ali  31  22...............SRGMCLCVKSDRTRQLLERRALAGTVTEPFPRVYARADYWRSLSPSARSLHVIRAAAALHPAWVFCGTSAAIAHGLQVSEPDPSVVHIVGGASSASRGKHVARHRSSTGDGEFEVVAGVKATPLDRTTADCLRLPMPAGLAVADSALRDCGLTREDLVGFVRAHARGSRQALQTIAWADGRSENGGESVAHGIMIELGFCVPELQV.. 232
96 3.000e-45UniRef50_D3R4A5 Uncharacterized protein n=9 Tax=Bifidobacterium TaxID=1678 RepID=D3R4A5_BIFAB  ali  34  11MRRNRVVEQLLDSAQHGHRCAYACNRNERVALARRARSGELNQVFRNCYVRPDYWDSLRPAERTWHICRTVNQYNPGVVFAGKTAATLLGFPLSHAVHDGTIVCAARRNWTSE---RTQHIYTDMDSAISMQGLLVTNPAHTLVDCALLPFEETLPMFDSA---STTHFKQIMEVMGTMSRDVSPVLRLLHFADPRSESGGESKARAVIIVLGFVVPELQIS. 227
97 4.000e-45UniRef50_UPI000B9AFA9D hypothetical protein n=1 Tax=Luteococcus japonicus TaxID=33984 RepID=UPI000B9AFA9D  ali  18  1MARSAGTISLGPMSRLVTHRQLRAEGFDAHEVSRKVSAGSFHRIRRGVYLDGEPKD--DRVGRYLVCCAVLARCGPETVLSHASAAAAWGLPLPWAALGTVHVIQPRRKGGRSRAGVCVHQAKLGDDACLRFGHRVTTLPRTLVDLGRLDLGWAVAAMDDALHHQRCAHHELATALRAGRPGCRGAARAVALADHRSESVGESLSRVLLVQAGLGPDELQHE. 224
98 4.000e-45UniRef50_UPI0009851828 hypothetical protein n=1 Tax=Olsenella urininfantis TaxID=1871033 RepID=UPI0009851828  ali  32  6...............................................LFVREAYWQNLNPLERHLHLLRGLSTLHPSWVFYGVSAAAVHGLWVSYGLLDRIHTASRNVSHGHDSECHARHHLSSREQITKIDGVRVTTLDWTVFDCMRLSFSEGLPIADSWLRRSGQTREALLNLVRSLGKGAKQARITASLADGRSENGGESIARAAIIELGYRIPELQV.. 182
99 4.000e-45UniRef50_A0A1Y3UGZ2 Uncharacterized protein n=2 Tax=Collinsella TaxID=102106 RepID=A0A1Y3UGZ2_9ACTN  ali  28  26.KARQALEHALEEAESNQRFVFPRSGHILQQAKQLSMNGILGEAYPGHYARATYLESLSPRGEMYHLIRTLAHRHPSWTFCLYSAAVVHGLQVPFALLTKAHVGVTQPRNRRSVSSCYAYHALPCLASTTVNGIRVTPLEATVFDCLCHTFRQGLAIVDSSLHHQLTTVEKLQAYAERYRHGAAKVWRALRYADGRSANGGESVVRSGIIELGFVIPELQVE. 250
100 4.000e-45UniRef50_A0A174BMX6 CTP synthase (UTP-ammonia lyase) n=12 Tax=Bifidobacterium TaxID=1678 RepID=A0A174BMX6_9BIFI  ali  34  1MKAYPQIDALLDQTENAQRCAHSSDPLIQKGLYRRYRAGDLARPYPGLFARAEYWNQLNEPEQSLHAARTLSRLHPNWVFAGITAAAAHGFDHPRFLHRLTITLPNHGSYRPHDKLNIIYSPYPRENAVLANGIHVTNPPRTLLDCGRLEFIYSLPIFDDAAADG-IEEKQILQECARTTLDCSRIFKLLRYTDAGSENGGESFARAVMIENGFAVPQLQVS. 224
101 4.000e-45UniRef50_G1WII3 Uncharacterized protein n=2 Tax=Collinsella tanakaei TaxID=626935 RepID=G1WII3_9ACTN  ali  29  6...DRTLDALLAEADAKGMCFAPRDRHLKRLLRARVNSGSVKEPAKGLFVSAARWESADKRAQAWRIIRGLQHLHPTWVFCSFSAALIHGLELSNRLLKPVHVI----SHRSRIANDIVHHAVDSFEIRTVMGLRATDMTRTLFDCLSCTFPQGLAIADSALRTTRTSREGYLRAIERRYHGVQKALRTMSHANGLSENGGESYARGVMIELGFKTPDLQV.. 225
102 5.000e-45UniRef50_A0A1Y1RNQ3 Uncharacterized protein n=1 Tax=Rothia nasimurium TaxID=85336 RepID=A0A1Y1RNQ3_9MICC  ali  20  12.................TTRQLLNQGYTFDRINRDVKAQKLTRIRKGIYCPTAWWGSLKPHEIYRAQIAAVHVAEPSTTFSHAAAACLHGLALAKTPPSVDI-VGPPDSRGRAAGTRKHYTYKPEEHRTLVGGFSVTGLVQTVVDCARLPIEEATVIADSALNQKLVGVEELSYELSAGW-GSQKCRRVAISMSPFAESPGETLLRLILIDAGLPAPAEQVE. 218
103 6.000e-45UniRef50_UPI000423AAC9 hypothetical protein n=1 Tax=Pseudonocardia spinosispora TaxID=103441 RepID=UPI000423AAC9  ali  22  4..........MDDLALHRRRGLLDAGFTDAELRQLRKTGELTMIRRGNYLAGPEPD--DDADRHRLLVGALGELAHGAVLSHASAAVMHGLPVWGMPLDRVVTRDRRSGARRSARVHMHAAPLGPDDLCEMDGFSTTSIARTVLDVARSPFEAAIVTGDAAVR--LITSTELASALASRRPGCARARRAVGFMNGLSESVGESRSRVAIALAGLPPPVPQ... 214
104 7.000e-45UniRef50_UPI000B80F5EF hypothetical protein n=1 Tax=Arthrobacter sp. HG TaxID=1638643 RepID=UPI000B80F5EF  ali  22  17.................RTHEVHEAGFNHRRIAALVRSGALRRLRRGCYIRGSTWAAQKPWVRSLQLIAAHAHSSGGLVYSHTSAARLHGLFLWDVGDKVHITQTTASTTSHGKDVVPHTRPLAKIGAVFVKGMPCTTLEQTVVDCLMLNYKQALVLMDHALRKG-ADASKLQEMCAAGRNGVLTLRRALENADARSESPGETLTRELLQRLRIEPPELQV.. 228
105 7.000e-45UniRef50_A0A261FW60 CTP synthase (UTP-ammonia lyase) n=2 Tax=Bifidobacterium lemurum TaxID=1603886 RepID=A0A261FW60_9BIFI  ali  42  1......MNELFADAEKAGRCVVGEDDTTRAKLRRRVKSGEAVCPYRTLYARAEYWNGLNAVEKTQHVVASLARRHTQWVFAGLSAAAMLGIDHSWSLHDGAVTIATQGSCHSVKGYRLRRIYMPSIPTQEVRGIHVTTVARTLVDCGLMPFMFALALFDSAFRRQLVTEDEIVAVCDGKKDACGPVFRLLHYADPLSENGGESLCRAVIIEEGFAIPELQH.. 222
106 7.000e-45UniRef50_UPI0007E33C47 hypothetical protein n=1 Tax=Gordonia sp. LAM0048 TaxID=1633223 RepID=UPI0007E33C47  ali  18  1......MDLPTDPHGLILRNETAGTHISDEQLQRMVSTKALTRLWPGAMADFTAVSELHAIEKYRLTVIAAARARPGRVMSHASAAAMHRLPMLWPDLS-QVHVTSPRVGKRAKSIVRHQATVELQDIGVIDGVTVTSIERTACDVARLGTRQALAVLDAALRR-DADPDRMRRILDRGFKGVEMLRQAMAHANASSESVGESLSRAVMLEFDLPVPRQQVE. 219
107 8.000e-45UniRef50_A0A1M3EWX0 Uncharacterized protein n=1 Tax=Cellulomonas sp. 73-92 TaxID=1895740 RepID=A0A1M3EWX0_9CELL  ali  21  18.............................AVMRRAAGRGDLRRVRRGVYVGADHWQGIEPRQRNLIEIRAAIATRSPSLVSHRSAAALWGLPVVGAGGTEVHLTVTGDSGPDNRRTYVRHAVAGPVPASEIDGIPVTSAARTVVDLARTGFLTGAAAGDAALHRGAVTPDELQAALAARGRGIRMARDVVAFVDGRSESAGESLSRVRMRELGVPAPDLQH.. 213
108 8.000e-45UniRef50_A0A087DFS0 CTP synthase n=3 Tax=Bifidobacterium scardovii TaxID=158787 RepID=A0A087DFS0_9BIFI  ali  37  1MRTNDSINRLATEARRGRRCIAPSSPAEDRALRRRAAVGEMTKPFPGLFICTEYWNQLVASERIVHIARSLAGRHPQWVFAGPTAAAIHGFEHQWSIHEDGVFIVSRHAQSGRNKYGVNRIYMTDDQALIVQSLAVTSPARTVLDCARLSFHHALPIADSALSMHPDLLERIGSL--RCRRDRTPVERIMRYANPLSDNGGESLARAIMIEEGFPVPALQ... 219
109 8.000e-45UniRef50_A0A2D9H7F1 Uncharacterized protein n=1 Tax=Nocardioides sp. TaxID=35761 RepID=A0A2D9H7F1_9ACTN  ali  24  19......VMELVDPDGILLRRDVIAAGYDDKALRRQVTGHALARIRQGAYCLRSTWESSSREQRHLLMVKAVCRQYGDDVVSHLSAALWWGAPLVGVRADAVHLTLDGEAGRRQAGVVHHRGACHVGDVTRASGHWVTSPTRTALDCLILPRRSAVCVLDWFLHQSLTTIDELRQRAMGNWPGSLPLMHLLALADSRAESPGETLVRLLIHESDIPDPVSQ... 237
110 9.000e-45UniRef50_A0A1H8KY58 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=15 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1H8KY58_9MICO  ali  24  23.......................AAGLNTRAVRALLANGELVRIRRGVYSLGATWRGANSDDQYRLFVRATVVTAEQPLLSHLSAAALHNLPIIGPWPKVVHAINNDTAGGSSARFTTSHRSVVEPEPVTINGCAATTLARTLIDVAATSFLVGVTMMDHALRAPALSKEDLYAELAHPRRGGPKVRRVIDFSTLLSANPGESMSRVRMHELGFEIPELQV.. 240
111 9.000e-45UniRef50_A0A0M2CQK2 Uncharacterized protein n=4 Tax=Kocuria TaxID=57493 RepID=A0A0M2CQK2_9MICC  ali  22  5............PGRLLTLEALQDLGLSPSTVTRAVRRGDLLRIRQGVYATPSWWRDLGAEGRLRQMHAALALRAASPVFGHSSAALLHGLDLLHRPAAPHVVSPPGRGSRNNRTCVHHWAELPPEHVVRVGGLLATSVPRTVLDCATLPLREAVATADHALRRG-TERAELLALLERRAPGCRRARRVLDLADGRSESPGETLTRLVLLRARLPRPELQV.. 216
112 1.000e-44UniRef50_G5F506 Uncharacterized protein n=4 Tax=Olsenella TaxID=133925 RepID=G5F506_9ACTN  ali  26  4.DADQRIGKLLDAGERERRLVHADTRADAAKLQRLRAKGALVSPHHGLYVRTSAWAALTEPERALWKMRALCARHPGWVFCDVSAALAHGLSVPLREVGTLHVLSSPGSPTRSTGAIVRHATSARGACWK-DGVHVTDLAQSVYDCLRLGFRDGLAVADSGMAAMGLTLADRLIALHHGEPGLRRALGILRHADPRAESGGESIARAAMLELGFELPELQVE. 228
113 1.000e-44UniRef50_D1BBV8 Uncharacterized protein n=1 Tax=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) TaxID=446469 RepID=D1BBV8_S  ali  20  7....EAVRAVAARLPVVTAADVARRGLDGMDLRAACLAGELVRIRFGAYTSARTWASLDALEQYRLRVLAAGRAFKDPIFSHDSAAALWRLPRVGAWPAGIHVSAPEGRGARSVPSVRRHAVSVAPSTEQVEGLRTTTAARTVVDIGRWSFSAALSAADHVLHTGLASAEELRGELQATSPGSRRARRVVLSSDGRAESVGESLSRARMTELGLAAPVLQHE. 227
114 1.000e-44UniRef50_A0A0D5AEJ3 Uncharacterized protein n=33 Tax=Nocardiaceae TaxID=85025 RepID=A0A0D5AEJ3_9NOCA  ali  20  7................VRRSEALADGHADHELRALYERGGWERLVNGVYVPSSRLAGLSEQGRHRLLIDAVLTIAEDSAVSHRSAALLYELPLPAGGFDKVHVTRHRRGGGRANAAVIVHCA-PWVPYATVDGISVTSLARTVVDLARTPLVSAVIAGDAAL--KRCDPQELDAELARGWKGVAQARRAVSLMDGRSENPGESQSRIMLRENGFSV-ESQVE. 212
115 1.000e-44UniRef50_A0A263DTQ3 Uncharacterized protein n=3 Tax=Pseudonocardia TaxID=1847 RepID=A0A263DTQ3_9PSEU  ali  21  2......MLLAVDLPELTLRPELLAAGFSDPELRRLVRAGRLTPVRRGAYVLGSVPDDVLAR-HALAVEAAIGELAPDAVVSHVSAAVLHGLRIWGLRLDRVHVTRPRRSGGRRGSVHVHTAAVDPREIVVIAGVAVTSLARTVADLARLPFEQAVVLGDAAMRADRASKADLLSALDARRPGTRAARRAIAFSNGLSESVGESRSRVAIAEAGLPPPVLQ... 221
116 1.000e-44UniRef50_A0A0N9NBS2 Uncharacterized protein n=8 Tax=Gordonia TaxID=79255 RepID=A0A0N9NBS2_9ACTN  ali  25  16......................LDAGITERRLRAALRSGELVAVGRGVAAETATWKQATERYRLACIAAAIEIGHDDPALSHESAAAVLGLPLLKPRRDRIHLTNGRSSGGVRPNRVIHHGLLPDEDVVEVCGIRVTSPARTAIDLALHMPDFALTVLDSALRMK-VNRLELEERLACQKRNVVAARHALGFANGLSANPGESWGRAQMITENLPVPTLQFE. 223
117 1.000e-44UniRef50_E4VC96 Uncharacterized protein n=4 Tax=Bifidobacterium bifidum TaxID=1681 RepID=E4VC96_BIFBI  ali  39  1...............................................MYARREYWDGLNPIEQASHVIREMARRHPERVFAGLSAAVIYGFEHSWTLHDEPYVYIATDGKSRRSYHRLRRISVRRSDIREIGEVRVTSPARTLVDCALLPFEHVLSMFDSALRRGLVTREEIVAVCDGLRVDCGPVFRLLHYADARSENGGESFCRAVSIEEGFVPPQLQ... 220
118 2.000e-44UniRef50_A0A0Q5J2Y8 Uncharacterized protein n=3 Tax=Cellulomonas TaxID=1707 RepID=A0A0Q5J2Y8_9CELL  ali  26  4.............................GALRRAADRGEIVRLRRGAYVGAERWRATTPTERHRLLVVAAHRDQPDAVFSHASAAALWGLTLIGPWPASVEIAVGAAPGGRSRPGVTRRSCSGHLDVVEVDGVRRSSVSRTVVDLARSPFVSGLAAADHALRRRLTTVEELRSTVEGPARGVRAARRVLEHTSGLAESPGESLSRGRMIELRLPSPVLQH.. 198
119 2.000e-44UniRef50_UPI000A0223A5 hypothetical protein n=1 Tax=Nocardioides halotolerans TaxID=433660 RepID=UPI000A0223A5  ali  18  2......VVELMTPSGLLLRKDAIAYGYDDKYLRRLVLSGQIVRIRQGAYVKTDVWRNLDDRDRHLLLCEAVVAQYDDAILSHSSAVLQHDGPDYGLDLSVHVTHLLDGGGRRGAKVIHHEGRCGAFDITRMDDHWLTAPARTVLDVALHGLEVGVVVADDFIHRGLTTTAELEQLYEQAWPGALILRLVISLATGKSESVGETLGFLLCRNQRLPRPEQQFE. 222
120 2.000e-44UniRef50_A0A261CVI3 Uncharacterized protein n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A261CVI3_9ACTN  ali  20  18.......EHELTPDGLILRRNARTAGLSDHSLQAATRHGTLERVYWGMYLPSGSAGELLTREQRQHRYRAVDAGRGDKAVSHWSAAALWGMPMLGGDLERVHFTANRAGGGRTRACTLHATPWQPDEVIELPGLLVTTPARTAVDISRAGFEQGVCACDAALRMGATRLELETIVARAGRRGIGTARRAVAFADVAAESIGESWSRALMSAMGIPVPELQPE. 242
121 2.000e-44UniRef50_A0A1H1LHZ6 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1LHZ6_9MICO  ali  22  15................RSREEVLDTGVTERELGEAVAHGRLRRVHRGAYVDAEVWDALWPEGRQLVRVCAVRRAGGGPVFSHLSAAALWGLPLVGPIRDDVHTIRSRRHSRTEAGVVRHQMALDEGDIVRRYGLRCTSLIRTVFDLARLLRPEAVVAADAALRMVSIDRAEVDRLCTAGLRGVRRARWIGAFADGRAQLPGESVSRLQLHRLGFRDIGLQI.. 235
122 2.000e-44UniRef50_L7KN62 Uncharacterized protein n=21 Tax=Corynebacteriales TaxID=85007 RepID=L7KN62_9ACTN  ali  22  10............EHGLILRRTALEAGVSDRQLIRAVDAGALVRVWPGVYAPPD--ASRTPEDLHRLKARAATLVSETDVLSHQSAGVLHGMSLLFPDLARVHLTTGHKTGGRETQRHLHSGRLEAEDITVVGGIVVTSLEVTAVDIACSGFFQGLAAFDSALRLG-ADRATMSALLDRRRRGVAVARRALAFADPLADNAGESWGRGQMIVAGLPVPRLQ... 217
123 2.000e-44UniRef50_A0A1H0NZN8 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Nakamurella panacisegetis TaxID=1090615 RepID=A0A1H0NZN8_9A  ali  21  7..........IDRKPLLIRRELMATGYSPAEVERARASGEIRSVHRGVYSPAEYFDRQDLRGQHVLRARAAAHAAPSVVVSHISAAALHGLPVSAVLGRIHLTRPGRTGARGDSRRILHVAPLDPADVIEIDGVRATSLARTLVDVARTEFGVAVPVADAALHQAPTIADQVARALGRGCVGASVARRALQFADGRAESVGESRLRVACRALDLPEPDLQ... 220
124 2.000e-44UniRef50_A0A0M3T559 Uncharacterized protein n=6 Tax=Arthrobacter TaxID=1663 RepID=A0A0M3T559_9MICC  ali  24  20.................RTAQLREGGLGPRAVRRLVEDGTLLRLRPGCYVRSAWWNRLSDDGRRRNRVATLTTSARGYVYSHTSAASLHGLYLWHVDELVHVTQESPSRAGCGKDTAVHTRALAEGDVVELGRTKVTSLERTVIDCATLPYKQALIIADHALRLGASLPKLLAAAGRASHRGIRTLRRVLRFADPRSESPGETLTRDLLRELLFEMPELQ... 230
125 2.000e-44UniRef50_A0A2N3R1M5 CTP synthase n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3R1M5_9BIFI  ali  34  2...............................LSRRYRAGDLIRVYPGMYMRPEYWNGLTPTERVCHLVRSLAHKHPEWVFAGECAACVHGLEVPWVAMRHMVYVIGPCAASTSDCDQLQRIRAYGIQPHCVDGIKVTGLARTVIDCACMDPCGAVAVLDSAIRKGL-TKQELYAECNRQHTDCAAVFPLLPHADQRSENGGESYARAVMMRLGFAKPQQQV.. 192
126 3.000e-44UniRef50_A0A086ZGS8 Uncharacterized protein n=1 Tax=Bifidobacterium bohemicum DSM 22767 TaxID=1437606 RepID=A0A086ZGS8_9BIFI  ali  36  1MRRNPSIDRLADEAERERRYFFGKTNAQRHAMRRRRDAGELMSPYKGIYARKNYSATLDPRTRTMHLIRALGKLHPGWSFAGLSAANIHGLPYLDDDTTVCIATRHSTNQRHADGLTLIHMT--DIPVTTCAGLLTTTVERTLIDCARHSFIDVLGMFDFVLSMGLTTAEGVKEQCATLQKKADTVINVLHYANPLSENGGESMCRAVIIEAGFVLPELQQE. 225
127 3.000e-44UniRef50_T5KRR0 Uncharacterized protein n=29 Tax=Actinobacteria TaxID=201174 RepID=T5KRR0_9MICO  ali  19  5.RMRRAVTIEEARQLLLSRRDVLARGITERELKGMVDGGVLIRVRRGWYAEGEAWAQLWAEGRHLLKVLAVHRSGGGAAFCFDSAAVLHGLPLYRTFPAHVHVLLGRTSHSRVKGCVARHIQVGEGDLEEIEGIRCTSLERTVLDLSRLGPEAAISVADAALRRAATWRGELARRARASGRGIRQARAMIALSDGRAQLPGESVSRLHLHRLGFTGIELQ... 240
128 3.000e-44UniRef50_A0A1H2JLB9 Uncharacterized protein n=2 Tax=Gordonia westfalica TaxID=158898 RepID=A0A1H2JLB9_9ACTN  ali  19  1......MDLPTDEYGLILRSETVGTHITDERLQRMVEGNGLYRLWPGAMADFATVDQLDAIEKHRLTVAAANAGRAGRLFSHVSAAAMHRLPMLWPDLS-QIHVTSPKVGKRTANMVKHQAVVEPQDIEVVDGATVTSIERTACDIARLGTRQALVVLDAALRR-DADLEQMNRILERGFKGVEMLRRLLPHANALSESVGESLSRAVMLEFDLPVPRQQVE. 219
129 3.000e-44UniRef50_UPI000789774C hypothetical protein n=1 Tax=Williamsia muralis TaxID=85044 RepID=UPI000789774C  ali  23  2........DPFEDLELVYRSQLVESTMGDDAIRRAVVGGELQRVVRGVLMPPD--PTLTPEQQYLRRIVGTCRRTRGPVLSHQSAALLHGLSMAGRAYQHVHYIVE-RGAEITTGVYKHHGVLTDDDVVVIGPIRVTSLARTAADVACAGFSSALVVLDSALRKG-VSFELLVEIADRGTPGISTLRAALRYADGKSESAGESESRAGMIEMGIPLPRLQHE. 217
130 3.000e-44UniRef50_A0A1H1VD93 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=5 Tax=Marmoricola TaxID=86795 RepID=A0A1H1VD93_9ACTN  ali  18  2...DDLLALLLGRHCCFLRRDALAAGLGDKALRRLVRGGLLHRIRHGAYTLREHWDGLSETERHLLVARCVLRAGTEVALSHTSAAVAHGAPVWGLSLDDVHLVRDHRSGRREAGVRQHRSPVEEHDVVALDGMRVTSPARTCLDITTSGVEVALGVVDHLLNTEKVTKRLLLQRCAERCPGSLTTELTFRLADPGAESLGETRLRFRCWRAGLPRPVSQFE. 225
131 3.000e-44UniRef50_L8DA18 Uncharacterized protein n=11 Tax=Nocardiaceae TaxID=85025 RepID=L8DA18_9NOCA  ali  19  2................VRRAEALAAGNADHELRALYQRGGWDRLVNGVYVPSSRLIQLSEQERHRLLIDAILMISEGSAVSHRSAALLHGLPLPTGGFEKVHVTRDRRGGGRKNASVIVHCA-PWVPTSTVDGIAVTSLARTVIDLARTPLLTAVIAGDVAL--ERCDPQELDAELARGWKGIAQARRAVNLMDGRSENPGESQSRIILRQAGFDA-EPQVE. 207
132 3.000e-44UniRef50_UPI000300DE5E hypothetical protein n=1 Tax=Enorma massiliensis TaxID=1472761 RepID=UPI000300DE5E  ali  26  6...DQELARLFSAAEDSGTCLYVTERCLRKSLERRMRDGSAVCPHRSLYARAPYWHALRPDDQALHIIRGLQQAHPSWVFCAQSAGLVWGLPISYRNLTPIHVIT--GSHRQPAGQSITAHALRDESIQMVRGVRVTTLPRTVFDCLRATFVDGLAIADRSLRMYAPERREFRGELKRRRKGGRRAVGIMGYADARSESWAESAARALIIMQGFALPKLQA.. 226
133 3.000e-44UniRef50_A0A261FWI0 CTP synthase n=2 Tax=Bifidobacterium hapali TaxID=1630172 RepID=A0A261FWI0_9BIFI  ali  36  1MKVKQHIEQQLNEAQKALRCATALCHTDQMAFLRCTHSGLVISPYRGMFADASYWQSLNPTAQILHIARTLSVKLPSLVFAGPTAAAIHGFEHQWAIHHGGLYAADTEHGKNRSRGELHRVYMSNIPIAHVDGVLVTSATRTVVDCGLLPFRNALPIVNSALAASATTREEVQLLCDRMQRDCASVTRLLLNANPLCENGGESMMYATIVEAGIAEPVVQHT. 224
134 3.000e-44UniRef50_UPI000684FA55 hypothetical protein n=1 Tax=Humibacter albus TaxID=427754 RepID=UPI000684FA55  ali  20  4MRHAITIPE--ARALLRSRQDLFVGGMSDRVISRAVATGILHRVRRGWFVPRAEWENLWSEGRHLVHIVAVFRDARGAVFAGLSAAVLHGLPLYGSPTRVELLVANPHHIHSSPDVLRREGVLPDSDTTLIEGMRVTSMERTVADVLRTSLEAAVAIADASLRRVAVRRDDLADAWRRGQRGVRQASWVLCFADGRAQLPGESVSRVQFHRLGVRNLGLQV.. 240
135 3.000e-44UniRef50_A0A126Z2C9 Uncharacterized protein n=2 Tax=Frondihabitans TaxID=447237 RepID=A0A126Z2C9_9MICO  ali  24  3.................GRFLRTTAPTPDRAQCRAADAGELVRVRSGVFLDSSCWEGLDARWRHIALVTAALRLQPHVVTSHASAAALWGFPVLDSWPAIVHVIDRSRSVGQRSSTLVRHGALRDDDVARRHGLRCTSATRTAVDVALLGFLSGLLCFDHGLRRGLFSHEEVEAALMRRGRGIRAARQALAIAGPGSGSAGESISKGVAFELGFPLAEQQ... 212
136 4.000e-44UniRef50_A0A143Q6G7 Uncharacterized protein n=3 Tax=Rhodococcus TaxID=1661425 RepID=A0A143Q6G7_9NOCA  ali  18  3..........ITGRTFLTRAQLAAAGVGDQEIRTARRRGGLVYVGRGVYSDAAAYAETSERGRHLLAVRGVVAARTNPVVSHASAAVLHDLRMWNPDLSRVHLSVDAARGGRRTARVHTHTNRLNGCLTRVRGLTATTVAKTAVDLARLPFEAGVCVVDSALA--VTSRADVDAALDAGMTGCSSARRTVAFADGSSESIGESRTRVYLQRFGFPAFELQVT. 215
137 4.000e-44UniRef50_A0A1K1X7H7 Uncharacterized protein n=2 Tax=Olsenella sp. kh2p3 TaxID=1797112 RepID=A0A1K1X7H7_9ACTN  ali  26  5..TRATCEKLLRDAERSARCAVPTNGGERSRFRYLERTGELVSPYPGIYARANTWNALYPSQRIRRIMRTIARIHPDWVF-----------VSASAAVAHAVAIPPKGTGTCESNGRTKRTVVSPCEVVLVDDMRATSLDRTVIDCMRLGFPEALAVADSYLRATGKSSDQLQKMVSQPWRGIKNARIVARYADGRAESWGESIARATMIELGFVIPELQ... 225
138 4.000e-44UniRef50_A0A0Q4FHW0 Uncharacterized protein n=6 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0Q4FHW0_9MICO  ali  19  4...................REFERVGGDRHALARAKTSGRAVRLRRGVYASAADWADLNDLDRYLLRVRGVAETRRRPVLSHWSAAAIWGIPIIGRWPAEVHVIDRTSGGRSKDGIIAHVTEMASVDVVEVDGLLVTSFVRTIIDLATVSSASGVASAEYALHRGHLTKERLLAEWEAAKPLKAHARRILEFATHLADSPAESAGRVNMYLAGFPQPRLQ... 212
139 4.000e-44UniRef50_A0A2E8Z0R0 Uncharacterized protein n=1 Tax=Nocardioides sp. TaxID=35761 RepID=A0A2E8Z0R0_9ACTN  ali  15  2......IEDVSDTHGIVLRREAVAAGFTDQALRRLVTDGVLVRLRQGVYAQREVWANLSDPARHLLLARGVLRLGHDVALSHQSAATAWGAPTWQVPLASVHLVNLRGVGERNGARVVHHRGRYPGAVERIRGLPVTSPAMSAAQTATLPRDPAIAVLDWFLHSKLASRTDLLSAADAGWPGSLGLHHRIQLADGGSESVGETRARLVMRDERLPVPET.... 218
140 5.000e-44UniRef50_C8XEA0 Uncharacterized protein n=1 Tax=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-10  ali  23  22............RSRLIHRPDALSNGLNSDDIRRKVARGEWQIVRPGVYLPVSQLLSITARQRHLMQIDALPHTSPDAVVSHLSAACELGIDLLRIPGRRVVTIPTAASGHRRPLLHTSRAAIDDDERELRRGHQVTGPARTLVDIARTRFDDALVAADSALHQGLVSKAELLAATDRRRAGMRQARRVMLFADGGAESVGESLSRLLIARAALPTPQIQF.. 235
141 5.000e-44UniRef50_A0A161GJB0 Uncharacterized protein n=20 Tax=Nocardiaceae TaxID=85025 RepID=A0A161GJB0_RHOFA  ali  22  3..........FDQRGLFTRADALASGFTDDDLRRARAHKSIVAIRRGWFVRGDVFATLDSAQQHALLAQAYADSGDDVVLSHISAAVVLGLDVWKLPLDTVTMTRRGHSGKRSRRRFLHGTDLLDDEWLHLDGMRVTRPARTVVDVARHPLEVAVCLGDRALRHGLTTIEELECEAAQHRSGAGRARRAVSAMSARSDSVGESRSRLIL.............. 206
142 5.000e-44UniRef50_A0A164NS26 Uncharacterized protein n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A164NS26_9NOCA  ali  20  4...........DSDGFLTRAAASAAGYTDAEFRRLKEAGEIRKTATGIYYPARGSDGLTPTAVHRLRAVAAVRGRTDHAVSHISAAAMHGLTMWNTELDRVHLTVDRSTGGRTSSVHVHTAALTTATVVDIDSVPVTSPARTVIDTARVDMDHAVVIGDSALRKYAITTDVLTEILEQSSRNIAAARRAVARMNGLSESAGETLTRLRMIDHDMPEPSLQY.. 217
143 5.000e-44UniRef50_UPI000CE4C2EF hypothetical protein n=1 Tax=Cryobacterium sp. M25 TaxID=2048293 RepID=UPI000CE4C2EF  ali  25  18.....................AAATESGDRQFRREAQFGRALRLRRGVFTTTEHWGPLPPRQRHLAEIRAVVATRRDPLISHQSAAAVWGIPLAEAWPSTVHVLAPPSRARSKNGVTVHRIDVPDGDIVDIDGMLVTSPARTLLDLARTSFATAVVAIDHALNQRSASPEVLTDEVLRSPRGWVKAERAIRFGRPNADNPGESLSRVAIFELGFPDPLLQ... 228
144 5.000e-44UniRef50_R7WHC6 Uncharacterized protein n=2 Tax=Rhodococcus TaxID=1661425 RepID=R7WHC6_9NOCA  ali  20  4............PSPFLRRSQALAAGFTDHELRTALGRGELVALRRGVFVPREVHDATDEIEHHRLAALAASDESEG-VFSHVTAAVLHGLAVWDLPLRLHVTVGGGSHGKATARRVVHAAPLDESDVVTITGVRVTSVARTVVDLATVGFEQAVVTGDAALAR--ISAHELSDATERRRRGAPAARRALAFLDGRSESVGESRSRVLLHRAGFPPPELQH.. 213
145 5.000e-44UniRef50_UPI0006FB4174 hypothetical protein n=1 Tax=Arthrobacter sp. Leaf141 TaxID=1736273 RepID=UPI0006FB4174  ali  26  6..............PLLLSRDRLSHDLTPNELAKRVKAGALVRLRHGVYTEGPRWRTLAPWEQYRLTVQAAAETQKPTVFARRSAASVWGIPFVGYSHPVAALTLKNDGGRSRCGVQRHFAGGAGLQVVQREGLLVTSRLRTVLDLAALPFAEAVPAMDHVLRLPALTKAELEDAVGASAAASRRIRAVLGFADPLSESVGESLSRAVIHLAGFEAPILQ... 221
146 5.000e-44UniRef50_A0A2V2CYF2 Uncharacterized protein n=1 Tax=Collinsella tanakaei TaxID=626935 RepID=A0A2V2CYF2_9ACTN  ali  26  13..........IADAFSSGKLYTPKTDSERRGLKRRVLKGTVATPYKGLYALTEQWVDMEKPQQYKMIIKTLAELYPNWVFCSFSAAVLHGLEVPFTEMNLVHIAAT----CSRRTNDLVYHHMKIDSPENVDGMKCDSIEGTVLECVRSDFRYALAVADSSLRLLRRNAKEMIERIETGRHGIAYVKEVFGHANSRAENGGESYARAVMIENGVMLPKLQVE. 224
147 6.000e-44UniRef50_B6GAZ0 Uncharacterized protein n=2 Tax=Coriobacteriaceae TaxID=84107 RepID=B6GAZ0_9ACTN  ali  29  4..ARQKMLDKLAKLEGEGLWLVAESHAEGELLRRLRAQGEVVSPCRGVYARAESYRAATCRIRAYRLIRALGRARPTWVFCCYSAAVMHGLQVPYALLDKVHVISTG-NDGAEGRIARHDMHAEGGEVASIFGVRVTSLRKTLIDCLCASFSQGLPIADSALHWGLVGKEEMIGWLHERRRGVRQARETAAWADGRSENGGESVARATMIELGFEVPELQVE. 226
148 6.000e-44UniRef50_A0A2P8D9C6 Putative AbiEi antitoxin of type IV toxin-antitoxin system n=3 Tax=Jiangellaceae TaxID=1217100 RepID=A0A2P8D9C6_9ACTN  ali  17  18..................RTQALDAGYSDGEIARCVARGVWVRVRRGAYAERRTWEALDEVGRHRARAHAVVRLAVPAVPSHVTAAVLLRLPVWDADLSAVHVTRADLHTPRIEGGVHHHAAIEQSELTSDDGLVVTADARTAVDVARLPFESAVVTTDAALARGNVPADGLLVVLDRMWRGARAAGRVVEFADGRSESVGESRHRVQLERIGLPRPELQVT. 227
149 7.000e-44UniRef50_F2N8H9 Uncharacterized protein n=1 Tax=Coriobacterium glomerans (strain ATCC 49209 / DSM 20642 / JCM 10262 / PW2) TaxID=700015 RepID=F2N8H9_  ali  29  7.....RINELLREAHRAKRCLAIRSGNERRALRRRVRSHEVVEAEPGVFAEISYWKTLGEDERAMHRIRAQASLHPSWVFCMFSAAVVFGLEVPFELLGATHVASHGSYRTRSPGLLV-RHRLSVEELERVDGIRVTGIDETVLKCLCTSTELGLAIVDSALHAGLTTKACLERYLGSGRRGIDQARNTLQLADGRSENGGESRARAVMIEIGFPPIDLQTE. 226
150 7.000e-44UniRef50_A0A0D7QQZ0 Uncharacterized protein n=5 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0D7QQZ0_9MICO  ali  22  24...........................EARQVRRQHRLGSSTRLHRGVYAESERIADLTPRARHLAQVHAIVETRRRPIIGHLSAAVLWGMPIPAMPTTVHVVVPPDSSIRSKNGVTVHRERLLEEDIVDVGGLLVTSPLRTLIDLARSPFVTAVTALDFALHDRRSTLAELLAALDA-VRGTSRALRAVEFSRAGADNAGETHSRIVIAELGFPAPELQV.. 228
151 7.000e-44UniRef50_A0A1G5QL36 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Micrococcaceae TaxID=1268 RepID=A0A1G5QL36_9MICC  ali  23  6.......ATALPQLGTLWRTQQLELGLSSRAIGALVRQGDLLRVRQGCYIRRAAWDKQPDDIRGKQLIHAHAHSNGGYVYSHTSAARLHGLFLWNVDQTIHVALPSPSSERLGKDVRGHKLRLTPSQITTVEYLKVTDLERTTVDCARLNYRQALIIMDHALRLG-ADKHLMHAHALSGRRGVRTLQRCLANADPLSESPGETLTRELLARLKLPMPAAQVE. 229
152 7.000e-44UniRef50_D3R793 Uncharacterized protein n=8 Tax=Bifidobacterium animalis TaxID=28025 RepID=D3R793_BIFAB  ali  31  13MKIDSQIERLLDESQNAHRCAVTTDVNLRRKLRRRCESGELTMPYPQLFARKETWDALNPREKKRHVILALAMVRPDWIFCAQSAACLYGIEQSYQIHDIHIASTHESGRARRSDAVIHRVYTPNPQYNVINGAKVTTLPCTIYQCALLPFEQILPLADSAVRSGMA-LDDLRQFPVHSATEALAIGNVLEYTDPRSENGGETLARSRFIERGLMIPQLQKE. 239
153 8.000e-44UniRef50_A0A0Q6FTU2 Uncharacterized protein n=2 Tax=Marmoricola TaxID=86795 RepID=A0A0Q6FTU2_9ACTN  ali  16  1MDDPLRVIALTD--GVFLRREALECGYDDKTIARRVRGGEWHRVRHGAYCFGDTWRTSTPDERHLLLARAVLRTTPGPVLSHTTALLAHGVAVWGADLSRVHVTRDTGAARREKDVVHHVAACSDDDVETVGDVPVLGVARSVVETATTGLESALVSADSALHLEKTERDELRRAGMTHRPGAQKIHVVLHHMDGRSESPGETRAAYLFWRHGLPRPARQH.. 224
154 9.000e-44UniRef50_UPI0004199141 hypothetical protein n=1 Tax=Aestuariimicrobium kwangyangense TaxID=396389 RepID=UPI0004199141  ali  18  16..............ESLTSSQLVGLGWSANTIRRATRDGALVRLRRGVYAAAGTGPPVPLTEAHRTLVHASAWMGEGVVLSHLSAAVLWGIPLWELEPGTQVWVTRSNTTRGYVRGPIHACPLTPHEVTAVDGLPVTTLARTVLDLARRGPDQGVVAADWALRHAGLDPRELQDVLQARRPGVRAARTSVELASRLAESPAESVSRLRMHQLMLPRPVEQVE. 231
155 9.000e-44UniRef50_A0A1Y3UGV9 Uncharacterized protein n=1 Tax=Collinsella sp. An7 TaxID=1965651 RepID=A0A1Y3UGV9_9ACTN  ali  28  1MALGRELMQHFDQTEQDCTCLHPTDSALQRQLARLAIKGEVTRVVDGLYARTVYWSSLRPDEQAFHLMRALQVVHPSWVFCHESAALVYGLPVSYHRLPVKVSCGRRDSSGTRRGAYHHAVPIDDAEV--VQGLRVTPLPRTLCDCASASFADALAYADGAIRVTSLSVERLGDAVRARPHHAERVLDVLTHADGRSESWAESAMRALVIERGFALPDLQVE. 225
156 1.000e-43UniRef50_A0A1H2AB76 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=4 Tax=Friedmanniella TaxID=53387 RepID=A0A1H2AB76_9ACTN  ali  22  4..............HPVLTRDLLAAGYSPAEVARLVRSGELVRLRRGAYRTAADLEPDAETRHRQLLLATVPLLAPDSVLSHRSAAVVLGLPVVGALGRVEITRSSVTSGKVRGAVHLRAAPLPDDEVTSVDGWQVTTPARTVVDLARLPLGPAVAAGDAALRAG-TSVEEVESVLAAGRPGLAAARRACRSLDGRSESAGESLSRVVLHRLGLPPSGLQHE. 213
157 1.000e-43UniRef50_A0A239IDA0 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Micrococcales bacterium KH10 TaxID=1945885 RepID=A0A239IDA0  ali  20  32...............RFTTATAAHWGIPHATLHRAVKRGILTRPMRGFYVRTDVWREAFPEQRHQWLVEALAQRAPHLIFAYESAAAVYGIPRLDKWHSRPQVISGRTKRGTHRASVKTFHEPLVAESLQVRGMRVTDPATTIVDLARRDSMWAVASADHAVRHKMTDVDAINERIMSGRTGIARARTYLTHIDGRAESVGESWSRILLLLHGFEIPDLQ... 240
158 1.000e-43UniRef50_UPI000D68C825 hypothetical protein n=1 Tax=Nocardioides sp. YIM ART13 TaxID=2173172 RepID=UPI000D68C825  ali  23  14..............GLITLAQAVSCGLSRHDVRRYLRRGAWVAVRRGVFTRREDWEALDVWQRPLQRARAVHLTMEDHVMSHHSAAYALGLDTLHPGDDEPVHITRPRGSRTRFGVKHHGAVFRDEQVVLAAGLPVLGPARTAVDIARHGLHHGVVACDSAMQMGVTRSELIRAEPMWSWPNVRAVRQAVELADEGAETVGESLSRLLILELGIGVPQTQFT. 227
159 1.000e-43UniRef50_K2I9B1 Uncharacterized protein n=5 Tax=Bifidobacterium TaxID=1678 RepID=K2I9B1_BIFBI  ali  26  2....................................KTGAVLRVFRGLYAEPTYWESLDPHEQVRHIVRALAIQHPDWVFCGPTAAIMHGLDCSYR-LAFPICIVASPGAHHQDTRHISHHAITHPDITVVQGVKVISLLQTLFDLAACPLRYALGPADCALRNGLVSESVLRAYPSSYSRNRAAVERAFALADRRAENGGESEARGMLHDAGCPPDDIQVE. 189
160 1.000e-43UniRef50_G5F173 Uncharacterized protein n=4 Tax=Atopobiaceae TaxID=1643824 RepID=G5F173_9ACTN  ali  28  3....DELRVALDDAEARESCLVPSTTAVRNRLDHLTRRGELARVQSSAYARAAHWDGLDAARRAMCRIRALATLHPDWVFCGASAALVHGLSVSYRSASR-IEVATRKEAPCRSTRNVGRHVIGRDERTVVAGVRVSTLERTVYDCLRLDFRGGLALADSALRVTGKPREWLTSLFAAGARGIKHARVVASYADGRAESGGESIARGAMIELGFMLPELQVE. 223
161 1.000e-43UniRef50_A0A1H1WJ46 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Marmoricola scoriae TaxID=642780 RepID=A0A1H1WJ46_9ACTN  ali  18  2....DELARISQEQGVFLRREAIAAGADDAWLARARRSGVIHRVRRGAYVPAEDWTPLDEAARHRLLVRAVLRAGAAAVVSHVSAAAVWGTPLWDLPLTEVHLTRDGRAGRREAGVVQHCGRLGEEETVQVGPYTVTTPARTALDLTLTDVEHALCVTDHLLHSGRTTAAELRRALMRRTPGMLAADLLVALADARSESVGETRSRHMFWRQGLPAPIPQFE. 224
162 2.000e-43UniRef50_A0A2A9E0V5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Sanguibacter antarcticus TaxID=372484 RepID=A0A2A9E0V5_9MIC  ali  15  18.RGAPPLPTVRLPTVALLPTVFLARELSPQLVQAQVTSGAWTRVRRGAYVAASLLPDAAPQTRELARIAAVARQLSPAVFTHESAALIWGLPLWRSPDRVHVHHPSLRSGHASQDVSRSSGVLDASDVVVRSGLRVTSLERTVVDCARSSAVSGLVVADAALRRG-VDPDSLRARLQGPARGVRIARAVIDLADGGAESPWESATRLVLVGAGLPRPSTQV.. 241
163 2.000e-43UniRef50_W0Z7T4 Uncharacterized protein n=1 Tax=Microbacterium sp. C448 TaxID=1177594 RepID=W0Z7T4_9MICO  ali  18  8..............ELTRTSDLTRAGLTSRQVQKLIDDGTFVRVRRGIFAQGKGWSELRAEGRMVVVARAWQMSAGEPVFSHITAAALHGLPLFRTGPHRVHTVIPEPRKGSAPGVIRHRGATDVG-LTTVRGLVVTDVARTIADTARASAETSVIVADAALRAVSTDRARAREVAASLPRGSARSQRVIEFADPRAQLPGESVSRLYLVRLGFAVPRLQV.. 224
164 2.000e-43UniRef50_UPI000C7829C1 hypothetical protein n=3 Tax=Nocardioides TaxID=1839 RepID=UPI000C7829C1  ali  17  14................FLRRDVLDQGYDDRHIVRMVRCGAWHRIRRGAYADGEAWRSLSETDRYRLRCRAVLRAHPSSSLSHVSAAIEWGVPVWGVPLDEVHLSRADGKGGRRAGVVHHRAPTPAEHLCDLRDVRVTSPTRCAVETSMTGVESALVSVNGLLHLGLTTPADVAELAHRFWPSSIGANLVVRLADPRLESPGETRTAYFMWANHLPKPIPQF.. 223
165 2.000e-43UniRef50_UPI0004A73A60 hypothetical protein n=1 Tax=Nocardia brasiliensis TaxID=37326 RepID=UPI0004A73A60  ali  17  2............TATPIQRRDALAQGFSDNELRRLTTRCGWRRLRPGSYLRSDAYAALDRQEQYSALVATAAHLSAPAIISHQSAAAVQDLPLWGLALDRVHVTRPRRSGGHRGHVHMHCAPFDEAETLTIGPLRVFTPARTVVDIARTTLQAAVAIGDAAVRRFHLIHESLCQALAVGRPGYRAAARAIGMLDERSESVGESRSRVLLAELDLPTPDLQ... 214
166 2.000e-43UniRef50_UPI0009F999EA hypothetical protein n=1 Tax=Pseudonocardia sp. CNS-004 TaxID=1904967 RepID=UPI0009F999EA  ali  21  7..................RSQLLAAGFTDDEVRRLVREGRLSPLRRGIYVGGPLPEDVLAR-HVLQVEAALHGLATDAVVSHASAAVVHGLRIWAVPLDRVHVTRPRRNGGRGAFVHVHTAPLDAAEIVVVGGLPVTSLARTVADLARSPFEQAVVLADAAMRRDRIAQADLVEALERRWPGVPAARRAIAFADGLSQSVGESRSRIAIAAAGLPRPVLQ... 214
167 2.000e-43UniRef50_UPI000DBE472C hypothetical protein n=1 Tax=Nakamurella sp. 12Sc4-1 TaxID=2164074 RepID=UPI000DBE472C  ali  23  4...........RRISLTHRSAVLADGWSDHDLRRAERHGELSRIRRGSYADPDALAGLDTHQRHRVAIAAATRAPTPCVISHASAAVVWGLPLHGVDLDRVHFTRPGAVGGRRSAGRVHGGALLPGDVTEQDGIAVTTPARTLVDLARTSPEAAVVAADHAFHEGTTTPSAVRDVLDRSAPGIGTGRRALLAADGRSESPGESLTRFVL--QGIAPMDAQVE. 216
168 2.000e-43UniRef50_A0A2M9BD82 Uncharacterized protein n=1 Tax=Mumia flava TaxID=1348852 RepID=A0A2M9BD82_9ACTN  ali  21  18.......................DLGLTRHAFRKALDEGQFRQIFKSVYVDARV-----PDTRGLRLVAAHLVTPPHAVVSDCFASWLFGVDTFRHLLTPSLLVPHGSSRVRAPGVRCRQARLAPEEVVEVDGLLVTSPLRTTGDLARLWRPYALAAVDGMVRAELVGLAELDEYVRRGFPGAPKARELVAYADPGAESPGESWTRLRMIDAGLPRPCTQI.. 217
169 3.000e-43UniRef50_UPI00047E76E2 hypothetical protein n=1 Tax=Gordonia shandongensis TaxID=376351 RepID=UPI00047E76E2  ali  22  5...........DENGLIRRTELLDTGVPVREITRALRSGALAHVARGVYAEASRVRGADFPGQYLLRCIAAATAGPSPVLSHESAAVIHGWPLLRPSLTHVHVTSGRESGGTRHERRTHPGLFGDGDVVEVGGVRVTSPARTAVDVARVDFARALAVFDAALAAG-TPDEQIREHLRRRRVGVGRARYAYGFADGRSESPGESWSRAQMIEASLPCPDLQ... 219
170 3.000e-43UniRef50_A0A260U798 Uncharacterized protein n=13 Tax=Nocardiaceae TaxID=85025 RepID=A0A260U798_9NOCA  ali  19  3..........FDQQGMFSRTEALARGYTDDDLRRGRASGEIVTIRRGYFVRADVYRRLDAHRRHAVLAEAYAESSTDAVFSHVSAAVLHRMETWDIPLDVTFTVARSYAGKKGRQRVLHGSPLPPADLTEREGFPVTAPTRTIVDLARLPLHPAVCIGDYAMRAGLTTHRKLQDALARNRTGIAKARQAVQSMSSRSQSTGETRSR................. 203
171 3.000e-43UniRef50_A0A099JQY8 Uncharacterized protein n=8 Tax=Cryobacterium TaxID=69578 RepID=A0A099JQY8_9MICO  ali  23  14..............GLILAASLWASGLTTRAVRAMLASGELVRIRRGIYALGDTWRRAETDDRYRLFVRAVLAAEQPLLLSHHSAAALHNLPIIGPWPKVVHAINNDATGGSSARFTTSHRSVVEPESIALSGCSATTLTRTLIDVAASSFLVGVTMMDHALRTPALSKDELYGELATPRTGRAQARRAIDFANPLAANPGESLSRVRIAELGFEVPELQV.. 240
172 3.000e-43UniRef50_U2V4P7 PF13338 domain protein n=1 Tax=Olsenella profusa F0195 TaxID=1125712 RepID=U2V4P7_9ACTN  ali  22  2....EDLMNRMGMAERAGLLYAPTCKAEQNALKGMTNGSVITRPYPGMFARAPSWDALTVSERHLRMMRTLARMHPDWVFCGPSAALALGFDVSNSCMHRLHLVCSGEASRRDTASVMWHH-LRDMKVMTVGGMRVSSAERTIVDCMRLDFSRGLAIADSALRVCAKDQDWLLAAVDRRTHGLRQAKLVAAYADARAESGGESIARAAMIEEGFSLPMLQVE. 222
173 3.000e-43UniRef50_J9RZH8 Uncharacterized protein n=19 Tax=Corynebacteriales TaxID=85007 RepID=J9RZH8_9ACTN  ali  17  5.....RMDLPTDPHGLILRSETAGTLISDEQLRRMVSTKTLARLWPGAMADFTVVSELHAIERHRLTVIAAARARPGRIFSHVSSAAMHRLPMLWPDLSKVH-VTSPRVGKRATNIIRHQAIVDLPDIEVVDGVTVTSIERTACDVARMGTRQALAVLDAALRR-DADPDRMRQILDRGFKGVEMLRRALAHANASSESVGESLSRAVMLEFDLPVPRQ.... 221
174 4.000e-43UniRef50_UPI00068A6E63 hypothetical protein n=1 Tax=Arthrobacter sp. UNC362MFTsu5.1 TaxID=1449044 RepID=UPI00068A6E63  ali  25  3.................RTEELLAQGLSKRRISEHLLAGVLVRVRTGIMARGSYWNALSDGDRGRARLRTLPATADGLTFSHTSAARLHRLYLWRADQLIHVTIPHAARGSHAADVRAHSAHILDSDRIEVGGLPVTSLDRTVLDCARLSYRQALILLDHGLRSG-ADRHWLESECTRGVRGVAGLRRALAFADPLSESPGESLTRDVIARLTFPAPVLQF.. 214
175 4.000e-43UniRef50_V8CVG2 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=V8CVG2_9ACTN  ali  17  9...............AFLRADLIAHGYTPSEIRTALHTSKIRALAPGIYAGPALWLEPMEKRHSELGKATVRKLGGNYLLGGASAAALHGLPLFGVDPRVVHLVADSGTGSRNSKLLRIHRDARPMSAMMLDGVPVTSPARAVVDLARRSLPSALVTGDAALHRGLCTVADLHKELEEGFPGYPQAKRAVAMMDARSESALESRSRASMHTAGIAAPTLQHE. 221
176 7.000e-43UniRef50_E2SFK7 Uncharacterized protein n=2 Tax=Aeromicrobium TaxID=2040 RepID=E2SFK7_9ACTN  ali  20  3.......DDLIHRAELRGRTEILDSGYLDRDIREAIAIGLLTRIGSGLYAVSRTYTALTFDQRHAVRSRAVQRHLQSVVLTHQSAAIMHGLPVWGLSLDEVHVTRRDHGRGRHAGVQHHTGRIPDADIVEIDGALVSSPSRCVWEVACSSTEAGLVTADAAAHRGLVTPENLGETAAAHWQGSRSARITTRLIDPRAESPGESRSRHLFWRFDVPMPDLQH.. 224
177 7.000e-43UniRef50_A0A126Z3U4 Uncharacterized protein n=5 Tax=Frondihabitans TaxID=447237 RepID=A0A126Z3U4_9MICO  ali  24  19...........................DDTAVRRAAARGELVRVVAGRYVRREHWGAFDARERHAMLCLAASRLSAPVVLSHASAAALWGLPRLGPWPARAHVTDPASHATTTRYASWHVGALPPGDVTTSHGVRVTTPERTALDLATTTFRQAVVSLDHCLRTSLVTNDELLLRLASKGHGRAKALRAIEFANAKANRPGESLSRVVIHESGLVVPDLQH.. 217
178 7.000e-43UniRef50_UPI0007A51ABD hypothetical protein n=2 Tax=Nocardia TaxID=1817 RepID=UPI0007A51ABD  ali  23  8........................................................EMSTEQRHLVLTGGVAASSSAAVVSHISAAVVHGLPVWSIPLARVHLTRRRTGARTGSRVMMHAASIESDEVVRIGDLRVTTAARTIVDLARTPFEQAVVMGDAALRLGRTSSAELAEQLLRGRPGCPAARRVIDFLDGRAESPGESRSRVVLCRAGLPAPELQ... 176
179 7.000e-43UniRef50_A0A0Q5QSE5 Uncharacterized protein n=2 Tax=Williamsia TaxID=85043 RepID=A0A0Q5QSE5_9ACTN  ali  19  6..........VDDMGLVHRDSVLRVGLADKHLAAAVREGRLKRLRAGTYLLTTP---SSPEHRHRLRV--VASTQPDTVVSHHSAAVLHGFAMLRPAFERVHTTSGSSAGGRSRTRHMHAGPLDDVDVVGHDRLLVTSAARTAVDVACHGFDQALVVFDSALRGGVEAVDLAAEVAGRRRRGIGVARRALAVADGSSASVGESWSRAQMITAGLPIPVLQ... 212
180 7.000e-43UniRef50_A0A1H5KSS5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Arthrobacter alpinus TaxID=656366 RepID=A0A1H5KSS5_9MICC :_  ali  21  29.................RRSQLRDAGFDDRAVQRLVAGTVLIRVRQGAYIRGSYWSQPSNDARDRTTIFMHAFGTPGFVYSHTSAARLHRLNLWKAHTLVHVTTRTPSSTGSDSGKLIHMAVLPSSDITQVDNMRATSLERTVVDCLTMPHKQALILTDHVLQLG-TSMDKLLEAASGRHRGVKTLRKVLAYADGRSESPGETLTRDLLRELLIEAPTLQY.. 240
181 7.000e-43UniRef50_A0A2S6JTD7 Uncharacterized protein n=4 Tax=Microbacteriaceae TaxID=85023 RepID=A0A2S6JTD7_9MICO  ali  21  14..............GLITGRALREAGLNSDRINQCVRQGLLRRVRPSVYVTADAWATLWPEQRHRLLVRATLMLARDWVVSHLSAAAMHGLPTIGEWPSTVHVSDADARGGASSRHVTVHRGAPRPELVVIGGILVTSLERTLADIAATPLGRSLAVLDAAFRAARVDAGEVAAARGAPRRGYRQAEFAIAFASGLAGSVGESLTRVRFHEHGFEIPELQVT. 253
182 7.000e-43UniRef50_A0A0M4RP05 Uncharacterized protein n=9 Tax=Arthrobacter TaxID=1663 RepID=A0A0M4RP05_9MICC  ali  25  20..........................YSARRLSRQTASGKLVRVRRGLYLPASVWESMKPWEQERMRIQAVVLASRHPIFARESAALVMGLPLIHTPRQVQTVVAPGLRGGQSSKGVRRTGSVEGDPVWTMFGLKVTPPAETARDLALLPLSQSLPAMDKLMQREILTADHVRASAALLPNGRRRVERVLEVADGLSQSAGESWSRAIMIQHGFPRPVLQ... 229
183 7.000e-43UniRef50_C0W471 Uncharacterized protein n=8 Tax=root TaxID=1 RepID=C0W471_9ACTO  ali  21  4...........APIEITLTRDLLDRGLSRYALARATRSADLIRLCPGAYVRAADFRELHASQRHLVRVCAVDRVRPGAVLARESAAVIHGIPLIGALPEQVQLVRVGRAGGRRTTATRTLPGPADYEVVETEGISISSVAQTLVDLGRRSLASNLASLDHVLRQGWVTKESLMELVDRHPRGNASMRRWIELADPQSESPGESLSRAVMIENHLPMPKLQ... 220
184 8.000e-43UniRef50_C0ZUZ9 Uncharacterized protein n=30 Tax=Nocardiaceae TaxID=85025 RepID=C0ZUZ9_RHOE4  ali  20  44..............EILTRAQAHRDGTSDAQLQRAVRRGELHRIAAGIYMRADHFRELDARARHRAVMVATESCGPGAIVSHASAAVMHGLDCGGLRLDTVHMTRNRCSGGRKSTLHLHPAVVPAEEVVLIDGVATTSLARTFVDLARTPFETAVVIGDCALRRGM-RRENVDASLARGRLGMSRARVAATFIEPGAESPGESISRVRMRDDGWPMPTLQHE. 255
185 9.000e-43UniRef50_A0A2M9HNK4 Uncharacterized protein n=3 Tax=Bifidobacterium TaxID=1678 RepID=A0A2M9HNK4_9BIFI  ali  29  1MRSHPRIEQLLLQAEHQRRCVWPMEQGDRQLLMRRVRAGILVTPFQGLFVRKALWLQLPFAERIAYILRAVCHQHPDWTVCGISAAAAHGYTATYYQHRFVHIAVSDRSKARRHGPFVGHYIPKYRSVVVNNGIRATTPIRTMFDCARLDFSTAMSICTMGLRATQLTAEALQNYCQSRKHGIRRAIYVAQNVDPLCTNGGEAVAYATILELGFAAPECQ... 223
186 1.000e-42UniRef50_A0A2T1A2E7 Uncharacterized protein n=3 Tax=Antricoccus suffuscus TaxID=1629062 RepID=A0A2T1A2E7_9ACTN  ali  20  14....................EHLEFGMTRKELRDAVRERALRRLFRGVYVDASVPDS-----RELRVTGIRLVAPPHAIICDGSASWIYGVDTFRPRLTPSVVIPHGSSRVRHPNVDCREAFIDPNDVMEIDSLLITTPLRTTADLLRMRRPYALAAADGLARAKLVCVDEVVSYVQRLRPGIVQARELARLIDVKSESPGESWTRLRLLDAGFPRPQAQI.. 216
187 1.000e-42UniRef50_A0A261G4T1 CTP synthase n=2 Tax=Bifidobacterium hapali TaxID=1630172 RepID=A0A261G4T1_9BIFI  ali  38  1MDTHKDIERLSTQAERYRRCFFPTTNAERKATYVRLKHGELVRPHRNVYARSDYWTALDVVEQARHVIRTLAEQFPHRIFAGLSAASMLHLDHGWHLHDPVFITTTGSAHLRNAYHKLHRIYMYDPDVREIDGVRITSPARTLVDCARYSFVDVLPMFDAALRRGLTRLEDVLDICDGLRVDCGPVMRALHYADSASENGGESACRAVILDGGFVKPKLQ... 249
188 1.000e-42UniRef50_UPI0006965C69 hypothetical protein n=1 Tax=Cryobacterium roopkundense TaxID=1001240 RepID=UPI0006965C69  ali  26  5.........QLARESLIFTCDMGALGLDDTRLGRAVRRGTLVRLKQGVYLDCALWATLRPPDRHRLLAIAERVAGPGLVFSHQTAAALLGLPVLGRWPDRAHVLSDCASGGRSTTILVHTVGLQGVSVGTADGLTATTTPRTVIDLATLPFLSAVVATDAAVHQFLTTLDDVRDLLDQLSRGLRRVSAVLDAATTLSESVGESLCRLIIAELGFDLPELQME. 228
189 1.000e-42UniRef50_D2PZ69 Uncharacterized protein n=2 Tax=Kribbella TaxID=182639 RepID=D2PZ69_KRIFD  ali  16  23.........AARRGGWFDRTDAVAAGYSDAEISERVRAGRWTRVRRGAYAEGSADESLPPWERAAWLVRAAHRLGGRAVVSHQSALLLHGLQISEVDLSRVHVTRRAGPGRSGRTLCQHAAQPPVTEVATIDDTQVTSAPRAVVEAIRSPYPTAVSVVDAALRGGLADRDQLREMLRRRQRGVRTAQRALAFGDGRSESVGESRMRVLLADLGLPPAVPQ... 242
190 1.000e-42UniRef50_A0A087CRW7 Uncharacterized protein n=1 Tax=Bifidobacterium ruminantium TaxID=78346 RepID=A0A087CRW7_9BIFI  ali  36  1MKNHAQANKIIEEAVMERRCAYSHNEAENAALRRRMKCGELVRAAHGLYLPQDYWNNLSPPERTLHIARSMSLLYPHWIFAGLTSATIHGFDHPWSLHSTHLTIVGREHGKIRARHPTKRIYVPNCVPVRIGGFLATTPARTLIDCSALYFRCALSIFDSAFAHG-VTANDVLEECEKDPCAHPAVAKLLLYANPDSDNGGESFARGTMIEEGFMPPMVQV.. 222
191 1.000e-42UniRef50_A0A2T7TLQ5 Uncharacterized protein n=4 Tax=Arthrobacter TaxID=1663 RepID=A0A2T7TLQ5_9MICC  ali  17  7..............HLRTSAELALQGVDLTQLQRQCRAGTLVRVRHGIYLRAEAWHNLDRWDRYRVLVLAVLSAQRPPLFSHETAALIHSIPILGVPRLVHTQQEGRRSDRSRKDIRRHFTDDYTPGKVRLDGLRATSLNYTLLALATATFPSAVVALDDSLRRNRTDPAQLRTAAQSLRTAAARFGMVLDFGDPASESPGESASRAHMALFGIQPPELQ... 216
192 1.000e-42UniRef50_F5XSQ5 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=F5XSQ5_MICPN  ali  19  8..................ASDFRRLGVTSDEVARMVRRGELIRLRRGAYLRASVADAADPWARHLQLIDTMPQLHPRAALSHGSAAALHRLPLFPAMTETVHVTRDRRGGGARPALRVHGSPLRDLDRGVIDGHPVTSLARTVVDLARTSYEQAVAVADGGLALG-ADVGQLAESVARSWLGAPQARRVLAFADGRSESVGESFSRIRIQRMPVPAPTLQYE. 219
193 1.000e-42UniRef50_C6KVV4 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=C6KVV4_9BACT  ali  23  8.....................LTRQGLESNGIRRLVDRGELVRVRRGVYADSPLPD--DRVAAHLMRARALLTLAPDKVFSHQTAGAIHGLPVWRPVLTRIAVTRPGRSGGQRPDLAIKVAPLAEDEVVNVDGWRVTSIERTAADLGRLPLDWGLPVLDAALRAG-VTREAMAEQVARRRPGVRALAAALDLADARSESPGESLARLVFWRLGIPAPVLQ... 208
194 2.000e-42UniRef50_A0A0S9DZ12 Uncharacterized protein n=6 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0S9DZ12_9MICO  ali  23  22...........................DDSALRRRATRGELRRVHHGVYATEQDWSRWNSEERYRARVFGIGQGRRDVVLQGYSAAALWRLPIIGAWPAEVHLLTEAAGGRSHARIRRHAVGFEHAGITTIDGLHVTGAARTVIDLAAVPFMTAVATADFALHTELTTRGELATLLMGRFRGSARAARVVDFSTPLAESVAESASRVTMARCRFPEPELQKE. 221
195 2.000e-42UniRef50_A0A1M3F975 Uncharacterized protein n=1 Tax=Cellulomonas sp. 73-92 TaxID=1895740 RepID=A0A1M3F975_9CELL  ali  23  39..............................................GAYVGSDHWSEIDDTQRHLIAVRAVAALRADAVVSHRSAAAVWGLPVVGCPSDGVHVTFPGRSGGVSRADLARHATDRPLAHQVVDGIDVTSVARTVVDLARHGFLAGVAAGDAALHRGIVTLDELCAEAAGSRRGSRVARDVVGFVDGRCESPGESLSRVRMRELGLPTPELQH.. 217
196 2.000e-42UniRef50_A0A0N7JZ60 Uncharacterized protein n=7 Tax=Pseudonocardia TaxID=1847 RepID=A0A0N7JZ60_9PSEU  ali  20  4.......SDALPGLGPFRRADLHAVGLGDPAIRALVRAGRLQAVCRGMYVPGPVAPAPARTARHVLAIRGVARLDAPAVVSHVSAAVLHAVDLWDLPFDRVHLTRRPSGARRGHDLHLHAAPLPPGDVTVIRGIPVTTPARTAVDIARATFDQGVVVADAALRQTGTNRPALEEVLRAGRHGVTRAARVVAFADGCAASPGESRSRVLFARNHLPVPVLQ... 230
197 2.000e-42UniRef50_UPI0006850F7A hypothetical protein n=2 Tax=Nakamurella lactea TaxID=459515 RepID=UPI0006850F7A  ali  25  7..............HLISRARATVEGSSKRAFYNIVRTADLNPVRPGWYTDRHEYAEGRHREQVTAAIAELRGAADSAVVSHVSAAVLHGLPIWGVDTDRVHLTRPGSAGASTRSIRPHRAQLTDEEITVVDGIRVTTRARTVLDLARCPFTQALVVADAALHAGLTSDELMAVLLARARKSAGQAHRVIEFADKRSESVLESLSRVCLAALGLPVPELQVS. 218
198 2.000e-42UniRef50_A0A1H0R8B0 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Arthrobacter TaxID=1663 RepID=A0A1H0R8B0_9MICC  ali  22  6..............RLVLAREHVQQGLTPKELAKRCRSGVLVRVRQGVYVDGEAWRALQPWEQYRLRVSAAAEATAPTVFARHSAASVWGVPTIGQRHPVHALTLQNAGGRSRAGVQRHYAAPDGLKVFRREGLLVTGRVRTVLDLAATPFAQAIVPLDHVLRLPALSKEMLLAGVDGNYTAAARIRTAVKFADPRSGSPGESYGRGLMWVAGFQPPELQHE. 223
199 2.000e-42UniRef50_UPI000D3B70C0 hypothetical protein n=1 Tax=Microbacteriaceae bacterium 13S1-3 TaxID=2144185 RepID=UPI000D3B70C0  ali  24  17..................TSDVAGRDGSNHQLRRAHARGELVRIRRGVYVDAAGWNAANPDDRYRMQVRAAALTRAPLHVSHLSAAAMHRLPMVGTWPPVVQAITPGASGGSSKHGIVTHSRVPAAAGVFVDDVLVTTIERTLVDVATSSARISVPMLDHALRLRLTTTAALREALSPHGPASSRARSAVEFANPLADSPGESLSRVLIEELGFAQAELQV.. 223
200 2.000e-42UniRef50_A0A1I5CB90 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Mycetocola TaxID=76634 RepID=A0A1I5CB90_9MICO  ali  21  2......IDPLRNPEGVHLSRADALKGGDGRSLRRGRESGTLVSIRRGVYTETSIWSELAARDRYLLQMRAVLETRGDAVLGYESAAAVWNMPIIGPWPDAVHVTADGRRRSSSRGVRWHNAPLLDGDVVEVDGILVTSRLRTLLDLARRGFMSAVASLDAGLHRTADAATRLREMLLGSAPGSRRARYAVEFASHLADSPGESASRVQIHLCGFPQPVLQF.. 231
201 2.000e-42UniRef50_A0A1H0IAS4 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Cryobacterium TaxID=69578 RepID=A0A1H0IAS4_9MICO  ali  23  23.......................AAGLNTRAVRALLANGELVRIRRGVYTLGATWRGAESDDRYRLFVRAVATAEQPLLLSHLSAAALHNLPIIGPWPNVVHAINNETAGGSSARFTTSHRSVVEPEQVVIDGCAATTLARTLIDVAATSFLVGVTMMDHALRAAALAKEDLYAELMMPRRGGPKVRRIIDFSNLLSANPGESMSRVRMAELGFEIPELQV.. 240
202 2.000e-42UniRef50_A0A2M9CGZ6 Uncharacterized protein n=5 Tax=Micrococcales TaxID=85006 RepID=A0A2M9CGZ6_9MICO  ali  21  1.........MLGWREHLIRADEIVRSGSPGAFYRAERAGRFVRVAHGIHLPRRIWDELDAEQRYLLRVHIVGERWPDAVFSHASAAALWGLPRLGPWPERPEVLADAATGGRSRVAVTRHTEGVPGATAVVLGLRVTTLARTVVDVARTGLTAGVVAVDAALAPGTASADHLLQELHPSARGRSRAFAALELGDGRSQSVGESVSRASMYRLGFHMPELQKE. 219
203 2.000e-42UniRef50_A0A078MRX7 Uncharacterized protein n=5 Tax=Micrococcaceae TaxID=1268 RepID=A0A078MRX7_9MICC  ali  23  14........................DAVTRASLARRCRAGELVRLRRGIYVETLWWKRQPLWEQQRARIGAVLQSGAGRTAAERSAAVVWGIPVIGSPPEVTLLALPPTHGRRRAGVHWIERPLL-EPIVLHDGMNVTSRAQTVLDMAAHAFEHAVPAADHVLRLPALSREGLMGLAYRLPSGARRSRAVLRFADARADSPGESVSRAVMHRMGFPPPELQH.. 219
204 2.000e-42UniRef50_A0A161U6K0 Uncharacterized protein n=1 Tax=Microbacterium sp. TNHR37B TaxID=1775956 RepID=A0A161U6K0_9MICO  ali  21  15................VTSRQLALAGWTARALRAAVESGEWIRLQRNRYVHGEAWRDLWPEARHLTAIVAAHMTTGTSVFSHESAAVIHGLPLYRHTRSLHVTVRRDGRMPSRAGLFRHRDELPPEDVVVVDGLRCTSLDRTVYDLARTGAEAALSAADVVLGRVAAWREDMLSRCAGGGRGVRRAIKVLELADGRAESPGESVSRLRWHEAGFRGIEVQ... 237
205 3.000e-42UniRef50_A0A1B1BNA1 Uncharacterized protein n=8 Tax=Cryobacterium TaxID=69578 RepID=A0A1B1BNA1_9MICO  ali  23  38........ALSSRDGLILATDAGRVGL-QRELRLEFERQTVFRLRRGVYVLTAEWAALGADDRYLRRIRAHAAVAEGAVYSHFSAAALWGLPVVGAWPSEIHLTSSAAAGGRSRPGVVRHSQEHCLDVVEHDGLRVTSVAATAVAMARLPFGRAVAVMDKALHEPLTTRAELEGALAGHVPGRAAAGRVLEFATPLSGSAGESISRAGIFLLGFLAPDLQV.. 258
206 3.000e-42UniRef50_A0A087E7R8 CTP synthase n=1 Tax=Bifidobacterium subtile TaxID=77635 RepID=A0A087E7R8_9BIFI  ali  39  1MNNNIEIKQLINTSKAQSRCLYGGNARQRAAVRRRAQTGAFVNPHYGLYAEQSYWTGLSPAQRYLHVLRALARKHPNWVFTSVSAAAIYQLECPWSLHDGMVYIASDSAINGYASRDVRKIFVAPIHAHIVNGLPVVTLERALVDFARHKFPQALPIFDSAMRIYQYSQEKVIEICDSLRRDCGPVFRLLYYVDGRSENGGESFCRAVIIELGFIAPLLQQE. 223
207 3.000e-42UniRef50_A0A2R2W896 Uncharacterized protein n=1 Tax=Frondihabitans sp. 762G35 TaxID=1446794 RepID=A0A2R2W896_9MICO  ali  22  2............PSPLLRTSDLVLADLDDSALRSAARRGEMHRIVRGAYLPAADWAALSARGRYAEVVRARARLGPRLVLSHDSAAVLWGYPTLDPWPPEVHARHRGRSTGKRTATLVVHPAPPSLESVDVDGFPCTTAARTSVDLALAGFARGVLAFDHALRAGIATRQECRDLLARRARNGRNARVALDLATPASESPGESISRAALHEAGFEAPELQ... 213
208 3.000e-42UniRef50_A0A0Q9R0W1 Uncharacterized protein n=1 Tax=Arthrobacter sp. Soil782 TaxID=1736410 RepID=A0A0Q9R0W1_9MICC  ali  18  18....................ALMDRGLTKRNLQTLVKSGQLVRLRRGCYMSARAWKKLSPRLIHAHRHATVATGSGSGTYSHTTAARGHGLYLWEVDSVIHLTQPSNSATSHASDVRNHQARLEPFEVTRRSNLRVTSLERTVVDCARLPFRQALIIAEHALHLGADS-ELIRKTIDRGYKGVARARNVFAHASALSESPGETLTWSFLRKMRLPMPVQQFT. 227
209 3.000e-42UniRef50_UPI00039BC2C7 hypothetical protein n=1 Tax=Smaragdicoccus niigatensis TaxID=359359 RepID=UPI00039BC2C7  ali  19  6..................RARALRDGISDERLQAATARNELIRIRSGVYVPASDFRAMHLEDRHRTVVIGVPRLHEDSVLSHISAAVLHGLPLWRTDVSRVHVTRLGATTRTTKRTRFSGAPLTLDEVTWIDGYRVTSLDRTVLDIARLPFEQAVVVGDAGIHKG----AQVKAVPDVR---SEQARRILAFLDGRAESPGESRSRVLMDRLRIAKPQSQIT. 204
210 3.000e-42UniRef50_UPI0009EBD779 hypothetical protein n=1 Tax=Frigoribacterium sp. Leaf44 TaxID=1736220 RepID=UPI0009EBD779  ali  19  36..............GLLLSRDLAALGLDDARLRDACRRGELVRVRRGAYVEAGRWAALGIEERYRLVVAAAASCRTRVLVSHVSAAVLHGLPLVGAPPRLVHVLVPPAGGSRQEHGFAKHACDDHDDALDVDGVHVTPLDATLVDCLTEPFVRAVVMTDHALHQGAVTLESLATEFARRRRGSRKVAAVLEFATPLAHRPLESISRVGFRLLGLPDPVLQH.. 248
211 3.000e-42UniRef50_A0A0S2LZD2 Uncharacterized protein n=4 Tax=Arthrobacter TaxID=1663 RepID=A0A0S2LZD2_9MICC  ali  24  63.................RTRQLNDSGLNADAINTLVGTGVLLRVRRGGYVRTTYWDSLTWLGQFLHAHTAVASERTRSVYSHASAARLHGLPLWKADNFIHITRAGKSSTAEASDVRVHCLQLRDDECTVIDGLPVTNLLRTTVDCALTMYQQALILMDHALRSGRATLEREAQALD-GHRGIRIFRAALNFASALSESAGESLTRDLIRICGIEPAHLQFT. 275
212 4.000e-42UniRef50_A0A166MWC9 Uncharacterized protein n=26 Tax=Dietzia TaxID=37914 RepID=A0A166MWC9_9ACTN  ali  18  15............RALLHTTEQLMAAGFSTQSLGRAVTSGDLIRLRPGFYVDRST-RELGREERHLLMVLAADRALGCPVFTHWSAALVLGLPGWDLPLGTVSLSRAGYAQRSRTTRLTRHTPLAEDDVHVVDGLRVTRPKRTIVDVARCAPPASVAVADAAFKAEAVTAASVDDALAAGKSGVKRARAALARVDARSESVAETRSRLIFADYGLPEPQTQV.. 227
213 4.000e-42UniRef50_D2S973 Uncharacterized protein n=11 Tax=Actinobacteria TaxID=201174 RepID=D2S973_GEOOG  ali  20  1..........MEPDRLFLRRLAVAEGWTDDELARHVRDGALTRLRRGAYVAGADMVT-DEVRHHLLIRATLASLRRPAVVSHQSAAVLHGLPLWGVRLDRVHVTRRPPASSAGRCLRTHVARLADHEVTRVDGLLVTDPVRTALDLARLPLEPAVAALDAALHRALLAKPVLEGRVQAGTRGSRAATRAVTFADGRSESVGESRSRVLLHRLGLAPSTLQ... 213
214 4.000e-42UniRef50_A0A1G6ML61 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Microbacterium enclense TaxID=993073 RepID=A0A1G6ML61_9MICO  ali  22  8.........ARARRSLFSRAELRERGVTEADLRKASAGGEWHRIQPGVYVAREEWETARPTDRHRFAILAARAREAGGVISHLSAAVLHGLPLYRSDGPVHTTVPRASHPPSGRAVRRHTGALGAADVVIVDGLLCTSLERTVFDIACTPREAALSCADAALRRAAVTREAMLDRIARGRRGVRDAAWIVAFSDGRAELPGESVSRLQLHRLGFRDLDLQV.. 237
215 4.000e-42UniRef50_UPI000DBE1B90 hypothetical protein n=1 Tax=Homoserinimonas sp. OAct 916 TaxID=2211450 RepID=UPI000DBE1B90  ali  25  6..........LPDHGLIRVADVMREGANDRSLRTAASAGTAIRLARGCYVRTATWSEMSPDQQYLLRIQAAATLSEGAVFSHYSAAAIWGYSIVGPWPQAHVSVGSASGMRSSRHIRRHVVTVPDNERELVDGLLVTNPLRTLCDLARMTFPSAVVMFDAGLRASALQREQILERLAAGRRGIRVATSAAHFARAGAHTAGESLSRVMIHRLRMPEPQLQV.. 229
216 4.000e-42UniRef50_A0A177K945 Uncharacterized protein n=2 Tax=Microbacterium TaxID=33882 RepID=A0A177K945_9MICO  ali  21  6...........AASRIETRPALLRAGMTRRDIAT-LSHGDLRKLARGAFVASETWDAAWPAERHLLQVAAYQRRRGGVVYSHLTAALLHGLPLWGAPPTHVHVSDTQHNGAVSRGVSRHRCAVPDVDVVSSGGIVLTAPARTVADVLRTPRETAIAIADAALRAVAWDRAEIARRLATGARGVRQARELLELAVGRSESAGESVSRLRLHDLGFRRIRLQV.. 233
217 4.000e-42UniRef50_F6EF23 Uncharacterized protein n=2 Tax=Hoyosella TaxID=697025 RepID=F6EF23_HOYSD  ali  25  2............................................RRDCYVRSREWAAMSTEQRHLLRVAAVARRHGDAVLSHSSAAVMHGLPTWGLDQKRVHVTRGHRSAGRVTG-DMHVHSGSASGSGLVAGLPVTTPARTVVDIARTPFEQAVVIGDAALQRGLATRDQLSSELARHCTGIREAEKAIAFLDERSESPGESRSRVFMHRYGLQMPCLQAS. 183
218 4.000e-42UniRef50_A0A2T0VBN6 Uncharacterized protein n=2 Tax=Glaciihabitans tibetensis TaxID=1266600 RepID=A0A2T0VBN6_9MICO  ali  22  21..........................VTERAVARDVAAGSLVRVRRGAYVERERWESATPRERHILRIHVVAATSKPVVIGGMSAAALWGMPVKGPWPTAVTVVPQERGGRSAPGVRRTSVGFSSASLVEVHGVTVTDLARTTLDVARHTFTDAIGSADWALWRRGISVSDLTEELSRMAPGRAHLERVAAFASPLSDSFYESAARAAMHLLGFAAPELQVS. 224
219 4.000e-42UniRef50_S2ZIE1 Uncharacterized protein n=2 Tax=Bifidobacterium breve TaxID=1685 RepID=S2ZIE1_BIFBR  ali  38  1...............................................MYVKPEYWNALKPDERIQHVACTLHLKHPNWVFAGVTAAALHGFEHPWHLHAGSVTIATASQGTNANNANIKRVFVPHCAPEYVNGIPVTNGAQTVVDCGLTDFRFALPIIDSALRKG-TAIADILNICSTMHRDCTPIFRLLHYANPASENGGESLGRGTIVEGGLMVPELQ... 173
220 5.000e-42UniRef50_A0A1Y4K9I0 Uncharacterized protein n=4 Tax=Olsenella TaxID=133925 RepID=A0A1Y4K9I0_9ACTN  ali  26  23.....ELSAMLDGAQRAGSLLVPETERVRAALRRRMGAGGIVSPERGMYARASWWEGLRPDARALAIMRGLQRLHPGWVFCGVSAALAHGADVWGLLEKTHVAAPRSSWSVRSDRIAWHAVDCAEDRPVVRSSVRVTPLPRTTLDCMRLSFREGMVVADHAVAHASGGREELLQARAGRCHGVDRALGTLAWADARAESGGESIARAVMIEQGFMLPDLQ... 242
221 5.000e-42UniRef50_A0A147DRP1 Uncharacterized protein n=7 Tax=Curtobacterium TaxID=2034 RepID=A0A147DRP1_9MICO  ali  19  13...........................DDHALQQAVRRGELVRVTRGIAVDARAWQTASVRERQRVGLEAVMTTVGEWVLSHRSAALLWDLPDVDRPDRRVHVTDPLGTTHSGRRVVRHAAGLGADEVTTFDGRRVTTLLRTVVDIVRTSYENGVAVFDHVLHRHLLDVDELRRAFAATPRGMTRARRALRFADGRAESPGESVSRVRIDEDGFPPPVLQ... 210
222 5.000e-42UniRef50_UPI000D74913A hypothetical protein n=1 Tax=Nocardioides daejeonensis TaxID=1046556 RepID=UPI000D74913A  ali  19  17..................RTELLALGYDDAFIQRRLRGGVWTRIRNGAYAVTEAWERKTPVEQHLIRARSVQRHARSPVLSHVTALLAHDLPVWEADLRDVHITGRRTAGRKEAGICHHRGMLVDSDGVDVGQDRATHPARAVLEYATMDLEHGLVAADGALHKRLVTAEQMHRQAQRHWPGAHCLRLLLSLMDPRIESPGESRVRHLCWVFGIPMPVPQFE. 224
223 6.000e-42UniRef50_V9XN07 Uncharacterized protein n=13 Tax=Nocardiaceae TaxID=85025 RepID=V9XN07_9NOCA  ali  21  7.................TRAMLAEAGISDRAVRTRLRHGGLVRIARGTYMTREDVDALGPVGVHLARARLVGRFDADEALSHVTAAVVHGLDVWDAPLRRIHVTRPPTRSCRVSDDLHIHTSDLDGDVVDVDGLRVTSLARTVVDVARLSRPRALVIGDSALRADPTAHLDLPRILARGRTGIVAAESVARLVDGRSESVGESLSRLHMIEAGLPMPDLQHE. 215
224 6.000e-42UniRef50_A0A2S0QHG2 Uncharacterized protein n=2 Tax=Dietzia sp. JS16-p6b TaxID=2052657 RepID=A0A2S0QHG2_9ACTN  ali  20  10................FTTAEATRAGLSHRALTAAVAQGRLIKIRHGWF-HAPQSGESTRDALARSSRIALYEGPLGAVISHHTAAALHGLPLIRARTDRVHTVDRPTGGRRTPHIQVYSSPRDSLDTTQVDGIPVTCVARTVVDLARSGFDAGVCAADHALRLRMVTADGLASEVDRGRTGVAIARDVVDFADPRAESPGESLSRCVMRRCRVPAPRLQH.. 218
225 7.000e-42UniRef50_C0W5C5 Uncharacterized protein n=10 Tax=root TaxID=1 RepID=C0W5C5_9ACTO  ali  22  11..................TRDLTLDGVSSKSFARSTRDSDLMPLLRGAYVNRQEFKALDLSQRHLTRLCAVGRLSGEAAIARESAAVIHGLPLIGKLPERVQLVRRGRTGGKTTAATRTLPAPEDCDMVEIDGIRVTSVAQTLIDLGRRPFASNLTSLDAALRRGNVTKEQLLSLVDAHPHGNTRLRRWIEVADPRSESPGESLSRAVMIEHHLPLPRLQ... 220
226 7.000e-42UniRef50_UPI00068104CE hypothetical protein n=1 Tax=Dietzia alimentaria TaxID=665550 RepID=UPI00068104CE  ali  17  10..............EPFSSFAALRIGISSRILAKGVESGQLIKLRHGWYCRTPAAEEPQTATMIRRIGVSLEQRPETTIASHASAALLHGLPLVGDASQVHLTRSRPDGGKSTPGLIQHTSPHPPASVV-VHGIRATTVPRTVVDISRTGFTAGVCAADAALRTGLTTLTELADEVERGRAGVGMARAVAGFADGLSGSPGESISRCLISWAEIPAPRLQHE. 222
227 7.000e-42UniRef50_A0A1V2NUT6 Uncharacterized protein n=2 Tax=Kribbella sp. ALI-6-A TaxID=1933817 RepID=A0A1V2NUT6_9ACTN  ali  18  10.........ARRQGGVFSRRQALSCGYTPRQIAYRLADGRWQRIRHGQYAVAVDLSATPPWDRHRRLVYAAVMRSGSVAVSHQSALVLHDVPIWGLGLTEAHLTRSDQRSGPAAGVRHHRGILDPADLTLVDGILTTTPPRAVVEAACTSFEAAVVAMDAVRRSHENCGPDLDRLLDEFWPGSTTARRALAFSDPSAESVGESRLRVQMHEQGLPRPVLQAS. 232
228 8.000e-42UniRef50_UPI0004B172F4 hypothetical protein n=2 Tax=Arthrobacter TaxID=1663 RepID=UPI0004B172F4  ali  22  16.......................RAGENRRSLARQVQRGVLVRVRPGIYAPAREWRDLTWWDQYRLKVEAVAQGPADRVFSRQSAASVWGIPFFGAKNHVHVQVGRSTHGRLSAGVQSHR-DLELESPVKRKKLWVTTRAQTVIELALSPFPHAVAAADHVLNAEPISKNEIMAIAERLNSKADRASNVIRFADVRSDSPGESVSRANMYLEGFGQPELQY.. 222
229 1.000e-41UniRef50_A0A096KUR7 Uncharacterized protein n=5 Tax=Collinsella TaxID=102106 RepID=A0A096KUR7_9ACTN  ali  33  5..NDQLIDQLLTQAEQEGRCLIPPSAAIRKALLRRIGD-MVVSPMPGLFARKIRWDELNRAQRHCEIIRALAIIHPDWTFCSFSAACLLGLEVSWR-HLNVVHVCSSTKPSARPGAHIQRHQIEPAGAIRRVGISVTPPIQTATDCLLTGFADGMPIADSAISKLGLTREQLMEAVARNGRAIRTALTTLRYADVRAESGGESVARAVMIETGFAPDWLQYE. 228
230 1.000e-41UniRef50_A0A2W6CCE0 Uncharacterized protein n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6CCE0_9PSEU  ali  19  2........RTLPPATVFSRADARSCGWSDAALSRAVRSGRVLRLRHDQFTAPE------NRDDRRVAATAAARVCRGSVVSHRSAALIHGLPLLEVPPKRPDLTITPRGTGDVAAALLHRATLRPADIIEIDGLPVTTVARTVIDLARMSTAAALVTTDAALNRGLADADDLELILRRNWPGIRRARRTLMAADGRAESPLESVSRLVLRWLALPTPDLQ... 210
231 1.000e-41UniRef50_A0A2G8CVE4 Uncharacterized protein n=2 Tax=Leucobacter TaxID=55968 RepID=A0A2G8CVE4_9MICO  ali  23  2..........................VNDRRIAAAVQQGTLVRVARGWFVAGEAWRRLSAEDRHLLTILAVSRLGPEDVFCRTSAAAIHGLPVYRFRASTVHLMTLGDSRRSRRSVARHADRLDPEEVTTVAGLRCTTLTRTALDIARTPPEVALGCADAALRARGPTRAHLLSALMPGARGVRAARTVLELADPRAESPLESASRWFLTRLGFDT-ELQV.. 211
232 1.000e-41UniRef50_H0QWB6 Uncharacterized protein n=2 Tax=Gordonia effusa TaxID=263908 RepID=H0QWB6_9ACTN  ali  22  8..............GLTSRAHAVRTSASDNDLKRLVRAGTVERPWRGHYLTTGALTGHPELERYRAKVIAAARSRGDRVVSHSSAAALHGIPLLSPDLDVVHFTTMKGTGRAAGRAIIHQAPIDPDDLVEKDGVPLTSVSRTIADVARAGFPQALTALDQGLRRGLIDLERI-AQSQSRWHGIEMLRRSIPLATPLAASVGESYSRAIIFEFDIPDPDVQY.. 224
233 1.000e-41UniRef50_A0A2U0HB46 Uncharacterized protein n=1 Tax=Microbacterium sp. Gd 4-13 TaxID=2173179 RepID=A0A2U0HB46_9MICO  ali  23  16...............LLRRGDLADEGIGSHALDRMVASSELRRVRPGVYVRDEDVRMLTPEGRIVVRARALAVSRVAPVFSHLTAAAILGLPVYGWHAVTLDAILSPERPGAAAGVVRHRGQLAAGDVVGVGDLTCTSLVRTVADIARTGFTPAVCAVDAALRQYLTDRAEAREVVGRSAHGRTRAQRALAFADGRAQLPGESVSRILLAELGFARPSLQV.. 236
234 1.000e-41UniRef50_UPI0009E78FC4 CTP synthase n=1 Tax=Bifidobacterium aesculapii TaxID=1329411 RepID=UPI0009E78FC4  ali  29  2....................................RSGSVERPFRGMYAEATYWHALTRYEQLRHVVRALAKKHPDWVFCGPTAAVMHCLDCSYRLLLP-LHILGNPNTHHRNTRQLKRHVVSYPETTEVEGVKVTGLMRTLFDCATLDLRYSLAPIDSALRAGHVSRDNLLAYPSSYSRHRQSAIRAFDLSDARSENGGESSARGMLHDMGYPPDDIQVE. 189
235 1.000e-41UniRef50_I4LSW7 AMP-dependent synthetase and ligase n=14 Tax=Bacteria TaxID=2 RepID=I4LSW7_GARVA  ali  31  1MKKS-NVKSMLEKAEFEHRCFHPISNSQRQCAYRYTRAGSLVRVFSGLYARREYWQNLYTAEQIRHIAFSLMDIHPDWKFTGVTAAALIGYDVMLQSQSTPIYVRTITRKSANDNPLLRRIVLPHLSDNIDYGVRIVDKSTMLFDVASMNFRSALSIFDSAARDNVTTSDLFESTFFGSCCETRSLRRLCCFANRLSENGGESFARGTMISLGFMVPELQCE. 309
236 2.000e-41UniRef50_A0A2T6KUJ8 Uncharacterized protein n=2 Tax=Promicromonospora sp. AC04 TaxID=2135723 RepID=A0A2T6KUJ8_9MICO  ali  18  58.....................LLARERDKNQLALASRQGTLVRIRRGAYCTTDAIRVDGPSAAARARARALHQLRSDPVFSHTTAALLLGCLVWTVPDSTHVYQDYRASTRSANDIARHRGKLPPEDITTAQGLPVTSLTRTVVDCALTHPLEALVIADSALRLGAERDDLLMMLARTGLRGIRRARLVIELADGGSQSAWETWVRYELLRAGLPRPRTQ... 266
237 2.000e-41UniRef50_A0A0U3HXD2 Uncharacterized protein n=6 Tax=Kocuria TaxID=57493 RepID=A0A0U3HXD2_9MICC  ali  21  14..............PLLRTADLQDAGLGDRAVHRQVQEGRLVRLRAGWYVRGEPYRALRQEDRMLLGHLAYARSSTDPVLCHASAALVHGLRLYRVPTRVHTVSAPGRGTHGAPDVVRHQEPLPPADVVEVRGIRVTSAERTLLDCARLPFTDAVVLADQAAAVR-VTRARLERRLPRGRRGVRRAHRVLCAMDVRAESVGETLTRLMLAEWGLPEPRLQ... 223
238 2.000e-41UniRef50_UPI00040000FA hypothetical protein n=1 Tax=Nocardioides alkalitolerans TaxID=281714 RepID=UPI00040000FA  ali  15  6....PQLDSLIEKEGVFLRRDAVDRGYDDKVIARQLRSGAWIRVRHGAYTLPPIWDAADRRERHLLTARAVHRAAEDIAFSHTTSVLLHGGATWDLPLDVHVVRAGGRSGRATAGVRRHRAAVEEEDLVVTDGLPHTSGARTVFEIISVGAERALAVTNDLLHRKVVLMADIKEYRARHWPHTLGAEVVLRLADPRIETVGESRTLYLMFREGLPHPVPQFE. 229
239 2.000e-41UniRef50_A0A259S5U3 Uncharacterized protein n=2 Tax=Microbacterium TaxID=33882 RepID=A0A259S5U3_9MICO  ali  20  21................RSREDLILNGWTDRRIAAAVRSGALFHIRRGWYIDADERSALWPEEQHRAHVIAVARSRGRAVASHSSAAVLWRLPLYRRCARVHLTTGRAPRISSAPDVTRHATPIDAADTTVIDGIRCTSLARTVFDLGTLPLEAAVALADAAVRLREWDIEAVASWRARGMRGIRQARWVFAFTDGRAESPGESVSRLQLRRLGYAPPALQV.. 242
240 2.000e-41UniRef50_A0A0Q9R9B8 Uncharacterized protein n=1 Tax=Arthrobacter sp. Soil782 TaxID=1736410 RepID=A0A0Q9R9B8_9MICC  ali  20  17.................RTTELEQMGVSRRTITRLVERGILARLQVNAYVPAKYWKSLSNAEQGRFRVMAHNRARTQSAYSHTSAARIHRLTLWDVDDRIHITQPSSGSSRHNPDVVRHRAKLLPGEVDMVDGLQVTSLARTAVDSARLSFRQGLITADHALHLG-VQRAELHQVLQRGYKGVQIARQVVEKASALSESAGESLTAHLLAGMPIPPPEQQ... 225
241 2.000e-41UniRef50_A0A127A7U1 Uncharacterized protein n=1 Tax=Sinomonas atrocyanea TaxID=37927 RepID=A0A127A7U1_9MICC  ali  23  16............RTEVASTATLRNAGLDDRLLTQAVRAGALVRLRRGAYILARRWAALPPWEKDAARIDAHVEGTGGAVYCLGSAAIIHGLSVWNSGPLVHVATEAGSTTSRGADTRSHRLDLDEKDVVVARRLRVTSKPRTAADCARLPFEEAVVVGDSALLSG-VSREEIREAVNGSPRGRRQALAVLEALEPKTESVGESRTRVLIERLGFARPVAQ... 230
242 2.000e-41UniRef50_A0A0K1JFK5 Uncharacterized protein n=3 Tax=Luteipulveratus TaxID=745364 RepID=A0A0K1JFK5_9MICO  ali  19  4MSDDNAI--AFDPTTLQICSELRRGFVEPRRVRRDDGALRFHMVRHGVCMESATWSNLGPDQRYEALVHATALMPGPHIFSHQSAAAVWQLPIVERWPAKVHVVVEESKAHSSS--VLVRHTQEGATAVLQNGLLVTDVARTVADLSRVGFVDGLAAADNAMRRGLCEREDLHAEWQRRSPGRAIIRRVAELADSGAMSAGESLSRGQMFLLRFPQPCLQV.. 226
243 2.000e-41UniRef50_A0A0Q6XWV3 Uncharacterized protein n=1 Tax=Leifsonia sp. Root4 TaxID=1736525 RepID=A0A0Q6XWV3_9MICO  ali  21  8....QSLDLLRIAPALLLAAEYNALGAVRGQLAREVAAGRLIRLRRGLYARRTVWDELSATERYQALVLGVARTSGQPVLSHASAAVIHGLPVVGRWPTEVHLISPRAGGRSTPDRIRHAAELDGADIVERDGLVLTGLARTLIDLARSASATAVASIDAALHRPAITRAELDETFERMLPRSARARGLLDFGDGRAESVSESNSRVTMARIGVPQPELQH.. 235
244 2.000e-41UniRef50_A0A0Q9RYI8 Uncharacterized protein n=1 Tax=Nocardioides sp. Soil797 TaxID=1736413 RepID=A0A0Q9RYI8_9ACTN  ali  18  5......LRQMCDDNGVFLRREALGMGLDQKTITRLARDGTFHRVRHGAYTFGDIWRVSTPEQRHRITARAVLRARSEALLSHVSAALEYAVPIWGMPLDEVHTTRRDGHAGRRAGIRHHQGLLVPGDLHELDGIPLTSATRTAVDLTTVDAEHALVPINAMLHQGLMTVEAFLTRLAEHWPDTLSAHVVKRLLNPKCESPGESRTDYICWASGLPRPEAQVE. 225
245 2.000e-41UniRef50_A0A1H0ZCK7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Arthrobacter crystallopoietes TaxID=37928 RepID=A0A1H0ZCK7_  ali  19  8....ARVTAAWPKLDVLTAAELTEVGIGERLRMEAVRWGVVLRIRRGAYVLAALWKQSTHKQQNLMRIRAHFLTTPHAAYSHTTAARLHHLYIWSINSTIHLSQPFSSTRRSSGGVQTHNRVLPVGETVVLQGPRATSLERTVLDCARLELHRAVIIGDHALRLGALSKMEGMVNAMPGAPGIRKARNVLSLLDGRSESPGETRTRLLLRTFGIPMPEPQV.. 233
246 2.000e-41UniRef50_A0A1G6Y9R6 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Auraticoccus monumenti TaxID=675864 RepID=A0A1G6Y9R6_9ACTN  ali  20  3..............EVHLTGELLARGWTSAELARSVRAGEIVRPRRGAYVLDPPGQEAGPPDRHRRLVEAVPQLRVGSAVSHTSAAVLHGLPVPYASLATVDLTRDPATTGRSRGVHTVAAPLPDDHVTEIDGLPVTTLARTVVDVARHGFDWGLAASDAALREGL-EREELDEVLRRRWPGVRRARRVRVESDPAAESPAESIMRARIVEAGFPRPHLQ... 215
247 2.000e-41UniRef50_A0A1Y3XXJ9 Uncharacterized protein n=2 Tax=Coriobacteriaceae TaxID=84107 RepID=A0A1Y3XXJ9_9ACTN  ali  28  4.RIEHHISQLLDEAEQRGACLASTDPSLRRHLMKRVRQRALIRPFRSLYMRAGTWKQLSLDERALHVLRGLQALHPDWVFCHDSAAIAWGLPLPAERTRAVHVASTTHARGNTPKTLVYHKFADGIPVATANGIRVTPFIETVYDLARSIFPVGLAVADRALRLCATTARQLLRELGTRHRNARRVAGVMGYASPRSESWAESVARALMIIHGFASPRLQV.. 234
248 2.000e-41UniRef50_A0A1H4KHN9 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Arthrobacter woluwensis TaxID=156980 RepID=A0A1H4KHN9_9MICC  ali  18  9......LEHLETSAPRFWRRQLLDSGVGHESIRWLHRTGHLQRLRRGCYYPRAAWEQRKPWERDTLRILAHAASPGRYAYSHATAARLRGWAVLHAEPRIHVTSTRPGQGQHAPDVVAHTAPLPVDQTEVMSGVVVTTACRTAVDCARLTFSGGMVVMDQALRSGVRAQDVLDATRQLGHRGVIQLRRVLDGADARSESPGESCTRVAVARMNIEQPTPQLE. 233
249 2.000e-41UniRef50_A0A087E0J3 Uncharacterized protein n=3 Tax=Bifidobacterium TaxID=1678 RepID=A0A087E0J3_9BIFI  ali  43  1MKQHKVVNARIVQAQQENRCAVGDTDALRRAMRRRVATGELASPYQNLYVPPDYWAQLNECQRSLHVARGLARLHPTWVFAGITAADVHGFEHSWKVHDQSVYVASRSGADGGRRFTVRRLYVPSIAPVSVNGIMVTDAARTLIDCGLLPFRFALPMFDSAARKGM-DMNEVERSCKGLHDDRAPIEMLLRYVDAASENGGESMVRAFIIDNGFVVPELQVE. 247
250 2.000e-41UniRef50_U1WMQ8 Uncharacterized protein n=3 Tax=Atopobium TaxID=1380 RepID=U1WMQ8_9ACTN  ali  29  7....HEATQLLANAEHMHMCAFTDDRLLRNTLRKYKLKERVTSPTTGLYVRQDYWSRLSTEEQHLHIARALQAKHPNWVFYGPTAALAYGFAVPYNSL-AKIHVMHTKGACRANGLIKHRRFPEHMKATLASDIAVPNPAETILQCLCTMFSDGLCIADSALRVLNKSKEWLLEAVKQLRKGIVQARLTASFANPRAESGGESIARARIIELGFALPELQA.. 231
251 2.000e-41UniRef50_A0A261G4T2 CTP synthase (UTP-ammonia lyase) n=5 Tax=Bifidobacterium TaxID=1678 RepID=A0A261G4T2_9BIFI  ali  42  1MKLRNDIEQLRIEGERGRRCFYPNNHLQQQALAARLHGGQFIRPYRNMYARSEYWHALPPPEQARHIIRAMSHQYPNRVFAGLSAAAMLHLEYPWKLHDESVFIASPRGRSTGTYSRLHHIVMRTAPTCTVNIVRITTPARTLIDCGRYPFVQALPMFDSAFRNNLVTRGQVLDLCNEVHIDCSCVLRLLHYANPLNENGGESLCYGTIIDEGFAVPQLQ... 254
252 3.000e-41UniRef50_A0K0A9 Uncharacterized protein n=8 Tax=Arthrobacter TaxID=1663 RepID=A0K0A9_ARTS2  ali  23  81.................RTEELLASGLSKRHINEHLLAGSLVRVRTGIMARGSHWNALSDGDRGRARLAAAATAGDGLTFSHTSAGRLHRLYLWRPDQLIHVIVPHAARGSHAADVKAHSALLLPGDRTEIDGLPVTSLDRTVLDCALMLYRQALILLDHGLRSG-CDRQRLESACAAGVRGVAGFRRALAFADPMSESPGESLARDIIARLRFPAPVLQF.. 293
253 3.000e-41UniRef50_A0A1H1Z3M2 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Microlunatus soli TaxID=630515 RepID=A0A1H1Z3M2_9ACTN  ali  18  7..............RPASTRQLRDRGFSQEQLRSLLRQGDITRLRRGAYADSGPDTDDFAAAHRQLIMATVPLIVAGSCISHTSAAVLHDLPVPPRLGAVHVTRSRQSGQGRRTDLHVHAAPLPDQDLCLVDGIVTTSVPRTVVDAARLSLGRGIAMADAALRTASVTREDLIRVSVGLRVGMPRARTVIGMSDPRSESPGESLSRVEFQLHGLPAPDLQ... 219
254 3.000e-41UniRef50_A0A255GQW5 Uncharacterized protein n=1 Tax=Propionibacteriaceae bacterium NML 030167 TaxID=2016500 RepID=A0A255GQW5_9ACTN  ali  22  2...............HHRRRDYLGRGHSAAELASALRAGEFVRLGRGIYGEAGSWQ--TPEDRHRDLVAAVPDLKAGSVLSHVTAGVLHDLWLPARALDRVQVVRAGKGGGSSRYLHVHRGGSQRSVPAPGLEIEMTDLLTTTMDLLRLPIADAVGVADSALRRGL-DRDELLEELDRRRRGNRTARIAAEFANPRAESRGESFSRWRIHELGLPAPELQH.. 209
255 3.000e-41UniRef50_A0A0F0LEW7 Uncharacterized protein n=13 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0F0LEW7_9MICO  ali  19  10.PHHEPILEHL----VRSREDLILNGWTDRRIAAAVQAGVLFHIRRGWYIDADERSGLWPEEQHRAHVIAVARGRGGAIASHTSAAVLWRLPLYRRCARVHLTTSRARRISSAPDVIRHATSIDAEDVVDIDGIRCTSLARTVFDLGTLPLEAAVALADAALRLREWDVEAVTSWRAGGMRGIRQARWVFAFADGRAELPGESVSRLQLRRLGYAPPALQV.. 242
256 3.000e-41UniRef50_UPI0009E4DF05 hypothetical protein n=1 Tax=Williamsia herbipolensis TaxID=1603258 RepID=UPI0009E4DF05  ali  17  37................ATRRDLERMGVSRDRITAALRSGSLVSVAPGYYMRPASIGAFPAHEHLALARAVLAGMSPGTALAEVAAAINHGLPVVGADLSRVRLVRPGGSGTQRTSVSVLTRNVTDDELVFVDGCLTTTVPRTVVDLARRDVRTAVVVGDAALHRGLATLHELEHRLAAAGRGARRAREIVAMLDGRAESPLESWSRLVVGRSNLPSPELQHE. 247
257 3.000e-41UniRef50_A0A239G6C4 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Micrococcales bacterium KH10 TaxID=1945885 RepID=A0A239G6C4  ali  22  31................HHRRELLNDGDSSYVMTQCIKQGMLVRVAHGFYAESAKWADLKPERQHVEYAQALARQHPDLQFSHATAALVQGMPWKRWRIPAKLQCVVGSQTKRRSSASVQRRHFDLDDAIRHNGVLVTSAPRTVLDVACSEFAIGLACADYVLVRRLATKRQLLDAISSHRYGIHRARLVVDLADDRIESAGESFCRAVIHQLGFVLPTLQH.. 239
258 3.000e-41UniRef50_A0A086DX05 Uncharacterized protein n=1 Tax=Cryobacterium sp. MLB-32 TaxID=1529318 RepID=A0A086DX05_9MICO  ali  21  18..................AAALRSSGVNSSAIGALVHRGELVRVRTGWYVLGPKWRAEQPDGRYRFLVRAAAHAGSELLLSHHSAAVMHGLPLIGAWPATTHALFPEARGGSSHPLLTAHRGMPDPTSTRVAGVKVTGLARTVVDMAASSFLIGVAMVDHVLHQPPITKDTLLTELAHPRVGWRAAHRAIAFANELSANAGESLSRVRFEELGFEIPELQV.. 240
259 3.000e-41UniRef50_UPI0006887E08 hypothetical protein n=2 Tax=Arthrobacter TaxID=1663 RepID=UPI0006887E08  ali  20  25....................ELLNAGLTDRSIQTLVRGRKLVRLRRGSYIETKAWKELTAEERSLQHVLAYERNSPKTVYSHTTAALLHGLFLLDTPNTVHISRRARTSTKVPADVRRHVRTLPQKDIITLRSRPVTTLERTLVDCAAMDYQHAMVIGDHAARLG-ASPDRVRQIVESGHRGIRNIRRVVEGINPLSESPGETITRILLKALDVPMPELQV.. 231
260 3.000e-41UniRef50_A0A2S0KGJ7 Uncharacterized protein n=2 Tax=Gordonia iterans TaxID=1004901 RepID=A0A2S0KGJ7_9ACTN  ali  21  18...........DRHGVIRRAAALKQGYTDAQLHAHVKSGRLLDLGEGAYLLPGALPVGSERAHYRMRCIAFGSAGRGAVLGHQSAAALHGLKLLKPDLDRVHVFSGRRGGGHRNRRHVHPGKIDDAEAVAVDGVLVTSVARTAVDIACCGFAQALTALDGALRLG-ATVDQLKAELEARRRGSAMATRALTFADGDSESVGESWSRAQLILAGLPVPSLQV.. 233
261 4.000e-41UniRef50_V8D4A4 Uncharacterized protein n=12 Tax=Actinobacteria TaxID=201174 RepID=V8D4A4_9ACTN  ali  22  11...............LVRRRDALQIGELDRHLAARVKTGELRRLYRGFYTFTSDLDQLDRHVRYRRTVLAAADNGPNKAISHWSAAVLHGLPVLDGDSSRVHFTANRGGRRRGRACVVHGSTWETDEVAMIGELLVTSRARTAVDVARSGFFQAVCVFDGALHAG-VPRGELESVLRRGRTGISVARAALAVADGKSESIGESLSRALILSFGIPLPRLQH.. 226
262 4.000e-41UniRef50_A0A0F0LT16 Uncharacterized protein n=10 Tax=Microbacterium TaxID=33882 RepID=A0A0F0LT16_9MICO  ali  22  29....................................DGRDLERIRPGVYAHRQDWAAASTEGRVIARAHALGLIADDAVFSHETAAALHGLPLFRPDRTRVHLTVSHARPGSAVGTIRHRGFVPEEEIVEIRGLRCTTLERTVADVVRTGFESAVVVADAALRARCVPLDAVHGIAHRFAHGRHRADRVLAFADGRAQLPGESISRIRLVELGFRSIRLQVE. 228
263 4.000e-41UniRef50_A0A1Z3LNJ6 Uncharacterized protein n=5 Tax=Cryobacterium TaxID=69578 RepID=A0A1Z3LNJ6_9MICO  ali  23  19.........................GHDARAHRREYEYGGTERLRRGIYVSRTIWTSADADARYLMRIQAAVLSRSRPVVSHLSAARVWGLPVLGQWPTEVHLQGGSGQTRTSNWIAWHHDPLPDEDVTEIDGLLVTTRLRTLVDLARSPFRSAVITLDAGLQEPAITRDEVMARVLRSARGTRRARRSVGFADAKSGSPGESLSRTGIFLAGMPMPELQV.. 229
264 5.000e-41UniRef50_UPI000688DFA5 hypothetical protein n=1 Tax=Propionibacteriaceae bacterium P6A17 TaxID=1410634 RepID=UPI000688DFA5  ali  19  4..............TLLTHAELLATGLTPDDITRLRRAGTLHRVCRGVYAR---HVPEDEEGRHLQLVAACARRHPSAVASHVSAAVIHGLPVRRGALGRAFIRPEGGHAGRSQATCIRALSLQEQEYTTVNGQLVTSLARTVADIARTEPVWGVAAVDVALRRG-IQREEIVAILDATRHGTWKARAVVEFGDARAESPLESISRFHMATLGLPAPELQVE. 212
265 5.000e-41UniRef50_K0F9B1 Uncharacterized protein n=9 Tax=Nocardia TaxID=1817 RepID=K0F9B1_9NOCA  ali  20  14................LARRDALAAGFTDRELHGI----GWQRVRRGSYTASASTLAPSAEHRHLLLTQAVAAVSSDAIVSHVSAALAHGLPCWAIPLTRAHLIRARSNGGRVTRVALHSMQIEPDEIVQVGALRVTSVARTVIDLARTPFEQAVVVGDGALHSGKTTCDELRAQIARGRQGNPAARRVVAFLDGRSESVGESRSRVALRAARYPEPELQ... 218
266 5.000e-41UniRef50_UPI00082E10CD hypothetical protein n=2 Tax=Rhodococcus phenolicus TaxID=263849 RepID=UPI00082E10CD  ali  19  5..............RVLTRARLLAAGTSAFEIARELRTGELVPVAHGVYLRRGDHGALDGTGRHRVLARHFGSTLDQGAISHISAATLHGAPVWNLPLTRVHVRTPGAGARHRGRLHIHTARWMDADLTVVDAVPVTSVARTIADVARTPRPQAVIIGDALLRIDPAAAAWLVVEAASGLHGVARARAVAGFLDARSESVGESLSRVRIEEAGLPRPVLQHE. 217
267 5.000e-41UniRef50_A0A0M5L065 Uncharacterized protein n=8 Tax=Arthrobacter TaxID=1663 RepID=A0A0M5L065_9MICC  ali  21  21................ATTAQLDDAGCGDRLLKAAVDMRVLVRIRRGAYVRTEVWDALKPWEQSFLLMAHILTASGNPVYSHFSAARLHGLDVWNCGDEVHVTSAATPSGMGVAADVVHHHLPLPGRITSAAGVRVTSLERTVVDCARYGFAQAVAIGDHALRRG-ANLEVMTDMVSRGQRGVKRARRVLAALNDASESVGESRTRLVLVVMDIPEPVLQ... 233
268 5.000e-41UniRef50_A0A1G6HVT9 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6HVT9_9ACTN  ali  21  14....................QLARCGMTTEEVSRAVRNGSLVRLRRGTYATG---LPDDPTARHRQLVEAVPALGESAIISHQSAAVCHGLAVPWSMLDPRIHLTRAGGGNRRPRIVSHVGHIPSDHVTTLDGLRLTSVAWSVVDCARLGFGGGLAVADSALRLQRGDMGQLSALLDSGRHGIATARAVVAFASPLPESPGESVSRAVLRQVGLPDPVLQYE. 223
269 5.000e-41UniRef50_UPI000C8343CA hypothetical protein n=1 Tax=Sanguibacter massiliensis TaxID=1973217 RepID=UPI000C8343CA  ali  18  2....................................RDGGWARLAPGVYVDAEIASDTSAAGATAVRLRAVAERMPEGVVSHASAALLHGLPVWHVPCQTHVTQQVGAHVRRPDDVVRHIVDVGDDERTTVLGLPVTSLLRTVVDCLRLDPLDGLVVADAALRAG-IGDEELRAAAMAGQRGVRRARELVRVADAGAESPGESVTRCHVLAAGLPAPQTQV.. 192
270 5.000e-41UniRef50_A0A0W7WBR2 Uncharacterized protein n=1 Tax=Leucobacter sp. G161 TaxID=663704 RepID=A0A0W7WBR2_9MICO  ali  22  10...........AASHLLHRDDLARAGIGARKITAMERSGELVRVRAGIFVPRAYWETAFPEARHALAIHAHQAARRPPVFSHRSAAVLHGLPAWSDPLQVHTTVARGSDATSTRVTRRHIAHLSTDDVTQVGEFTATSADLTLADLARSDFAVALACADAHLHRNMGARHEQRSASMAGYSGVRAVRALAELADPRAESPLESLSRLRFLQLGL-VPELQVS. 243
271 5.000e-41UniRef50_A0A286GHC1 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=15 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A286GHC1_9ACTN  ali  19  54...........RQLGLVTAADARRAGYGPPEVRRLCESGSWVRVRRGVHLPAGELDALTPAARHRLDCLAVLLGRTDAVVSHTSAARLHGLPV-RRDLDRTVRLTAPDAWRHGRGFRLNRAPLPQDDVLQVPPLRLTSPARTLVDCARREVEDSVVAMDAALLAGRTTPAELRTAAARSWPGGIGAGRALSLTDGRAESPLETRGRLRMVGAGLPAPELQVE. 268
272 5.000e-41UniRef50_UPI00098573B1 hypothetical protein n=1 Tax=Olsenella urininfantis TaxID=1871033 RepID=UPI00098573B1  ali  25  5..ANQRISTLLEEDEAARMLTHARTKADASKLQRLKCAGRLISPHRGLYVRPEAWSALGERDRALHLMRTLSRRHPGWVFCDISAGAAHGLSVPLKSLSRLHILTPAHAPTRSTDEICRHASSARASV-MVDGIRMTTLEETTFDCLRMGLRDGLALADSALRRGLDDWERLADRVVVRHRGLRKALAVLQLADARAESGGESIARATMLELGFQAPRLQVE. 228
273 6.000e-41UniRef50_A0A0M3U933 Uncharacterized protein n=8 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0M3U933_9PSEU  ali  22  10...........DPAGLLHRSTLLGAGLAVDEIDRLVRARVLVPVRRGTYRLGDDEPRSPVHAHLLRARATAPHLAPGSALGHVTAALVLGLPVWNLPLDRVHAVRERSGGRNRHGTSVHRAPLPDDDVRELDGLLVTSPARTLVDLARTPAEQALVTVDAALHQGATTVDELAEVLSRGRVGTPAARRVVALADARSESPGESRSRFRMYLASLPDPATQ... 236
274 6.000e-41UniRef50_A0A1X7KAJ1 Uncharacterized protein n=2 Tax=Corynebacterium pollutisoli TaxID=1610489 RepID=A0A1X7KAJ1_9CORY  ali  19  12MRDWKTAAHLI---------YLPAVRLGDSTIRKAIDAGGYLRLCPEVVVPTHIWNGLKPWEKDEVRIQAVGMSVDKAVLVGRSAARVHGLPVPHGDAYVELNLPGRNRRPPPTGVRYWSAHLGEENVVERNGLRVTDIPRTLVDIARHGVEEAIVTCDAALSLKGATKQMLAKRFDGPVPGIALAREALELADPRSESPLESWGRAQIVTADLPE....... 225
275 6.000e-41UniRef50_UPI000405961B hypothetical protein n=2 Tax=Amycolatopsis halophila TaxID=1069073 RepID=UPI000405961B  ali  19  1......MHDHSAVSAVFTRAHARAAGHSDADIRRLLRRGEWIPLRRGVYATASALAGDDEREHALAAFGTLLALDRDAVAAGTSAARILGLPLLGRAPTD-IVLAIESASGHRDDYVLRTTALPPQHRVRCHGVPITSAARTVVDLARCGFAHGVVAADAALHSGLASQGELIQVLRRGWPGIDGARRAVTFADAACESVLESVSRIAIHQQGLPMPRTQVT. 221
276 6.000e-41UniRef50_UPI000686F79B hypothetical protein n=1 Tax=Nakamurella lactea TaxID=459515 RepID=UPI000686F79B  ali  21  2......................LQAGATDAEIRAALAAGRFTRLATGVYVDTEPYLALTPEERYVVRVHAMAARSPGLIVSHLSAAALHGLPLVRTKLGAVHLTRPGGGGTRTAARRVHVGELPASMRMTLGGIELTTVARTLVDLGRCEPATTVTAADAALQAGTATTDLIAAALLEARAGTPAATRALGCVDGRSESPGESLLRLSMRGRGLPEPELQVE. 205
277 7.000e-41UniRef50_A0A0A0BSZ6 Uncharacterized protein n=1 Tax=Cellulomonas carbonis T26 TaxID=947969 RepID=A0A0A0BSZ6_9CELL  ali  23  2.....................LLARDHPDDDARRRLRDGEWRRLRPGAYVVADTLPTDPFEQLALAHAVAVSRQHRPGVLSHTTAALMWGLPLPGDPGPTHVIRPTTVSGSHADDVVRHLVRLAPDEVTTVAGMPVTTLARTAVDCATLPAGHGLVVVDAA-RRSGVTAEALQRALAGRPRGIRRARAVVEHADDGAESPGESSTRAALIGLGLPRPETQV.. 206
278 7.000e-41UniRef50_A0A2E2L6K6 Uncharacterized protein n=3 Tax=Microbacteriaceae TaxID=85023 RepID=A0A2E2L6K6_9MICO  ali  18  18..RHASLDELLGL--LRSRPALIDEGMSDRSIADAVDAGVLHRIRRGTYIDGAVWASLWPESRHRALVLAVERASRGAVFCGVSAAVLHGLPLYRLAPRRAHVLAAASARHSADDVMRHEGSLAETEVDIVGGLFCTNLERTTYDVIRVSAEASISVADAALRRRFDDRAALHRTEMSGPRGIRQARRIVELADGRAQLPLESVSRLQLHRLGFERAELQV.. 250
279 7.000e-41UniRef50_V8D3M8 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=V8D3M8_9ACTN  ali  22  1MSDHCGVESIDDVNLILRSVQIGTGASTDHALRRATSRGELERVVRGAYCEPQ--PDLTPEQTYLRRVVAVARTRGRRVLSHQSAAVLHEVDTLGRDYGQVHFIVDRGAERGKS-VYLHRGQLLDEDIVEVGSFRVTSMARTVADVACSDFAGALTVVDCGLRRG-VPRAQLEGLAARGSRGIANFRNALGHADEKAETAGESLSRARMIEIGIPLPRLQHE. 223
280 7.000e-41UniRef50_UPI0006A7710F hypothetical protein n=2 Tax=Leucobacter TaxID=55968 RepID=UPI0006A7710F  ali  20  8MREHRERIRFVRRQLALKRNLLAGDEYDERGLSAAVCAGAIVRVLRGCYMRAETWHAMRIDEQLLARTLAVARLRARPLFSHLSAAAIWGIPIYWTSRRVHVTTSPARRGTSSAPVLQHLADVPDEDICEVEGLRVTSLARTVIDLARWPAETAIGCADAGLRRGVTRDQDLGAVTMRGGRGVARARWLLRIADPRADSVAESVSRLHLVRLRVP........ 243
281 7.000e-41UniRef50_UPI000932503B hypothetical protein n=1 Tax=Rhodococcus yunnanensis TaxID=278209 RepID=UPI000932503B  ali  17  4...........DPAHPLRRVDALEAGLTDFQLRLLYTEGGWRRLGYGSYVSSSNYALLSDVARHVLAVDALLPCVDDAVVSHHSAAVLHRLPLTGINLSKVHVTRDRKGGGRSSARSVVHCA-PLEEVEILDGRRVTTQARTVVDMGRTSLDTAVALGDAAVRGGLSHSALLELDRARGRKGIAAARQAIEILDGRSESVGESLSRTRLLTAGFRDLDPQ... 214
282 7.000e-41UniRef50_UPI000371E3CE DUF559 domain-containing protein n=1 Tax=Sporichthya polymorpha TaxID=35751 RepID=UPI000371E3CE  ali  20  28.PRPGAIEPLIPAAR------ARELGYTRDEIERLRVAREWATLRRGIYQRGG--PEPDPRDQHVACAGAALLASPDAVVAHRSAGVLWGLDFLTPPDTVWLAVPELGKVRTYPGLRLWPAQLPADHVTTPGGLPVTTVARTVVDLARHHFRQGVVLAESALRQQLTTKPEIDRVLARGWPYTRRAARALEIADGDTESVGESFTRAVLAEAGL-RPQAQV.. 246
283 8.000e-41UniRef50_UPI000D6BD22C hypothetical protein n=1 Tax=Nocardioides sp. CCTCC AB 2018079 TaxID=2201891 RepID=UPI000D6BD22C  ali  15  2...DPRLLAICVDHGVFLRHEANDLGYRDDTIKKLVDTKAWHRVRRGAYVFGQTWRAADTAERYRLFCLATIRQSVEVIPSHTSAVAFNGGPLWGLNLSVHLTRPDGKTGRSAAGVRQHRGVLLDGDVVDVDGRRVMAPTRALLETTTVAPVEAICVADDFLRRGLTTSEQLRSALMTSWPSTLTTDLVVRLADGLHESVGETRTGYMIWRAGLPRPELQVE. 225
284 8.000e-41UniRef50_UPI0002DCF5FA hypothetical protein n=5 Tax=Nocardia TaxID=1817 RepID=UPI0002DCF5FA  ali  18  1..........MSAAPVHRRPEVLLAGVDDDEIRRRCAGGTWRRVRRGVYAEQATYADLGAAERHRLLIAAVPGLSVAAIVSHQSAAVLYGAPIPTAELGR-VCVTRNRRGGGRVRTDVRVHCARVDRVVEWGGLVVTTPARTIVDLARLPFEAAVVAGDAIARRFGVSALDLEEELAKRRHGCTQAHRVAEFLDPHSASIGESRSRVLFRRLGLPVP...... 210
285 8.000e-41UniRef50_U1XWI7 Uncharacterized protein n=1 Tax=Atopobium sp. oral taxon 810 str. F0209 TaxID=1321773 RepID=U1XWI7_9ACTN  ali  27  5..APQQASTLLDQAELQARCLEPLSKAQGLALFRLKQRGAVVSPLEGLFIRTEAWDQLNPVEKHLHIARALHERHPHWIFCGPTAAAAHGLAINYKFL-HHIHLCHPTDTNRKTGLLTHHRFNPQYPLEFHAGIPVVSLEAAAVQCLCLDFTDGLSIADSTLRATGKSVGWLGAELGHGFRGIKQARITARFANALSENGGESTARAKMIKLGFHIPELQV.. 231
286 8.000e-41UniRef50_K7RPU1 Uncharacterized protein n=3 Tax=Acidipropionibacterium TaxID=1912215 RepID=K7RPU1_ACIA4  ali  19  1......MSHEMDDAAARIRRDLVRNGVGPQALARGVRDGTWTRVRRGACVEGSL--SDDAVVRHCELIAATLLKADSWVLSYTSAAVVLGLPVPYEGLEAWITRPGGRSAHRRQQLMTRVCEFEDDEIITVGGLAVTCPERTAIDMARHGFPDGLMVADAVLRAGGLTKMQELVVRSARRPGNRAAVRSVELASPVPESPGESKMRAHLARLGCPLPELQFT. 221
287 9.000e-41UniRef50_A0A0Q5HUQ3 Uncharacterized protein n=1 Tax=Leifsonia sp. Leaf325 TaxID=1736337 RepID=A0A0Q5HUQ3_9MICO  ali  21  15..................ARALPPESASARTLRRHASTGAMARLRPGAFAPADWWADATSAQRLAARIAAVSRTRHEPVFSHESAALLWGLPIAGRWPDAVDLAVRGTTPRSRGGIRWHRGAIDPEDVVRIGGLWVTGLERTLLDIARREFASAVPALDHGVRAPGAVKARLLEEAEGVRRASRRASVAISFSDARADSPGESISRVNIHRLGFPPPDLQV.. 232
288 1.000e-40UniRef50_A0A0M4QVV0 Uncharacterized protein n=6 Tax=Pseudonocardia TaxID=1847 RepID=A0A0M4QVV0_9PSEU  ali  20  1......MDGPFPEHGVRFRADLRAAGVDDGEIGRAVRRGELVPIRRGAYLDHGDPALVDPRGRHRAAAGAALRLGPGAYASHVSALVLLGIDFWDLPLGRVHVTRDRSHGGRRRDLHVHPSSLPREHRGRAGGLPVTGPARTVVDIARSGVERGLVVADRALRPPPTTPEALARVASAGRTGMPVVRRVLAFADGRSESVGESRSRLAIAVAGLPAPVLQ... 225
289 1.000e-40UniRef50_A0A087A6M8 Uncharacterized protein n=3 Tax=Bifidobacterium callitrichos TaxID=762209 RepID=A0A087A6M8_9BIFI  ali  41  1MKQHKVVNTLIRESEEQRRCLYGGDDAVRRALRRRYSIGELVSPYPNIYARPEYWKGLNACKRSLYVARTLHLMHPKWVFTGLTALDAYGFDHTWRLHGETVMIADNRGRGDRGSYTLRRVFVPTIRASMIAGIPVTDAGRTLVECARVSFIQALPMFDSAIRKGIA-MDDVRAACRGSRSDLTSVLRVLQYANGKCENGGESMVYGVIVSGGYAVPEFQVE. 227
290 1.000e-40UniRef50_UPI00068C1EAF hypothetical protein n=1 Tax=Bifidobacterium crudilactis TaxID=327277 RepID=UPI00068C1EAF  ali  39  1..................................................................MIRSLGAKHPDWVFCSLSAACIYGFEHAYRLHRGLVHIATTGSTNRCHAPQLRPHYIPASHVESLYGIRLTSPLRTVFDCGRYDFVSALPIVDSALARDAVLHDDLIEYCETPKRGRGRARAVARAADPLSENGGESMCRAVIIEQGFQAPELQVE. 161
291 1.000e-40UniRef50_UPI0003B5806F hypothetical protein n=1 Tax=Glaciibacter superstes TaxID=501023 RepID=UPI0003B5806F  ali  22  24...........................DDRPLRRERDAGLRRRIRRGVYADAGRWEALTASERYQARVMAAVRTRHRPVVGYDSAAVMLGYPRMEAWPGVVHLVPSASNARSKNGVMVHREQLEFDEVVEVDGIMVTSPQRTLVDLARVTLSISVAAIDRSFNLERATREQLLDVHDRLRRGRRQASKAIMFANGLADNPGESKSRVVAFELGFPPPELQ... 227
292 1.000e-40UniRef50_A0A0B6TYB5 Uncharacterized protein n=1 Tax=Corynebacterium marinum DSM 44953 TaxID=1224162 RepID=A0A0B6TYB5_9CORY  ali  22  18..........................LTDRAFWENLKGRYYVRLCPEVVVRRDMWEKLPVWQQEEVRVQAVGMSVDRAVLVGRSAARVHGLPVPGRDRFVELNLPRPPRRQWPSGVKYWSGYLPEGQIQVVNGVRVTSIPRTLLDLARHGIEEAIVTFDAALSMQGATKELLLDRFLAPVPGIRKARRALELADGRSESPLESWGRAQIVTAELPE....... 214
293 1.000e-40UniRef50_UPI000833DA54 hypothetical protein n=1 Tax=Microbacterium resistens TaxID=156977 RepID=UPI000833DA54  ali  20  10.................RRAALADVRAVGDRFRSPSVDGALIRIRPGVYVRDDDWDAASPEERVAARAVAVQGSSDGVVVSHESAAALHGLPLLRPDPERVHVILGSERPGTGRGTIRHRGELSAGEVETVHGIRCTSLARTVADVARTSYEQAVVVADAALRRARRLRRAAEQIAERSAHGRARARRVLAFADGRAQLPGESVSRIRLAEIGFRRIRLQVE. 229
294 1.000e-40UniRef50_A0A0Q5S4X0 Uncharacterized protein n=4 Tax=Frigoribacterium TaxID=96492 RepID=A0A0Q5S4X0_9MICO  ali  24  9..................RSFLIRSRFDDPAERRAHARGEHVRVAPGRYVESVAWRGLRREERHALRVAAVGRMRDEVVVSHTSAAAVWGMPVLGPPLARVSTTPARARTHTGAHVTRHAARLPSDEITRHRGLVVTTPARTAVDVALTGTRQAVAVLDHCLRRRLCTLDEYQACLLGRVRGSTRASWVAEFASPLAGSAGESVYRVALDGLGFPAPRLQ... 215
295 1.000e-40UniRef50_A0A0P0SFL3 Uncharacterized protein n=12 Tax=Actinobacteria TaxID=201174 RepID=A0A0P0SFL3_9PSEU  ali  20  3..............ELHLRRRLLAEGRTDEEVRSAIGRGTLWRVRPGAYLDADDPRRRSAVECHRLLVEATLLLGPGAVVSGLSAAVLQDLPVWGVQLRRVHVTRDRSGGGRSARVCLSAAPLPDGDVTTVGGVPVTSAARTVVDVARTPFETSVPIADAALFRGLCTEVEVADAVGRAAGRRGAGPAVAAFADGRADGPGESRSRVRMQVQGVPAPRLQH.. 214
296 1.000e-40UniRef50_UPI000691B333 hypothetical protein n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI000691B333  ali  18  4..................RASAVRLGFDDGELARLVRSKQLDRLQRGAYIDPHADRAARAR---AVIVATVAGLRLPGAVSHGSAAVLHGLPTWRVSARVHVTRTPPASGASSRRVHLHVARLGAEETTVVDGVLTTDVTRTVVDLARLTFESAVVTADAALALGSTTAAQLDDALRRGAPGTRRAARVIAFADRRSESVGESRSRVLIHRIGLTAPDLQVE. 208
297 1.000e-40UniRef50_UPI000931DD5A hypothetical protein n=2 Tax=Olsenella TaxID=133925 RepID=UPI000931DD5A  ali  30  7....RRIARELARAEAAGSCLCPTSRADRAALERRLGHRRIISPMPGLYVRWAHWRLLKQPARCLHLMRGLAALHPDWVFCGPSAAMVHGLSVSWSELRRVHVICGPRDGRRLSG-RIVRHQIEGEEPQVVAGLRVTSALRAAFDCMSMDFPDALAIADSVLRLRNTTLMSLMRRDFRGRRGIARVLATCCWADPRPENGGESVARAIMIERGVALPALQVE. 233
298 1.000e-40UniRef50_A0A087DF18 CTP synthase n=4 Tax=Bifidobacterium TaxID=1678 RepID=A0A087DF18_9BIFI  ali  42  1...............................................................MRHIIRALSQQFPNRIFAGISAAAMMHLDYNWKLHDGTIFIAGKTGNSKQTYRKLRRIIVADPPTDIINAVTITSPARTLVDCGRYSFAQSLSLFDSAMRQGLTTTELIIDICDDMQIDCGRIFRLLYYMSPLSENGGESLCRAVIIEAGFAVPQLQ... 189
299 2.000e-40UniRef50_A0A1Y4AFN9 Uncharacterized protein n=1 Tax=Collinsella sp. An307 TaxID=1965630 RepID=A0A1Y4AFN9_9ACTN  ali  30  6...NHEIDQLFCDAERRQRLVRVSSNRLGAALARRLKAGYVIRPARSLYARVTYWEALTPIEQAWHLIRSIHDAQPHWVFCGETAALIHGMPVSYSRALP-IHVADGPHARPRTSGVIAHHALPCDNPVLVNGIPVTSLARTLCDCLALPFGDALAYADAALRVSKRSIEELREALPLRPRGVRRAAGILGYADARSESWAESVVRATILSQGFALPELQVT. 227
300 2.000e-40UniRef50_A0A1Q3ZZI0 Uncharacterized protein n=1 Tax=Micrococcales bacterium 72-143 TaxID=1895790 RepID=A0A1Q3ZZI0_9MICO  ali  18  27..............................RIRGLVRDGALLRLVQGVYYPARLWEAENPRERHRTLARAVLLRGRRLVMSHRTAAVLWGLPLLGEPPADVHVVAHRANGGRSDDRLVRHCLDIPEKTAEIDGLEVTLLERTAIDVARTSFAEAVMVADAVLARGVPRSAFVGELPPPGSRGVKRARDVVDFAAAEAGSPMESLSRVSIHEAGLPAALLQQE. 220
301 2.000e-40UniRef50_D0L4D5 Uncharacterized protein n=4 Tax=Gordonia TaxID=79255 RepID=D0L4D5_GORB4  ali  20  7...........DTHGLIHRTTLINIGFTDDDIRRAVKAKRIGRIARGVFVYAG---ERTAEEWHRLKALASRIGQASKVLTHQSAATVLGLAMLKPNLRRVHTTAGRGHGFRTDRQHCHVAELADDQIILVSGVWVTSIERTAVDVACTTFAEALTIFDSALRAG-ADREVMRAMLSGRRRGIGRARRALYYADGASESPGESWSRAQMIEAGLPMPRLQ... 214
302 2.000e-40UniRef50_A0A1H0SZZ2 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=5 Tax=Arthrobacter TaxID=1663 RepID=A0A1H0SZZ2_9MICC  ali  21  71...................SDLARLGQDARGLARQAKSGQLRRIRQGVYVRAQDWESLTPWDRYPVLIRAAASTLSRTIFCRQSSAALWDMPLLGRCHLVHACTFDDGGGRSRAGVRRHFVDLDSAQIEERHGLLVTDRVRTALDLAAFSFEQGVTVFDHVLRLAPLGREELHAGIDGTRAAARRIRTALDFADPASGSPGESVSRALMHRLGFRIPLLQVE. 282
303 2.000e-40UniRef50_A0A0Q5RZ09 Uncharacterized protein n=1 Tax=Frigoribacterium sp. Leaf186 TaxID=1736293 RepID=A0A0Q5RZ09_9MICO  ali  19  13..............ELLTSSALVRSGLDDRHLRHAADRGRLTRVSRGVYLDTTRWGDLEPEDQHALRVNVLLRSSARLVASHSAAAVVWGLPLLHRPPPEVHVIDPGRRTNSRSTTMVRHAPLHEDEHVARDGLAVTSPARTAVDLALHGLHAGLMAYDHGLREGLFRRDDLERCLAGRRRSPRRADLCLQLADEGSMTPIESVSAATLHLLGLPRPVRQ... 223
304 2.000e-40UniRef50_A0A1Y6FE92 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Agreia sp. VKM Ac-1783 TaxID=1938889 RepID=A0A1Y6FE92_9MICO  ali  23  24...........................EARQVRRDHRSGTSTQLHRGVYAETERVNSLTPRARHLAQIHAIVETRRRPIIGHLSAAVFWGMPIPSMPSTVHMVVPPSSGAHSKNGVTVHKEHLSDGDVLEVGGLLVTSPMRTLIDLARSPFVTAVTALDFALHKKRSTLSAVVESVDALGRGYSRARRAVQFSRSGADNAGETHSRIVIAELGFPSPELQV.. 228
305 2.000e-40UniRef50_A4E727 Uncharacterized protein n=10 Tax=Collinsella TaxID=102106 RepID=A4E727_9ACTN  ali  22  13.KSQAELFFRLFEAHHGGHLFVATKKWDERCAYALMQKEMIIRLYNHVYADPAYWNGLGVEDRIFQLASAIAVVEPDAVFCGATAALLYGIGSAYSLLDRVQVLL-PRSTRRDMYEFVEYRRWRPGDVWQLGPFTLTDPYRTVVDIARTSFRYALGYVDGLAREYGVEREELRAYAQRGLHGIARAFDVFEHMDGRSDNGGESEARAAMILAGVAAPELQVE. 236
306 2.000e-40UniRef50_A0A022L8S7 Uncharacterized protein n=16 Tax=Dietzia TaxID=37914 RepID=A0A022L8S7_9ACTN  ali  23  14...................SELLARGYSRRAREHAERTGQLYRVRHGVYVPAADLPTGPDEAEAMLEMRSRASARPGTVMSHTSALVLHGLPAQDLDTRRVTTTRHRPGSGSRRGENAICHSLDLGDVTELEGIPVTTPARTIVDVARTPFAGAVCAADEALRRTLCTLAELENELAAGRVGIARARAVVAFANPGAHSVLESLSRVAITRAGLPMPQLQHE. 223
307 2.000e-40UniRef50_M3TD13 Uncharacterized protein n=6 Tax=Gordonia TaxID=79255 RepID=M3TD13_9ACTN  ali  23  5...........DQHGIVQRDAALARGISPRRVDDAVRSGALILLARGRYLPREAIADAPRDELYRYRSIASALGSGRPVLSHDSAAAVLGLKLLYPDQKVHVTNGRGSGGSRRPQRMVHAGLLPDDDLVDVDGVLVTGPARTAVDLATATFPQALTAFDAALAVG-VDREDLRRRLATSRRGVGLARRALLFADGRAESPGESWSRAQMIEAELPVPDLQVE. 219
308 2.000e-40UniRef50_UPI00025C53C0 hypothetical protein n=1 Tax=Bifidobacterium animalis TaxID=28025 RepID=UPI00025C53C0  ali  29  1MRVNIAMNQFLDEAQQQRRCAVMPTRAVHQALLRRVRTGEIVSPMRGLYARASYWKSLDTVERNRHVVRAKSRQHPEWVFGGLEAVCMHGLDHDYALHSSNLTVLSPTHAQAKPVHGITHICMPNCNYAVIDGVKVLPLAQTVAMGLRSDFVNGMQIANCALRHGL-TKQEIGDCMSRLGNCGASAWRVLEYGSDRCENGGESRAYGVMLDEGVAPPLLQ... 220
309 2.000e-40UniRef50_A0A255H737 Uncharacterized protein n=6 Tax=unclassified Propionibacteriaceae TaxID=185283 RepID=A0A255H737_9ACTN  ali  20  6................FTTEQLTEMGWNTEKIRSAVRGGEFVRIRNGFYRPRQDWTPEDYQLRHRCLIQAAAVISDDTVLSHRSAAVLHGLPLPPGLLRRVDLLRDGDGARRTPTAHHRRAPLPTDDRTVIEGLPVTGLARTVADLIRLPFRDALAVLDVGLARG-VTAAELGVRLKRRAIGNPQARQLLELGDEASESPGESRCRATMALAGIPRPVCQF.. 220
310 3.000e-40UniRef50_A0A0N9NDG0 Uncharacterized protein n=4 Tax=Gordonia TaxID=79255 RepID=A0A0N9NDG0_9ACTN  ali  25  5...........DSIGLVRRSRALDVGITDLQLKQALRDGELTVADRGKYAITALLPPVDDDELYRLCIAAALDDQCRLALSHESAAAVLGMATLRPSRDVVHFSSPASTGGRKLRTRHVHTGLPAGSTMVVAGIEVTTPARTAIDIAARGFAAGLAACDSALRMGVTVDELLDELGKRRVRGAADARAAIQYADGRSANPYESWGRAQIIRAGLPVPDLQ... 222
311 3.000e-40UniRef50_UPI00076112A6 hypothetical protein n=1 Tax=Pseudonocardia sp. HH130629-09 TaxID=1641402 RepID=UPI00076112A6  ali  19  9...........DAHGLVRRSRLREQGFSDDEIDALRRSGVLTGVRRGVHRLTDGGGPDSAVVDHALRARAAAGLSPEAVFDHVTAAVLLGLPVWAVPLARHVLRSRPTGARTRGDLVVHSGALASDDVVEVDGLRLTGPARTVVDLARLPAEQALVVADGALHAGATSPDDITSALARGTTGVGTARRTLALVDPASESPGETRSRLRMHLSGLPTPVTQ... 234
312 3.000e-40UniRef50_A0A1R4ELL7 Uncharacterized protein n=1 Tax=Frigoribacterium sp. JB110 TaxID=1434829 RepID=A0A1R4ELL7_9MICO  ali  22  1..........MSELLTHSRSDLTRSGLSDRALREALRSGRLLRIRNGHFVDARTWESAHPEQREVAAARAAQRDHGRHVFSHATAAALHGLPLFRHSPGKPHVMIGNDTLSGTSPGVARHHDLWDGETTERDGLLVTTLARTTFDVLRTCRAEAVACIDAAMRRIALRRDEVIRLIATGKRGVKQARELIAFADPRAESPGESVSRMYLARLGYERVELQV.. 228
313 3.000e-40UniRef50_UPI00036C1364 hypothetical protein n=1 Tax=Kribbella catacumbae TaxID=460086 RepID=UPI00036C1364  ali  17  15...NKKLERVVDERGGFSRADALEAGYTLSEIRLRLHRRQWERLCRDAYVETAGWPADSPWERHGLLARAVGRMAGQAVVSHQSATLLHGLPAWGLDHSQVHITKFTGRARSDRAVRVHRAALRADEIDEALGLRLTSPARAIVETTCTSYEVGVVLSDAALRAGLVTSEQLTATARRHWPGSPAAQAATAFADGSSESVGESRLRVLMANEGLPAPRPQVE. 243
314 3.000e-40UniRef50_A0A1I4Y2K1 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=6 Tax=Pseudonocardia TaxID=1847 RepID=A0A1I4Y2K1_9PSEU  ali  19  3..............ELHLRRALLAEGRTDEEVRSALGRGTLVRVRPGAYLDADDPRRRSAVERHRLLVEATLLLGPGAVVSGPSAAVLHDLPLWGVSLRRVHVTRDRAGGGRSARLHLSAAPLPDGDVTTVGRIPVTTVARTVVDMARTPFETAVTVADAALFRELCTEADLADAAGRATGRRGAGRARAVFADGRADGPGESRSRVRMRALGVAAPVLQH.. 214
315 3.000e-40UniRef50_A0A1H9LVY2 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=4 Tax=Friedmanniella flava TaxID=1036181 RepID=A0A1H9LVY2_9ACTN :  ali  18  18.........LRANGGVFSRAEVLALGENDRSLASAVRSGELVRLRQGAYVRAVDVGTQDERGRHLLLARAVARQRGRVALAGPSAALLHGFSVWGHDLAKVHVVRLDRGAGRREAGVVHHLAAPGDGLELCEGLLTVSARDAAWQTALASLEAAVVALDSALHLRPELVGPLHELAERRHPHSRRARLALGLADGRAESPGESLTRMACYRHGIPRPELQHE. 235
316 4.000e-40UniRef50_A0A2P2CBC6 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A2P2CBC6_9ZZZZ  ali  16  3....ARLRVLVAEHGVFSRKEALAAGYHDHAIAGLVRSGAWVRVRRGAYVFGDGWVGLTDNQRYAVLCRAAVRAQTRVVLSHTSSANEYGAPLWECDLTTVHLTRPDRAGRAEAGIVQHRGVIVDGDVILRNGHEVMSATRTALELLSHDVEHALVEIDYLLHQGFTTLDKLRARYDSHWPCSLTTDLVLRLADGRSESVGETRARFLCWAQHLPAPIP.... 222
317 4.000e-40UniRef50_UPI00082495E5 hypothetical protein n=1 Tax=Gordonia hydrophobica TaxID=40516 RepID=UPI00082495E5  ali  20  6...........DSIGLIHRDRALDVGITDLQVKQAVRRGELTAVDRGRYAITDVLPAVDVHGRYRLKCLGAARDESRFPLSHESAAAVLGLATLLPDLGVVHFSTPSSSGGRKLRTRHLHTGLPANSTMEAEGVEVTNPARTAVDIATRGFAAGLAACDSALRMG-VPVDELYAELGRRLSGASTALSAIKHADGRSANPYESWGRAQIIQAGLPVPDLQ... 222
318 4.000e-40UniRef50_A0A166NTB4 Uncharacterized protein n=8 Tax=Dietzia TaxID=37914 RepID=A0A166NTB4_9ACTN  ali  19  18...................ADLARGGLTHADIARLIANGELRRVRTGVYAHAADDAGPDGRVFVERTAAAARAVEPGTVFSHASALALHGLPLHGMVLDRPTATRHRAGGGSRRSSALIVANLPLDGVVMLDGIPVTSPARTIVDVARTGLESGVCAADQAIRRGLCTRFDLEAEAAKGRTGVSRARALPERTSGLAESVLETLIRLILVMAGLPEPELQV.. 235
319 4.000e-40UniRef50_A0A087BER7 Uncharacterized protein n=2 Tax=Bifidobacterium magnum TaxID=1692 RepID=A0A087BER7_9BIFI  ali  30  1MRPYPQIITALEEARHDRRCAIANSAKLQSAVHRREQTGELVCPLPHLFCETQSWARLTPSQQVQYMAKALCILDADLIFAGPTAAQLYGWEVPFSAHRRGLFTVCSSAHPASRAWRVIPIASDGEHIDERNGCHVTQAARTLVDCALLPFVLALVVWDSAFRLTQVSATDVLRAGQRLRGARERIDRLLEYTDPRSDNGGESFTRAVMIEQGFQIPELQV.. 231
320 4.000e-40UniRef50_A0A1G8BHR9 Uncharacterized protein n=1 Tax=Agrococcus jejuensis TaxID=399736 RepID=A0A1G8BHR9_9MICO  ali  24  22....................................RSRALRQIRRGSYVDATAQDSAGVEDRYRARVRAVGIARPRIVFALESAAMLHGLP-FGTEPRYVFSTGDPSMSGGRAGVRNSHLPIRPEHVVEVDGLRCSSVAWTLADLGRRRPSDGIPAMDAALATGVVTKPDIRALLHQSKQGRVRARWSIAFADARSESVGESRSRVAIALLGFPVPQLQV.. 207
321 4.000e-40UniRef50_A0A2S5VYU6 Uncharacterized protein n=1 Tax=Subtercola sp. Z020 TaxID=2080582 RepID=A0A2S5VYU6_9MICO  ali  19  7...........ASGELLLSRDAHFLDSESDSLRRAAASGRLTRLRRGVYTDSASWSAASPRDRYVRRIHAVVATREPCVVARQSAAALWSFPRINRWPEDVHLIPVPPGGRSRNGVRHHAEAMPDTDVAELLGLRVTSRLRTLVDLARFDSAEAVAALDHSLNHPVVTQDALLEQLVGSSRGAARAARAIHFADGGAGSPGESYSRLLIRQLGFAPPQLQVE. 228
322 5.000e-40UniRef50_A0A174DY00 Uncharacterized protein n=1 Tax=Collinsella aerofaciens TaxID=74426 RepID=A0A174DY00_9ACTN  ali  26  1MRARQRIEEQLDGAERLQRCLVPKTRADREALRRAVAAGVAVRPFSGMFMRASTWNALSPRVRWRYVQNTFLDEHPDEAVCSFSAALDHGLWVSKKYLDTIHLVASGRSHG-RCGTGIHRHECPLNEIELNGTVKRTTLERTVLDCSLVSFEDGLAIADSALRFCKLDIRDYVEALARCRSGAFCAEMVARYADGASESGGESIVRGLIVALGYLPPTLQAE. 231
323 6.000e-40UniRef50_A0A2V4PFZ1 Uncharacterized protein n=1 Tax=Microbacterium esteraromaticum TaxID=57043 RepID=A0A2V4PFZ1_9MICO  ali  23  1..........................MTERQLQQDLSAGRLIRVHRGSYVSTDHWKALWWEGQHLLKVLAVASAGDGPVFTHASAAVVWGLPMFRMGARPVQTLLETKRHSRTADIVRRDMRVDPIDIVELDGIRLTSRRRTVFDIARTSFASSLCCADADLRRVAVDREDVMQLAAPGLRGVRQARRIIEFADGRAQLPGESVSRARLRTLGFSRYDLQV.. 211
324 6.000e-40UniRef50_A0A0F0L7E5 Uncharacterized protein n=10 Tax=Micrococcales TaxID=85006 RepID=A0A0F0L7E5_9MICO  ali  15  2..RHATVDEIADILISSRR--LNAEGWTSRTLRSAIDARRLHRVRRGWFVEHVRWVSLSPESRHRAEVVAAALSSAGPIFSHASAAVLWGLPLYRLRPERVHVLTPPDHRHSTQGILRHEGALPDSDIVELDGIRCTSLARTVFDVVRTPWDYDENAADALL------GELAIRAGRPGARGILQARRIVELADGRAQLPLESVTRYRLHQLGFARPRLQV.. 234
325 6.000e-40UniRef50_V9XHL4 Uncharacterized protein n=22 Tax=Nocardiaceae TaxID=85025 RepID=V9XHL4_9NOCA  ali  17  3..............ELILRREANARGVTDAEIRRLVRNGTWTRLASGVFVQSDQYAGADDHARHALRARAFIAAGPTSALSHVSAAVLHGLDVWQIPLDDVHLTRAPSGARRTPGRAMHAALFREADVVDRRGARVLSVARTITDVAATPVEQAVVLADSALRTGLVASDELTRSVERMHPRIAHARRAVQLSSGCSDSAGESRSRVLFVREQIPMPLTQV.. 214
326 6.000e-40UniRef50_K6WC07 Uncharacterized protein n=1 Tax=Gordonia rhizosphera NBRC 16068 TaxID=1108045 RepID=K6WC07_9ACTN  ali  17  27..............RLVHRADARAAGITDDELRRDVKNKVTERVWRGVYLPTGTGARTARLDRYRATVIGAARHGPERTASHVSTAAMQRVPLLWPDLSKVHFT-SATTGKSTGRAVIHQSALEPDDIVVIDDIRVTSPARTVYDVARTGLRRAVCALDSGLHLG-ATPDELAAHAQKRHRGVAMLRAALPLANGLSESVGESLSRLVLAENELPTPELQVE. 244
327 7.000e-40UniRef50_A0A1G6H5I7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6H5I7_9ACTN  ali  19  18.KTASRRTSDLPSGRLLTPRTVAPLGLTAHELRSAHRLGQMVRLRRGVYAKTA---DLDPVQRHHLRILAADLLDESAVLSHVSAAVWRGLDVPWAIDDRVHVTRGIAGGSIRERLATHTGQVPDDQWTVIDGLRVTTVARTVVDLARVSEVPAVALADRVLRQDGADRTEMQRILGQGRRGVGQARWVVGFADPRAESGGESVSRVVLESLGVPTPELQFE. 242
328 7.000e-40UniRef50_D0L478 Uncharacterized protein n=3 Tax=Gordonia TaxID=79255 RepID=D0L478_GORB4  ali  17  4..........FDADDLVFRADTLSSGRTDGDLRRDVRDGVAQRIWRGVYLPARDGAHGYEAEKYRATIRAAALSGGDRVISHASALAVQRIPMLRPDLSKVHFTAEGSGKTTKRAVI--HQASLDGDVIEVDGLSVTTLPRSTCDHARMGLEQAVCVLDAGMHAG-VTEDQLAQQMARMRRGHRIARAAIPLADGLAESVGESLSRLVMVRHPLPAPDLQV.. 218
329 8.000e-40UniRef50_C8XJN0 Uncharacterized protein n=1 Tax=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-10  ali  23  7...........DDGEIVSRTALLDRGLSDGQIRRARERGELVALLPGLYLRGEGPVRLDPASRHRARLTTVACLAGEPVVSHVSAAIVHGLPFGHSEPPLHVTRWEPGRARPGAPVRVHRAALEPAEVVDLGGVRVTSPERTVVDCALLPFDHAVVVADAALRRGLVTRRSLQDQLADRVPGRRRAGAVLAFADPRSRGPGESFSRVLLHRWGFAVADL.... 219
330 9.000e-40UniRef50_E8N6R6 Uncharacterized protein n=9 Tax=Microbacterium TaxID=33882 RepID=E8N6R6_MICTS  ali  20  30....................................RDPDLHRVRPGVYTEREGWEALPPWDRYLLRVHAFRLVNAGAVFSHESAAALHGLPIFG--HPRHIHLFDGRRARSVAGDVRVHTSADSRRAVEHSGIRCSPLADVVVDLARLPPALGLAVTDAALRTGAIASIELLAAAQRNPRGRRKLDWVLARGDARSESVGESVSRAVIQWCGFPAVDLQTE. 217
331 9.000e-40UniRef50_G1WKP2 Uncharacterized protein n=1 Tax=Collinsella tanakaei YIT 12063 TaxID=742742 RepID=G1WKP2_9ACTN  ali  27  13..........IADAFSSGKLYTPKTDSERQGLKRRVLKGTVATPYKGLYALTEQWLDMEKPQQYKMIIKTLAELYPNWVFCSFSAAVLHGLEVPFT-EMNLIHIAATCSRRTND---LVYHHMKIDSPENVDGVKCDSIDGTVLECVRSDFRYALAVADSSLRLLRRNAKEMIERIETGRHGIAYVKEVFGHANSRAENGGESYARAVMIENGVMLPKLQVE. 224
332 1.000e-39UniRef50_A0JZP5 Uncharacterized protein n=52 Tax=Micrococcaceae TaxID=1268 RepID=A0JZP5_ARTS2  ali  21  16.PRRWHLERMNDLPTLLLARDRLLHGLTAKDLARRAASGALVRIRHGVYVDGPAWRELVPWEQYRLRVQAAAETHHSPVFARHSAASVWKIPTMGVRHPVQALTLKNDGGRSRAGVRRYFADPSGLTVVRREGLLVTDRIRTVLDLAATPFTEAAVPLDHVLGLRALTLDNLTAGIGSNYTGARRIRAALSFADPLSGSAGESYSRSLMHVAGFEPPVLQ... 244
333 1.000e-39UniRef50_A0A255H7D0 Uncharacterized protein n=1 Tax=Propionibacteriaceae bacterium NML 130396 TaxID=2016507 RepID=A0A255H7D0_9ACTN  ali  20  5..................RREYLDRGHSPTELAASVRRGQLVRLRRGGYAEPNPLA--TPEQRHRELELTLPSLGSGSVLSHATAGVLHGLWLPANQLRRVHVCRDGKGGASVTRHLHVHRPDPESSTVPVGELRMTDLLGTTVALLRLPIADAVGVADSALRQGLDPDELLAAIAARKRPGNRLARRAAEFADPLSESRGESWSRWQMCQLGIAAPGLQHE. 211
334 1.000e-39UniRef50_UPI00068278EC hypothetical protein n=1 Tax=Luteipulveratus halotolerans TaxID=1631356 RepID=UPI00068278EC  ali  20  2........ATFDATTLQLCGDLRRTGIEPTRALDPTGAASYVSVGHGVCMPATRWHGMDDRDRHRALVHAHARADERPVFAHESAAALWGLPLLNAWPEQVHTVVPARSRRKSSTRVRRHHTTRLGAV-ERDGLQVTPAARTVVDVARTDLAAGLVCADAALRRSLCSRQDLEAEVAARLRGRRVAKLVVALADPLSESAGESLSRAQMFLLRLPRPHLQVE. 221
335 1.000e-39UniRef50_A0A2A9D1Y5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Serinibacter salmoneus TaxID=556530 RepID=A0A2A9D1Y5_9MICO  ali  20  2........DLINDGEPFRSGDAAGLGLTRYRCERLVRTGSLRRVVRGVLVDGGVPDSRELRARALALV-----LPPDAIVSDHSAAWIYGVDTFPPGERPHCLVRHGKGRPAATRAIVRQTTVPDPDVVLIGGIPVTSPLRTCVDLLRLWRPYALAAGDAMVRSGVVTPEDVAVSVSRRLPGTKQAMELAPRLNPLAESHGESWMRCRILDAGLPNPELQV.. 216
336 1.000e-39UniRef50_D1NTA1 Uncharacterized protein n=2 Tax=Bifidobacterium gallicum DSM 20093 = LMG 11596 TaxID=561180 RepID=D1NTA1_9BIFI  ali  29  1..........MGEAQEAGRC-LITSGEVRRTVRDRTATGEFTQIMPGIYYPTDAWNQLSVQGQTLMLLRSLQIQHPQWVFTGMHAAMLHNLYYSTLVLGKRIHILTTRGTGPADRTHVKRHHVAAIEYEEIQGIKVATGARTVVDCANYEFRDALGVADSYLRSGGYFADIYAAANDHCTP---QLVDVLRYTDQASESGGESFSRGTMIEMGYVVPLLQV.. 209
337 2.000e-39UniRef50_A0A2D9NUH8 Uncharacterized protein n=4 Tax=Microbacterium TaxID=33882 RepID=A0A2D9NUH8_9MICO  ali  22  20.................................RLRTEPAWVRVRRGVYAPRAAWEALAPWERYLARVHAASAQHPGALFAFESAAALHGLPIFGEPRDVHLIDDAGGKSRRYGDLVIHSTRRPP-HAADLGTVWATGIRDTALGLARLPPAYGLAVVDAGLRRVGETAARWLAVAQGHQRGSRRARWVLDRATPRSESVGESVSRAVIEWLGFPDPELQV.. 209
338 2.000e-39UniRef50_UPI0004257E69 hypothetical protein n=1 Tax=Amycolatopsis halophila TaxID=1069073 RepID=UPI0004257E69  ali  19  31...........ASSGLFTAAQVRAAGCDKAAIRRALRTGMWVALRRGVYVEASRLTAVAAERRHALDVAAVLVLGLDAVAGGESAARILGLDLLNPATSEPVLVTDTARGTHRNGYVLRTAALPGNHRAIRHGVPITSAARTAVDLARTSFAEGVVVADSALRQGLVTVDQLRDVTCWTWSGIARARQVVDFADPRAESVLESLSRVAIHAQNLPAPRTQVT. 248
339 2.000e-39UniRef50_L7L8N5 Uncharacterized protein n=2 Tax=Gordonia TaxID=79255 RepID=L7L8N5_9ACTN  ali  18  1......MVLPIDGHGLTWRRKALDSGYSEKDLAELIGSKQLLRVGRGIYVTADRVADRYPEELYRLKCAAVTRAEKPFVLSHQSAAAVLRLPVLNPDRTQVHVVKSGQGRGCRRSTRHVHVAPTAGALVVVDGVEVTNRVRTAVDVASASFAQALAVFDAALHA-HVTREQLEKVLERRRRGIAVAKYALAMADGRAANPGESWSRAQMIRAGLPLPDLQHE. 223
340 2.000e-39UniRef50_A0A1Y6FG79 Uncharacterized protein n=1 Tax=Plantibacter elymi TaxID=199708 RepID=A0A1Y6FG79_9MICO  ali  18  11...........RRGGLVLTADLNDLGVTTQQIRDGIHLGVLACVRRGVFVRAARWEALRPEERHRELVRSIHTSGRDLTVCRRSAAVMHGLPVFGTIPDRVHAIDPDAAGGSSNRLASHRGEPDDPDAIVIDGVRVTSLARTVIDLAHSPMLSSVPALDQALRTGRPEPGQLIELLDAPRRGRRRAIDAIGFADADSMSVGESVSRVQMHRLGFAAPELQH.. 235
341 2.000e-39UniRef50_UPI00041CBF18 hypothetical protein n=1 Tax=Granulicoccus phenolivorans TaxID=266854 RepID=UPI00041CBF18  ali  21  29....................DLFTRGYTHAAIRRAVAKGTLVRLRPSDTLPIPQWPDGEAELRHRYLLRAALPFAPGTVASHHSAAILHGLPMPNRILGKVSMLRPGSGQGTTSTRQLRRAALPASDIVEIGGIPATSLPRTVIDVARLPFADAVPVVDAALHAPDLLRSTLLAQLAHRQSGNAAARRAVLFADSRAESPGESRCRAAFELAGLPIPELQFE. 243
342 2.000e-39UniRef50_A0A1Y3M7X6 Uncharacterized protein n=5 Tax=Arthrobacter TaxID=1663 RepID=A0A1Y3M7X6_9MICC  ali  21  17...................RELFDEGLTRRDVQHFLADGDLRRLRKNCYVTEAHWASLTAVERLALRAEAHHHSLVGHVYSHETAAVLHGLELWRPGADVHVTQPTRSNSSHGPDVRNHSAELTDDDVVLLRGLPTTSLQRTAVDCARLSFDQALIVVDQ-CRARGVDRAGALTALDLLGPGAARARDVIVASDPSSESPGESLARIRLRRLGLPAAQCQVE. 227
343 2.000e-39UniRef50_A0A0Q7Z485 Uncharacterized protein n=4 Tax=Nocardioides TaxID=1839 RepID=A0A0Q7Z485_9ACTN  ali  18  1MRPDLAIHANL-QHGLVTRIQAMAAGYTERELRTLTHGGAWVTVRRGVYVARNTWESLDDREPRLRVLAAHLTMNRPHAVSHRSAGLLHGLPMLEVDDTLVHVTRPGVTGSRTHGVKHHLAHFAPDQVVDLNGVHVLDLARTAVDIGRHGYRHGLVACDSAMQLG-ATKNELWTAVDAHWPHVVRSRSAVQDSDSGAESVGETLARELVQSLGLGPVQTQFS. 227
344 2.000e-39UniRef50_A0A255G212 Uncharacterized protein n=10 Tax=unclassified Propionibacteriaceae TaxID=185283 RepID=A0A255G212_9ACTN  ali  19  3................ETTEQLLARGWSYAEIRQRVRDGALHRLARGSYSDQN-PARLNPDERHLQLVTGLGGLTEGSVLSHASAGVLHGLWLPVEQLTRVHVARPG--ARDSQGRRVHIHPLPECAVVDPVQRLGSEPARTLALVSTLELPAAVAVADSALRQGLDRQAALDVVSGWPRPGRRRARLALEFANERSESAGESRSRWLMHELGLPAPVLQQE. 214
345 2.000e-39UniRef50_UPI000407CFA8 hypothetical protein n=1 Tax=Microbacterium gubbeenense TaxID=159896 RepID=UPI000407CFA8  ali  20  19....................ALIRRAESGTRFDHAVRVGRLHRIRSGVYVDTDGWEALPPWSRYLARIHAFAMKSPHTVFMHESAAALWGLPTLGMPYHLH-ARAKRSGGSRRTGDIQWHHTSDEPDVVVEPGIAATSPSDTIVDLARHHPVIARAAADALVRRSGMSPDVLLATNDERRRGRAAARWPLATATPLAETALESASLCVIEWLGFERPELQVE. 222
346 2.000e-39UniRef50_A0A2M8WVH5 Uncharacterized protein n=1 Tax=Luteimicrobium subarcticum TaxID=620910 RepID=A0A2M8WVH5_9MICO  ali  22  48..............ELVLTRDAGTTGGAPRTLVRAHAAGELVRVRRGAYVGTTVWEAATAEERHALRACAATALFPGVVLSHQSAAVAWGVPRTDGWDEVAHVCAGAASGGRSTSQLVQHTFGGELEVVARGSARCVGAERTVVDLALTDFASALASADWALRVGLAGHDGLARVLSGHAAGRARAERVLAHADGRSGSVGESVSRARMLELGLPRPQLQVE. 259
347 2.000e-39UniRef50_A0A2A2EGF9 CTP synthase (UTP-ammonia lyase) n=10 Tax=Bifidobacterium TaxID=1678 RepID=A0A2A2EGF9_9BIFI  ali  30  1MRTNTEITQLLDEAQQHNLCATSTDNNQRRKFARRVACGELITPHPRMYVRPEFWENLNPTQRKRAVVQTLAILHPNVVFAAESAMCMFDVEQPYDIHPEEITVASTSHSGTHSGTIRHTVCMRNLPTVTIEGVVVTSFARTLFDCARLPFELALPMADAAAR-KNFDVSLITQFPVSSVDEANKVARVVSGTDARSENGGESRARAVMENGGFMRPHLQYT. 227
348 2.000e-39UniRef50_A0A0Q5QU37 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q5QU37_9ACTN  ali  20  9...........DSSGLIRRRDVIAAGVDDWSLAAATRDGDLDRLYRGVYALSSDSSHAALDERYLSRVHAAVSMGPGKVVSHHSAAALHRLPTLGRTDALHFSVNRRSGGRRKRAFVLHATPWEPDEVTMVDGIAVTSMARTAIDVSRSGFVEAVTVLDGTLRRS-VSPEELLAVSDRGRRGAPVARRALAIADGRSESVGESVSRALMRGFDVPVPDLQV.. 225
349 2.000e-39UniRef50_UPI000C835708 hypothetical protein n=1 Tax=Collinsella provencensis TaxID=1937461 RepID=UPI000C835708  ali  28  6...DDELIILFEQAESNHMCLVPPTQRLRDALNRRMNSYMIVRPYSGIYARRDKWDALDPTQQTIHAARALYTKHPTWVFADVTAATIRGWNVSYALLEEIHL----GSTYHRRANAVVSRTSKQVEHELVDGLPVTSAEQTLFDCLRTDLRLSLPVVDSALRQLNLSAKEAVTWLEQGRAYFKRVLDTVKLADPRSESGGESVARATMIALGFAMPELQVE. 230
350 2.000e-39UniRef50_A0A1R1LLD3 Uncharacterized protein n=2 Tax=Tersicoccus TaxID=1418588 RepID=A0A1R1LLD3_9MICC  ali  18  14...........HELGVRTTTQLAQAGYTSNRLERLVAGGSLVRIWRGHYVSASAWNALTTDERHAALLTCAQGSAADGVLCRGSAALAHGVSLLRADPTVHLLCPTPRSTQRHAGVRLHACDEEPDVVVLANGLRTTGALRTLTDCSRLPHRDALVIADQFAATG-VDLAAVRAWAASGWRGVARLRLVLDRVDPLAESAGETLTRIRLHEWAVPLPVSQYE. 229
351 3.000e-39UniRef50_A0A0S9PFK7 Uncharacterized protein n=2 Tax=Agreia TaxID=110934 RepID=A0A0S9PFK7_9MICO  ali  21  8..............RPRSSDLLLARDLDPDTLRQLQRSSDTRRLRRGVYVTSESWAGFDTYARHLTNVLAVESTHRHPVFGHASAAAIWGLPLADRPWPAEVHVVADATSHSRSGVVVHRQAMHDGDVAERNGLLVTSLERTAIDLARMPFPIAVAAIDFTVHRHVLTREKLVEGLLRSPRGRARARRAIDAARVGADNAGETLSRLAIIELGFPEPLLQV.. 226
352 3.000e-39UniRef50_A0A024GZP6 Uncharacterized protein n=15 Tax=Micrococcaceae TaxID=1268 RepID=A0A024GZP6_9MICC  ali  22  18..............HLASTSQLDEAGIGDRLLTSAVRQGVVIRVRRGAYARSSYWNGLKPWTRDGLLVHAHHLSTGGTALSHVSAARLHRCQVWNAGPLIHVTTSANSRASAGRDVRTHRAPVPERDTITPGGFRATSLERTVLDCARLPLEQAAVIGDHALRKG-AKLAEIQRLLNTGPRGSRRARVLLDALDERSESAGETRTRLLLRSFGIHSFIPQ... 232
353 3.000e-39UniRef50_A0A2C8Y685 Uncharacterized protein n=1 Tax=Salinibacterium xinjiangense TaxID=386302 RepID=A0A2C8Y685_9MICO  ali  20  24...........................DRAQFFARARKGEFTALFRGVWVPTPLWISLSRAERYELRVKAAAAVDSEATFSHESAAVLWRLPMVGAWSVRIQTLAEESCGGRSNAMFQRHAAGVPFEFEHIQGIRVTSLARTVVDIARLPFGVAVTMTDAALRRSVLSQQTLLEELQPMRHGTAKARAVIEFASGLADRPGESMSRVSMRRARIPAPELQV.. 230
354 3.000e-39UniRef50_A0A2A9CR22 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2A9CR22_9ACTN  ali  21  2................ARAAQLAVEGADRMSLTRQVRAGSLVRVRHGAYAS---ELGVDAMERHLQLVAAWPLLGESAVLSHSSAAVLHGLPTWERDLAKVTVIRPGGHGRAGTWLHARLGALEPDQVCQLQNLRVTSLARTAVDRACLSYDRAVATLDAALRAG-VRRSELEQIVARRRHGVGVARAALAFADGASESVGESISRVLIAQVGLPAPSLQVE. 208
355 3.000e-39UniRef50_A0A0Q4UXW9 Uncharacterized protein n=1 Tax=Curtobacterium sp. Leaf261 TaxID=1736311 RepID=A0A0Q4UXW9_9MICO  ali  19  10..............GLLLRRAVQPTDSRARQLSREAARGTLERVARGVYVDAAIWSRARPVERHLLLVHAAATRPDRATVSHQSAAAMLGWPRIGPYPRLVQATDPRATSRTGALVRWHVAALDAADVIEIDGVRVTAPLRTLRDVLMTSRRDAVAVADFAIGHAFVREADAVRTLDTPVRGSRRARDALAFADPDADSPGESYSRVVIDELGFPPPRTQVE. 222
356 3.000e-39UniRef50_UPI0004099DF3 hypothetical protein n=1 Tax=Arthrobacter castelli TaxID=271431 RepID=UPI0004099DF3  ali  20  14................VTARELTTAGIGDKLRRAGVKLGVLYKLRRGAYVRADLWDGATLAMRELMRIRAHFLSTPHAVYTHATAARLHGLHVWDVPPLIHLSQPASTRSARGPDTVTYHQHLDAADIVTLNGPRVTSPERTVVDCARTLEEHAAIIGDHALREG-ADWEQMHSLLRAGTRGIRKARSVVAALDGRSESPGETRTRLLFRSFDVPMPEPQI.. 227
357 3.000e-39UniRef50_A0A096LMG0 Uncharacterized protein n=4 Tax=Collinsella TaxID=102106 RepID=A0A096LMG0_9ACTN  ali  24  28..ARNRMLARLTEATEQGTLLATHDNTELMWLRRHVGTDDIAEPEPYLFCFQHDWDALTLTERALRTIRGLAEFHPDWAFWGYDAALIWGLEVPNDLLGPRYLVKTGCSVPLSAGCRLLR-PQAAGALEQVDGVWATPFWRTVDDCLRAPFSYGLAIADSALRAKGVSRGDLCERLRKGRRGYRRAQVIASYADGLSENGGESRFRAFFIAYGFPVPELQVE. 250
358 3.000e-39UniRef50_A0A1Y3UG95 Uncharacterized protein n=1 Tax=Collinsella sp. An7 TaxID=1965651 RepID=A0A1Y3UG95_9ACTN  ali  31  4.RIDAELSFLLDEAEADRRFLMTSDPNLQRCLVRRVRTGELASPLPRVFSRPDYLRELTHEQRQLHSMRALGGHHPTWVFVRGSAALAQGLFV-GRALTGTICVASAYTATA---GGVQHERLRVMGRCEASGVWVTSVLQTMVDCLRTPFEQGLGIADSALANLGLNREYVAELVREGWRGIRHALQTLAWANPLSESGGESYVRARIVQLGFAEPILQVE. 224
359 3.000e-39UniRef50_A0A229W0J0 Uncharacterized protein n=1 Tax=Bifidobacterium vansinderenii TaxID=1984871 RepID=A0A229W0J0_9BIFI  ali  40  1.........................................................................MHPNWIFAGLTAACAYDLDHSYALHHSIICIASAYSPSPHQSRQLKRIYMRNVNHTRTSSIPVTDIHRTLIDCATLPFADALPMFDSAARKGVSIV-GLPDRCRTLGIDSANVTALCTYTDPLSENGGESFARATIIQLGFVVPRLQ... 148
360 4.000e-39UniRef50_A0A0Q6BGT9 Uncharacterized protein n=7 Tax=Frigoribacterium TaxID=96492 RepID=A0A0Q6BGT9_9MICO  ali  20  7..............EIIRRATWLRSGRDDHELRRRARVDELVRLAPGTYLSAETWVAADPRQRHALRVRAVGRLTSDIVVSHESALALNGFPLLGRRPERVHVVDRRRASTTSSTLVRHAADLGAADLISRWGMPTVVPLRAALDVARTDLRGGLVVIDHGLRSQAFDRTAAGAHLEARHRGTRVATLALALADPLSESAGESLSRAGMFEAGLARPVLQ... 217
361 4.000e-39UniRef50_A0A1Y4HS06 Uncharacterized protein n=1 Tax=Collinsella sp. An2 TaxID=1965585 RepID=A0A1Y4HS06_9ACTN  ali  26  10....ERIACQIAQAEKDGALFRPSRE-EIRAFRRRVGRGELVEPFPQLFGRSAYWANLERWERPFVIIKSLARHDDHLIFASFSAACVFGLPVSLELLEDVYLAVSPRSHTGKAGRFVRCGVRATPGIGTVHGIHVTSPEQTVVDCLCTPFPQALAIADAALRLLGISRDELMQLVKRRKRGVRGALRVASYVDARSQSGGESIARGVMIQEGFVVPDLQV.. 234
362 4.000e-39UniRef50_L7KES4 Uncharacterized protein n=10 Tax=Gordonia TaxID=79255 RepID=L7KES4_9ACTN  ali  19  52...........DRFGLIHRTAVIAAGYTDNDLRTSLRRREIERVHRGVFVVRIDRSRL---EQHRLIVLAAAGSRARAALSHQSAAAVHGLEMLSPTLTRVHSTTVAGTGFRTATHHRHVATLTDDELVTVDGVLVTSIERTAVDIACASFAQALAVVDSALRLG-ADREVMKRMLVGRRRGVGLARRALHHADGRSDNPGESWSRAQMIEAGLPTARLQHT. 313
363 5.000e-39UniRef50_A0A1V0KH10 Uncharacterized protein n=1 Tax=Actinomyces gaoshouyii TaxID=1960083 RepID=A0A1V0KH10_9ACTO  ali  24  44.....................................RAELYRLRPGVYAPRKEWDSLPYTKRHLVRILAAPRGRRTGVLARESAAVVLGIPMIGPLPSRLQFVLPGGRHGDTTPLAHVATAPEDTPIVMAHGLPVTDPAHTAVDLMRHSFQSGLVTLDHVLRERLATPEELLDIIAPGRQGNSRARLCLKHGDARSESVGESLSRAVLIEQHLPTPDLQVS. 234
364 5.000e-39UniRef50_A0A1I5BTX7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Mycetocola TaxID=76634 RepID=A0A1I5BTX7_9MICO  ali  20  6........DAFQHADFIRRRDLVAIG-EDQAIRQQLRHGRLVRVAPGSFVEQGTWQSLDALARHRMAVLATARLRTPVVFSHHAAAALHGIRMLGNWPSTVDVTLERASGGRSDGLRRHCTGLDDVDVVVLGDLTVTSPAQTVVDLARLPFADAVVTMDSALHRKLTTRAAILDAAAEGKRGWRRAQLAADFSTDLSDSPEESHSRVQIHLAGFPVPTLQ... 226
365 6.000e-39UniRef50_A0A2M9HGQ8 Uncharacterized protein n=1 Tax=Bifidobacterium sp. TRI 7 TaxID=2045441 RepID=A0A2M9HGQ8_9BIFI  ali  27  1MRRNSTLDAMLDTAEANGLCLWSGTEVQRQILRRRVTIGELTAVGAQCYARTSYWQALSAEDRLRHLTRSLTLMHPKWVFGGSTAATLLNI-CDSTRHMRKLHRVIDGNRVPRSTGIIVNHYIEETAPIIIDGARVTPLDRTAFDCARLGFPDAIAIIDSILRQRLRTKSQLDRSFRTNGKYRNRALHVLNWATGRTDNGGESFSYGVILEERFMQPQLQV.. 222
366 6.000e-39UniRef50_A0A0Q5NLQ0 Uncharacterized protein n=7 Tax=Arthrobacter TaxID=1663 RepID=A0A0Q5NLQ0_9MICC  ali  21  1......MDSTPPTLILASRRRALTG--SSRSLSRAYNNGELVRVRFGVYYNKPAWLALKAWQRYSATIAAVACCDPSAAFCYLTALRLWRLPLPRVPEHIHIVTQSPHKAGRRSYGIYRHHW--AADIVEHRGVAVTSLVQTVVDCVRMELPEAVAVTDAVLGSRRTTGEGLESARLRSAAKRRRLLEVLALADEASESVGESRSRALIHVLGLPAPVLQH.. 240
367 7.000e-39UniRef50_A0A1H1WHV3 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Microlunatus soli TaxID=630515 RepID=A0A1H1WHV3_9ACTN  ali  17  25............................................................DEHRLLIRAAAAVTESDSVVSFGSAGVLHDLPVEPDAYRRVHLTRRNSGGRIRRGVHVHVAPLGDSEIVDLAGIPVTSLDRTFVDLARTSLQDGVAIGDAALRRGMDSVTDQLEAAN-YRRGIRKARRVASMLDIRSESVGESRSRLVMIEQDLPRPELQVE. 189
368 7.000e-39UniRef50_R7D6I4 Tat pathway signal sequence domain protein n=3 Tax=Collinsella TaxID=102106 RepID=R7D6I4_9ACTN  ali  23  9.....RLAAQFEDAIARGACLAPAMQRDYQLLKRRMNQKKVVESRPGVFAPVDCWNKLGDRQRYLHVLRSMAAKHPDWVFCSFSAAVIQGLAVSKKQLRAIHIASPANHCGEAPTGVVRYRA-SQLSVVTVNGLKTTPEVETVFCCARGGFSEGLIVADSFLRNNNMDSRQLYTCIGKNRPGKACALRVARYADGRSENGGESKARAVMIEGGWETPDLQVE. 228
369 7.000e-39UniRef50_A0A2N9JI03 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Micropruina glycogenica TaxID=75385 RepID=A0A2N9JI03_9ACTN  ali  18  1..........MTDAALTHHRSLSAQGLTRADVRALERAGELTRIRRGVYQRGPFEAGDGARHRQLVRA-TWLELGDGAAVSHASAAVLHGLPLLGAPARVCVTRPEGGHGRADSVLHLRLCPIDAAETVLIGDVLVTSLARTVVDVARSSLDQGVVVADAALRLGL-HPAELADAVTRRRPGVTRARQVASFADGASQSPGESVSRVRMHQAGLPTPVLQ... 212
370 7.000e-39UniRef50_D2PUQ8 Uncharacterized protein n=1 Tax=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) TaxID=479435 RepID=D2PUQ8_KRIFD  ali  18  5............QGGVFSRRQALACGYSLQEIQARLTDGRWERIRYGQYAAAVDLGGMPPWERHRRLVHAAVMRLGSVAVSHQSALVLHGAPRWGLDLEAQLTRLDDLRSGPTAGVRHHRGGLTPADLTEVSGLTVTTPARALTETACTSFEAAVVAADAICRSHPEVDLHLQRLLVEFWPGSTTARAALNFRNPLAESVGESRLRVVMHDHGLPPPTLQV.. 223
371 8.000e-39UniRef50_A0A2U0HBS2 Uncharacterized protein n=1 Tax=Microbacterium sp. Gd 4-13 TaxID=2173179 RepID=A0A2U0HBS2_9MICO  ali  22  20.............................RDASRGVRSGELTRVIRGVYALSDEWNALAPWDRYAARVHAAALRHPDSVFCLESASVLHSLPVFG-DPGTVHVLRDDSSTSRVSGGVLVHTTSEHRSMDTAGGMRRTTVRDTVIDLARSRHAVALAVGDAALRRGIGTASLVGEESRASSRGRLRARWVLDRVSPSAESPLESVDRAVLEWLGFPRPELQV.. 214
372 8.000e-39UniRef50_A0A0S9K9A8 Uncharacterized protein n=1 Tax=Leifsonia sp. Leaf264 TaxID=1736314 RepID=A0A0S9K9A8_9MICO  ali  21  14..............GLISTDLLRRSGVDPRGIECLIGLSELVRLRRGWYVTATEWKAAGRDGRYRFMIRATNASSPSLVAAHLSAAAMHRLPTIGNWPSELHTFDPRASGGSTSRLITTHRSGPPAETVVIDGIEVVALERTLVDVAVNEPERAVTAIDAALRRDAVRATDLRQRGEGEARHRARAESVIRFADARAGSPGESLSRVRMRQGRFVIPDLQV.. 245
373 8.000e-39UniRef50_A1SJA4 Uncharacterized protein n=7 Tax=Nocardioides TaxID=1839 RepID=A1SJA4_NOCSJ  ali  18  11...........DRHGLITRRGARAAGLDDADLRHLVKHGRLIRMRRGVFVEAEHWNMLDERGRPLLRVRAAQELQRDHVLSHDSAALVLELGCPDPRTALVHVTRPKVHGDARAGIKHHLAPYSADQVLVVDGLQVLDPARTALDMARHGLVAGVACCDAALRRGACTDLDRARQAMRCWPGSRVMDAAVRLADRGAESWLESEARVFVTSLGIGRPQTQF.. 225
374 8.000e-39UniRef50_A0A1Y2N3Y8 Uncharacterized protein n=3 Tax=Pseudonocardia TaxID=1847 RepID=A0A1Y2N3Y8_PSEAH  ali  24  17...........DADGLLRRTELRAAGFDAGEIDRLLRSGVLILVRRGVYRLAGERSSPSPEADHALRARAAAELSAGTVFARTTAAALLGLPLWGLPLDRLHVIRDRSSGGRRRGMHVHCARLPIGDVLDLGGVRVTTPARTVVDLARSPPEQALVAVDGALHKGAVTPGEIGAIVARSARGAPAARRVLGLADPLSESPGESRSRFRMHLAGLPAPVTQ... 243
375 9.000e-39UniRef50_A0A1I6LXY8 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Microbacterium sp. cf046 TaxID=1761803 RepID=A0A1I6LXY8_9MI  ali  24  32.................................RGVASGELIRVRRGILAPSSLWLALPPWRRYEARVHAVAMTHPGVVFYRESAAAIRGLPVFGEPPEVHILDTPGATARSSGGIRVHVTA-EDRVVDSRGGILITSLADTVIDLARGRHGAGLAVADAALRLEDLTVEGLVAQNESRVRGRRLARWALHRATPLAETVLESVSRAAIEWLGFADPELQVE. 223
376 1.000e-38UniRef50_A0A1G8LM85 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Arthrobacter subterraneus TaxID=335973 RepID=A0A1G8LM85_9MI  ali  23  21............................PRELSRRARSGELLRIRHGCYVDAQDWRLLEDEERYRGMLAAMVRARRTPLFGAETAGVLWGFPRPDLPSDVQMIVPVGSGRRSSNGVRRIRDPYLSTPVALDHGMQVTDKVQTAVDLALYDFPWAVAVMDRLLRRRPVGKAEVEECVALLPSGRRKARRVLQFSDGRAMYPGESLSRVHIAELGFPEPDLQYS. 228
377 1.000e-38UniRef50_UPI00036F9CAD hypothetical protein n=1 Tax=Leucobacter salsicius TaxID=664638 RepID=UPI00036F9CAD  ali  23  27............ERALLRASAILDAGLSPRALERAVAAGEYVRVAHGWYADGVAWRSWLPERRHLAAVLAAHHAVTPPLFSHYSAAALLGLPLWGFRLGRVHVV-SGRGGKSNAAVLRHDLEIPAHHTGSVAGYFCTNHERTVFDIARADTETALGCADAVLARKARRMAELLGAMPRHLRGLDRVRRIVELADPRAESVLESVSRLQLLRLGFEL-DLQV.. 250
378 1.000e-38UniRef50_A0A126YXV1 Uncharacterized protein n=1 Tax=Frondihabitans sp. PAMC 28766 TaxID=1795630 RepID=A0A126YXV1_9MICO  ali  25  13.....................AAHSVADDRALRRSCARGEIVRVRRGAYVLASLWHQARPREKSLLRIAAVSSTRGFALLSHHSAAAVLGIRTLSEDDRVHIVDPRARTTRTVSGLVIHAGSPDRHEALGLEPFRATGTARTAADLATTPFRDGVAALDSALHQQETGREVLLAAVRRRVHGQKTARRVLEFADHGAANPGESASRVVMAELGFASPRLQ... 221
379 1.000e-38UniRef50_A0A2W0CQU4 Uncharacterized protein n=6 Tax=Curtobacterium TaxID=2034 RepID=A0A2W0CQU4_9MICO  ali  19  8.....................LLLLRSNDSESQHRIRRGELVRVTHGAAVDATAWERASVRERQRLVLEAVATTVGEWALSHRSAGLLWGLPDVDRPDPRVHVTDPLGTTHSGRRVVRHAAPLESAAVSTVDGHRVTSLLRTVVDLARTSYENVVAVLDHVLHERLLDIDTRRRAFAPTPRGITRARRALRFADPLAESPGESVSRVRLDEDGFAPPVLQ... 211
380 1.000e-38UniRef50_E6S7Y3 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=E6S7Y3_INTC7  ali  18  14..............GTFTAAQATALGVPDHELRRAVAGGELVRVRRQAYVSGPVWAAATPEERYRLAAVAIARTRAGDALSHHAALAVHGLPLWGADTDRVDLVSEVRQVTHRRGLALHPAR--GLHLGEVDGVRVTSVARALVRTASMGRDCAVVAGDAALHRNLVTVAELIDEVARVTPGRGRALEAVLRMDAKAESVGESLTRLVLDDLG.......... 213
381 1.000e-38UniRef50_A0A2M9BUM3 Transcriptional regulator with AbiEi antitoxin domain of type IV toxin-antitoxin system n=2 Tax=Compostimonas suwonensis TaxID=10  ali  21  2..HDRTMERHELNLLHTSLLDERQDGAS-RALRRDAAHGAYVRVARGSYAPADEWHALDPRERHCVRALLRARLPPRHVLSHVTAAALWGLPIATRWPDDIDVTVDRATGGRSEGVRRHATGLDDLETRQLDGVTVTSPAQTAVDIALLPLRSSVVVLDAVLSARLATKAELERLLDTMRRGIRRARAAVDFADGRAESPGESMSRAVIHELGFPPPILQ... 227
382 1.000e-38UniRef50_A0A1H8VQM4 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=7 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A1H8VQM4_9ACTN  ali  21  4.......ADPVLRSELVLRRAALAEGWSDDELDRRLRRGEMARLRPGAYAPASAIRDPARRHRHL-ITATLAALRRPAVVSHQSAAVLLGLPMWGVPLGRVHVTRTPPASSVGRHLRCHVARLADDDVVTVGGVAVTSPVRTALDLARLPFEAAVATLDAMLFHRKLGGEALVAGAQGRLPGARSAARAVRFADGRSESVGESRSRVLLHRLGLAPSALQLE. 221
383 1.000e-38UniRef50_A0A221R651 Uncharacterized protein n=2 Tax=Sinomonas TaxID=596707 RepID=A0A221R651_9MICC  ali  20  3.................ARSGLIAAGLDERDIRSLTESGQLSRLERGIYAP--ELSGTPDPMIVRICAHNAASTGQSHVYTHTSAALLWGLSVWRARPLVHVHAGRRGNRGPADDVVRHNQIIPESDVRILNGMRLTSLERTIIDCARLPFELGVIVADSGLAHG-ADQDALRHLVAEGRRGIRRVREVLAAADGRAESPAETRFRLLLDEWNLPEAELQ... 206
384 1.000e-38UniRef50_G7H3Y0 Uncharacterized protein n=1 Tax=Gordonia araii NBRC 100433 TaxID=1073574 RepID=G7H3Y0_9ACTN  ali  21  1MRLRD--MEHSDDTRIVLRADALAAGITDRELAA------LDRLAPGCYVPRSD-RRFFPEERHRLVAIAMAAKSGG-VLSHQSAAAVHGLGMLSPDFKRVHFTSVGAHGNIRGMRHTHSGFLADDEVVVVNGVEVTSIERTAVDVACARFPGALTIMDSALRAG-ADRDRMEELCAASRRGIRVARRALVLGDGQSANPGESWSRAQMIAAGLPLPTLQ... 211
385 1.000e-38UniRef50_A0A1M6P5P8 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Tessaracoccus bendigoensis DSM 12906 TaxID=1123357 RepID=A0  ali  20  7..................HATLVQSGLNRTDISRRLKDGSLSRVRRGVY--SPEPPAIDTPSHLMLVEATLPLVAPSSVVAYESAGAVHGLPLPELPTCVQMIRRTPGHADGGTVLRMRDTALHDDEVTHVGPIPVTTLERTVADLARLPIEWGVAVCDAALTRGL-PLERIAAVVRAHPRGLPRARSALSLSRFGAESPAESISRLQFIRYGLPEPQLQYE. 210
386 1.000e-38UniRef50_A0A1I6KTZ6 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=5 Tax=Microbacterium TaxID=33882 RepID=A0A1I6KTZ6_9MICO  ali  19  23................LTRHELLASGIRESQLKRSLRDGRLRRLHTGAFVTRQDWESARAEERHLLAVLAAARKGGDVVFSHASAAVAWGLPLFRMPPSPVHTSGPRTDGRPKAGLAHHAVAVDDEDRVVIAGLPCTSLERTVYDMIRTDAAMRLVAAGS--RRGRAWRASLLGRIARGARGIRQARWLARFADGRAELPGESVSRLYLVELGFAAPRLQV.. 248
387 1.000e-38UniRef50_A0A087BE87 Uncharacterized protein n=1 Tax=Bifidobacterium magnum TaxID=1692 RepID=A0A087BE87_9BIFI  ali  31  7.RTWGALTAVIAKAIEEQRCAYATNGTQRQQFHRLVASGILAKPYLNLYAPYDYWQQLSLCERHMHIMRALTLRHPKWIFAGMSALEAYGFEHSRYMHESAITVRSPRQSHHRSRQPLRYLYIPDDEFTVVQGMPVTSPVRTIIDAMNVSFPHRLAIADSALAYGL-SIDEIVDECGKLRMDCNAILTAFEYADQRSENGGESFMRAVLIQCGFQIPQIQVE. 254
388 2.000e-38UniRef50_A0A2W6UUN4 Uncharacterized protein n=1 Tax=Microbacterium sp. TaxID=51671 RepID=A0A2W6UUN4_9MICO  ali  20  28..................................RVRSRELIRVRPGVYAPTAWWRGLEPHARYVERVKAAALVFPGSAFMRESAAALHGLPIFGDPAFIHLFDPSRRSTRTFGDVVVHALT-GHREVIRLDGRLVTDLVSTVVDTSRLTPAYALAVIDASLRRGMNTTDLHDSAADPDRRNERMLAWAWEFADGRAESSGESVSRAVISWLGFPVPVLQ... 214
389 2.000e-38UniRef50_UPI0004C2FF6D hypothetical protein n=1 Tax=Marmoricola aequoreus TaxID=397278 RepID=UPI0004C2FF6D  ali  17  2...DEIIEKLCAGRHSFRRGEAVDIGFDDKALRAAVRAGLLWHVSHGRYGPYAAWAEASLLQRHLWRLEAAAEAHSDVAASHVSALAVYGAPTWRFSLNRVHLVRLDGRANRRTKVLTHRGSVQPDDIVVHEGTRVTSVERTCLDITTLGLEDSLVVLDWFLHGGSTTKKALVERAARFRRGTLHTDLAIGLADPRRESVGESRSAYLFWRYDVPAPVPQY.. 224
390 2.000e-38UniRef50_A0A1A9GQD5 Uncharacterized protein n=5 Tax=Nocardioides TaxID=1839 RepID=A0A1A9GQD5_9ACTN  ali  20  8...........DDLGVVLRRDLVAAGIHDNAIARLVRAGELVRMRHGVYAVAQQWNQATARERHVMLSRGVVRLYGDVALSHVSAALVYGAPDHGLPLTHVHLTDAGAGERTQASVRHHRGGCRVDELSRRGECWITAPTRTALDTAAVDRDAAVCVLDWFFQQGLSSPEECQYQLDARSVWSDHLDLALGYARVGSDSVAETLARLAFLDAGLPEPELQLE. 223
391 2.000e-38UniRef50_A0A2M9BV81 Uncharacterized protein n=1 Tax=Compostimonas suwonensis TaxID=1048394 RepID=A0A2M9BV81_9MICO  ali  22  27............................HGELPRALVTGDLRRVTRGVYAPAE-PASADADARYRTLVRAVAARGHRDILARFSAAAVWRLPMLGSWPTAVHIDPDASGGRSTSRVTYRFHADAAHDATVIDGLRVTSAARTVVSVSRHDFAGGVAMADRALRNQLVTREALVDELGRHGRGVRRARAVLEFADPGAYNAGESLARVLMHQLGFDPPELQH.. 223
392 2.000e-38UniRef50_A0A2M9CLN6 Uncharacterized protein n=2 Tax=Diaminobutyricimonas aerilata TaxID=1162967 RepID=A0A2M9CLN6_9MICO  ali  24  2.........................GAHPGYLRTQAKRGRLVRVVPGSFLDAELWRRLDDRQRHRLRVAAIARTHVGYVYSHHAAAAVHGMELLRDWPTTVDVTVDRASGGRSTGWLRRRALPPAEHLAERDGLVVTSAARTAVDLARLPFGDAVVAMDSALRHRLATAEEIGAVVLAAERRIARAHAALGSAAVGAESVAESVSRLVIRELGFPAPTLQHE. 208
393 2.000e-38UniRef50_A0A229VXH4 CTP synthase n=3 Tax=Bifidobacterium TaxID=1678 RepID=A0A229VXH4_9BIFI  ali  31  1MIQHHSLQTLFTDAEQRRRCANPVTATDIKAIMRRLDHGEVTRVYRGLYARTAYWNTLNRLEQVRHIVRSLAVQHPDWIFCGPTAAIMHDLDCSYRLALPIRIVARPEDHQRSS-AQLARYTMSHPETELIHDISVTTLPRTLFDCARQPLRYALGPLDSALRQERIDRDVLLAYPSTVRYSRRRAARAFSLADGRSENGGESEARGVLISIG.......... 217
394 2.000e-38UniRef50_A0A0Q6F881 Uncharacterized protein n=1 Tax=Marmoricola sp. Leaf446 TaxID=1736379 RepID=A0A0Q6F881_9ACTN  ali  19  7........ELLGDDLFFLRRDALARGLGDKALARLRREGVLHRVRHGAYTRRSHWRSLDRAGRHLLARCAVRAARADVALSHTSAALAMGCPVWGALDDVHLLRLDGRGGRREAGVCQHHQSYAQEDLVMRDGLVVTAPARTCLDLTTTGVEPSLVVVDHLLHRGEVSRQDLLRRSRPYGPGSLTTGLTLSLADGRSESVGETRLRYLLWRGGLPSPVPQ... 223
395 2.000e-38UniRef50_A0A2P8GXQ9 Uncharacterized protein n=2 Tax=Labedella gwakjiensis TaxID=390269 RepID=A0A2P8GXQ9_9MICO  ali  24  4...........DEHRLIRRRDRIAMGDSTADLDRALRRAELMTIAPGTYITGEDWRELGPDRRYRLRVAAVERVSSDPVVSHFSAASLWGMDVWGGWPTTVDVLAAPGRGRSSGSFRRHGTDAARHEVTRLGEILLTTPAQTVMDIATVPFADAVVTADSALRARLVTREELQSAAERGTPGSRRAAAVAAFASSLAESPLESFSRVRMSEEGFPPPILQH.. 222
396 2.000e-38UniRef50_A0A2M9BCR8 Putative AbiEi antitoxin of type IV toxin-antitoxin system n=2 Tax=Compostimonas suwonensis TaxID=1048394 RepID=A0A2M9BCR8_9MICO  ali  23  51...........DAAGLISARRFRELGVGADQLARLVREGTLQRVHRGLYLPRERWKGLRAGARHRIRVLAASAARGRLTFSHHSAAALFGLPFVDARLDAVHTHDPGATGGTARSGITVHRSRVAAATESIDGARVTSLARTLVDVATTSFLTSVVMLDHALRESLATKSSLREELDVPRRGGRLARRAIEFADPRSGSPGESLSRVRMHELGFVIPELQV.. 279
397 2.000e-38UniRef50_UPI000A00EB3A hypothetical protein n=1 Tax=Hoyosella altamirensis TaxID=616997 RepID=UPI000A00EB3A  ali  27  1.........................................................MSTEQRHLLRVAAVSAARRDAVLSHSSAAVMYGLPTWGVDLQRVHVTRGQRSAGRVTG-DMHVHSGSVSGSGLVAGLPVTTPARTVVDIARTPFEQAVVIGDAALQRGLATRDQLSSELARHCTGIREAQKAIAFLDERSESPGESRSRVFMHRYGLQLPCLQAS. 169
398 3.000e-38UniRef50_V8CTY6 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=V8CTY6_9ACTN  ali  22  7...........DGDGLIWRRDVIALGYSDDDIKRAVRGGALSRIWHGAYVRTSRDLSDDALARLRVIAAARSCNHP-LVVSHTSAALLHELPLLKPSHARVHLLNGRIGGGRVSRRHLHAGKAAPGEVIEIDGIALTSLERTAVDTALAGFDQALVIFDSALRAG-ANRDVMSVMVDSCGRGVGPVRTALAAADQLAETVGESWSRAQMLARDIPRPRLQ... 218
399 3.000e-38UniRef50_A0A0Q8AJL0 Uncharacterized protein n=1 Tax=Microbacterium sp. Root166 TaxID=1736478 RepID=A0A0Q8AJL0_9MICO  ali  21  1MPRH-VVHDPVGVAVSELTSLLVFSGHEDREMSAARRRGAVISVRRGVFAPAPEWGALRPHERNELRVRAASVMLDDPIFALESAAIVHRLPVFGEVHD-VHTFAPDRTRGYRHGGHVVHASADAKQIVRIDGVRATSLADTTVDLLRLPHALGVALLDAALRRGL-RVEQVAEVLASNRRGRSAVLRAVAACDARSESVLESISRVLIDALGYPAPELQV.. 223
400 3.000e-38UniRef50_A0A238XNS5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Haloechinothrix alba TaxID=664784 RepID=A0A238XNS5_9PSEU :_  ali  22  11...................AQARAAGCDRAAIRRALRSGRWVPLRRGVYVQAAQLAAVAPERRHAVDVAAVLVLGFDAVAGGNSAARILGLDLLDSRVREPVLLTGAAAGTHRNGYVLRSAALPSHHRATRHGVPITSAARTVVDLARTSFAEGVVVADSALRAGLVSIARLRALLGSTWSGTTRARRVIDFADPLAESVLESLSRIAIHEQNLPAPRTQVT. 221
401 3.000e-38UniRef50_UPI0004C391C9 hypothetical protein n=1 Tax=Marmoricola aequoreus TaxID=397278 RepID=UPI0004C391C9  ali  16  6.........HLTPETLFLRRDALAFGHDDRELARSLRAGVIVRVRHGAYCSAVVWRNLDEVGRYLLRCKAVMLVHRERVLSHTSAAVAHGLELFRPDLTHVHVVRLDGGNAAVRGDITYHAPRWTPEDLYWDGHRVTPTLAALGTASLHDVLSGVVVVDSLLHHGLAELGEVVETRRGHHPHSRRLQLVVRLTRPGAESVLETLLRMLFWRHQIPEPELQF.. 222
402 3.000e-38UniRef50_A0A2W6FJC7 Uncharacterized protein n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6FJC7_9PSEU  ali  13  30.............LTPFTARDAAHHGVSRHQLGRLCRNRDVIRMLYGVYGSSHLDDSLSTRA-----AAVALVLPPGAVLCRRTAAWIRGVDLRRPPLPVEVLVCAGTQPPRRIGVIAHQSAVPDDDVELVGGLPATAGLRTAVDLARRSRTEAIVALDALAHAGICRLDDVAARALRGRRGVRQLTDVIPLADRRSESPMETRTRILILDAGLPTPEVQYE. 239
403 3.000e-38UniRef50_A0A1Q2TJX0 Uncharacterized protein n=2 Tax=Actinomyces TaxID=1654 RepID=A0A1Q2TJX0_9ACTO  ali  24  46.......................................ELYRLRPGVYTPRREWDSLPYAKRHLVRILAAPRGRHTGVLARESAAVVLGIPMIGPLPNRLQFAIPGGRHGDTTPLAHVITAPKDTPIVMAHGLPVTDPAHTAVDLMRHSFQSGLVTLDHVLREGLATLEELLDVVEAGRQGNSRARLCLKHGDARSESVGESLSRAVLIEQHLPTPDLQVS. 234
404 3.000e-38UniRef50_A0A0M3UH10 Uncharacterized protein n=6 Tax=Arthrobacter TaxID=1663 RepID=A0A0M3UH10_9MICC  ali  25  2.....................LASAGITDRTLTAGLRCGLLKRLHRGSYVSVTVWNAAKPWVREMILIGHVLASHSHGVYSHSSAARLHGLRTWGCGDAVHLTQEFAGNSGGAHRVRGHQQLLAPSLVTSVGGIRVTTIAQTVLDCARLAMQEAVIIGDHALRKG-VQIAQLQALLVASPRGSAKARLLLAVLDGRSESAGESRTRVLVGRMDMPQPELQVE. 210
405 3.000e-38UniRef50_A0A1Y3UDA2 Uncharacterized protein n=2 Tax=Enorma massiliensis TaxID=1472761 RepID=A0A1Y3UDA2_9ACTN  ali  30  10....RRIDALLDDAEA-SRTIVVASHGDADALKRRASRGQLASPAKNLYARDAYWSGLDPAERALHLMRAEASRHPTWRFRSYSAALVWGLDVPHALVDALHIIADRPPNAPHCRA---RRPSSRDDYALRDGMNVTSFWQTVAECLCAPFSYGLAIADSALHMRGTTNEELLDRLSDDRTGIAQARLIASCADGRAENGGESRVRAYLIAQGYQIPELQVE. 226
406 4.000e-38UniRef50_A0A0M2HES0 Uncharacterized protein n=2 Tax=Microbacterium TaxID=33882 RepID=A0A0M2HES0_9MICO  ali  21  3....PEIDRLLHPARAVTTR-------SWRDLERSLVTGELLRIHRGWYAPKAEAAALRSEDRLLLRIRSVNRSARGGVFSHTSAGALWELPLHKVGTHVVHTTLREGEVHSTAGIRRHRDVLRPDDITNRFGMPCTTLERTVVDIARTSLETSLSAADAAMRQRDTEREDLDAAAMAGKRGVRQARVVADLADGRAQLPGESISRIRLLELGFDAVRLQV.. 232
407 4.000e-38UniRef50_A0A1N7CYA5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Williamsia sterculiae TaxID=1344003 RepID=A0A1N7CYA5_9ACTN  ali  22  7...........DSDGLIRRRLVVAGFGDDDGLARAVRDGSLIRVRRGSY--TSVDTDPDALGRLQILAAAGDAIIEKAV-SHHSAAALHGLDTLDSPPRGVHFSVRRANGGDTRTRLLHPTRWDPDEVVMIDDVLTTSIARTAVDIARQGWMSALVVFDSALRLG-VTKDDLRSVRSRGRTGVGAARAALPYADGRAESVAESLSRGLIISHDIPTPTLQH.. 218
408 4.000e-38UniRef50_F6FWN2 Uncharacterized protein n=8 Tax=Promicromonosporaceae TaxID=85017 RepID=F6FWN2_ISOV2  ali  19  7.....................LIARDHDPYELRVAHRAGALERLRRGAYASSGDAAMSAVRRRELDRARAVHELHAEHWFSHGTAAVLHGLPVWRLPDQVHLVQAYRASSRSAADVRRHVLPVPPEHRVVVGGLSATSLERTVADCSTMPALEGLVIADAA-RRRGVDVEEVRRIVMSRYRGRARGLLVLDLSDPDAESAWETWLRYVALWAGLPRPETQV.. 214
409 4.000e-38UniRef50_A0A126YZP6 Uncharacterized protein n=1 Tax=Frondihabitans sp. PAMC 28766 TaxID=1795630 RepID=A0A126YZP6_9MICO  ali  24  8............PDGLIRTADFIRAGRNDRELRRAATAGELVTVIPGVFVRADRWQAATGPDRHVLRAMAFARLDERAVFSHTTATALHGWGSLGPPPDLLDVSDPDSKSRRLASARLHVARLSGADLGVVEGLPVTSPARTAVDVVSQGFRAAVVALDSALHASLLTLDDFDAALGRRVRGHKHVQRVRAFANGLAASGGESLSRIVMHERGWPAPTLQ... 235
410 4.000e-38UniRef50_A0A2E8P0A2 Uncharacterized protein n=1 Tax=Leifsonia sp. TaxID=1870902 RepID=A0A2E8P0A2_9MICO  ali  20  22............................RRGVYRGARDGEFLKLAPGVYVRRDAWNEMGVDERYCLRVRAAWRAASSDVLSHWSAAALWKLPILGRWPKDVHVVGSATSNSRSTSVLRRHTDSWDAHPVHLDGMRLTALGRTVVDMARVRFPVAVAMGDAALWRAAHDAEGLAGASLEHGRGFARARRVLDFIDGRANRPGESLSRVTMHALGVPTPELQHT. 229
411 4.000e-38UniRef50_A0A126Z0F1 Uncharacterized protein n=2 Tax=Microbacteriaceae TaxID=85023 RepID=A0A126Z0F1_9MICO  ali  22  16................VLRPSALDTRFT-RALPDRCLRGELVRVHTGGYVAATDLTGLDRRQGHVLRVHAALRLSPRVVVSHGSAAAIHRLPSLGPPPDRVHVTDPARTTSQANGVAKHAGPLPNEDVVMVEGVRVTSMARTAADLALLPMPDAVVVLDYVLHCELADRETIGVQLEXXXXXXXXXXXXLDFADGDAQSPGESWARVLAHRLGAPKPVLQ... 223
412 4.000e-38UniRef50_UPI0006604B8B hypothetical protein n=2 Tax=Micrococcales TaxID=85006 RepID=UPI0006604B8B  ali  16  2.................TTRSLLAQGATEQSLTQKARSGEITRLSRGVYVITNRWKHATEREKAIARHFAVWKTARPFVFSHASAALLHGINLLRLPDRIHITTPRRTYPHNPRILAHTRSHALDDWVRFQDGPHVTPLATTAFECSLLPLREGLVVMDQVLARGKSSVEALVAQ-GRRRHGIGRARQVLELADPRCQSVAETLTRLVLSAPGLPRAIPQ... 207
413 4.000e-38UniRef50_UPI000C2C0656 hypothetical protein n=1 Tax=Microbacterium TaxID=33882 RepID=UPI000C2C0656  ali  21  22..............PLLTARRLTREGATSRQIERRLNTGELVRLRRGLYIEGADWSRLLPEERRIVRARGWAETSGAAVFSHATAAAIHGLPVFRARDERTHVVVPLPRHHLAEDISRHRGTVDSG-VTEIGGLRVTTLARTIADLGRFETAEAISAADAALRAIADFRQLALEFLPPRAPGSAASSRNIRFADPRADRPGESISRLYLHHLGFAAPRLQIE. 239
414 5.000e-38UniRef50_A0A0Q8AQ00 Uncharacterized protein n=3 Tax=Microbacterium TaxID=33882 RepID=A0A0Q8AQ00_9MICO  ali  23  26.................................RLRTAPDLVRVRHRVYAHAAAWRALRPWERYTARVHAYALVSPQAVFALESAAALHGLPLFGEARDVHVF-DTGRSASTRYGDVVVHTSRDAPAIEVRDGILATTALHTAVALGRLPPAFGLAICDAVARRGNDDLAGFAELIHRQARGRRRLRWLHERVDPQSESTGESVSRAVIEWLGFADPELQHE. 216
415 5.000e-38UniRef50_UPI000DC2C651 hypothetical protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI000DC2C651  ali  24  20..........................HASRQLSKRADAGELFRVRQGLYLPTEVWSALKPWEQHRMKVQAVHELAAPPVFARESAAEVMGLPVVGVPRDVQTLVPPGPGGQSRHGVRRIMAVAGDPEPWTMFGLQVTRPVETARDLAHLPLEQSLPAMDKLLQRKALPEEDVCESAARLPSMARRVLRVLDVADGGSQSAGESRSRAIMILNGFPRPELQ... 229
416 5.000e-38UniRef50_R7WRY3 Uncharacterized protein n=1 Tax=Rhodococcus rhodnii LMG 5362 TaxID=1273125 RepID=R7WRY3_9NOCA  ali  21  15...........................TDNDMRRRRRTHDVHRIACGVYTPLD-PDGLDPLRRHRLAVDAMLRLSPDAVVSHQSAAVVHGLTLWRTDLSRVHVTRERDGGGRRRAGLRVHPGDLRGRTTRVDGIVVTTLERTVVDLARLPFEQALVAADAALSTAGARRAELERACLTGCYGAPAARRVTEYASEGSESVGESRSRVVFAKFGVPLPIQQAE. 212
417 5.000e-38UniRef50_UPI0004B16226 DUF559 domain-containing protein n=1 Tax=Promicromonosporaceae bacterium W15 TaxID=1214064 RepID=UPI0004B16226  ali  22  35............................RREIEDQVREGTLTRIRPGVYGPRVVEDSVAKRAQMLQQVRAVERLRGEFWFSHVTAAVLWGCWTWKSDGLVHLTELHNPAIRRSRTIRRHWTDLPVRDRSSVSGVPVTSLERTAVDCARMLRPSALVVLDAALRKG-ADRRLMATILERGKRGVRQARELLPLAVATSESPGESIVRWVALDAGLRPP...... 230
418 5.000e-38UniRef50_U2RTZ5 Uncharacterized protein n=2 Tax=Leifsonia TaxID=110932 RepID=U2RTZ5_LEIAQ  ali  17  8.............APLVLTRDLRDLADTRHQHARAALAGSEVRVGRGVYVRREDWDELDALDRYRLRMVAFARTRRPPVFSHQSAAVLHGLPMIGVPERIHVSVGSTAGGRSARAVVAHSREVVLEDIVEVDGLRTTSLPRTAIDLAATPRPDAVVVADAVVRNGSPRLALLEAWLRAQPRGHRRAQEVIAFADARAESPLESVSRVSMHAGGVPQPALQV.. 219
419 6.000e-38UniRef50_A0A1Z3LLQ3 Uncharacterized protein n=1 Tax=Cryobacterium sp. LW097 TaxID=1978566 RepID=A0A1Z3LLQ3_9MICO  ali  20  10....DVLAALSGHSGLILASDAARVGL-HHELRREYERHTVIRLRRGVYTRAAEWDALGADARYLRRIHAHAATAEAPVYSHVSAAALWGLPIVGAWPADIHLATTTAAGGRSRRGVIRHPQEHSLDVVEHEGLRVTSVAATAVALARLRFGQAVAVVDKAIHHALATRADLDRAFDQLGRGRAAAGRVLEFASPLSGSAGESISRAGIFLLGFLLPELQV.. 234
420 6.000e-38UniRef50_A0A1G9I5B0 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Tessaracoccus oleiagri TaxID=686624 RepID=A0A1G9I5B0_9ACTN  ali  17  7..................HAELLAMGHSPHDITALCDSGELTRLRHSMYSAERLDDELT---RHRTLIRATTRLDPTSVVSHTSAAVLHGLPVQRSSLDRVTMTRTPGHGDKSPQLLVRNTRIIEAEIGEVDDVRVTGLARTVCDVARTEPLGWGISAADAALAAGISRSELGAALAMHPRGLRRARRVLRFADARSESPAESISRINMSIAGLPTPELQTE. 211
421 7.000e-38UniRef50_A0A1Y1RND5 Uncharacterized protein n=1 Tax=Rothia nasimurium TaxID=85336 RepID=A0A1Y1RND5_9MICC  ali  20  13....................ELRHEGISPSTVRRRCAQGRLIRIMPNAYVDAHQWVQWDEETRVKARHASFIKTHQHYVLSHVSAALWWSAPLLRLPRKIWVSHPAPT-VRSRPQVHVSRGREDCAKSTFHRGAFVTSPLQTVLDCATLPCLDALCVADYFLNRGLVSTKEVREGISLLGKGVCTARAVAALMSDKSESPAETIARYRIVTWGFTPPQEQVS. 216
422 8.000e-38UniRef50_A0A100YVB4 Uncharacterized protein n=1 Tax=Olsenella scatoligenes TaxID=1299998 RepID=A0A100YVB4_9ACTN  ali  31  1...................................................................MRTLARLHPSWIFVGPSAALVYDLQVPPSALWP-LCIATTGNGTCKTYANAIRKRISPCEVLVIDGIRVTSLDRTVVDCMCLEFPSALAVADSYLRKTNQPRERLEAMVAKGKAGIRNARLVASLADGRSESWGESEARAAMIELGFQMPDLQV.. 157
423 8.000e-38UniRef50_H0QZA4 Uncharacterized protein n=3 Tax=Gordonia TaxID=79255 RepID=H0QZA4_9ACTN  ali  20  1MRLRLVIEIPQTRHGVYFREDILAHDYDDAAIARAVREQELIRVGTGAYAAA---KDRYPDELHRMKAIAAWLGDPGGVLSHISAAVVLGLDTLNPTLGRVHFTKPNSSGNIRANRHTHSALLRADEVTFVDGIMVTNLERTAVDIACVSFPAALAVVDAALRRG-ADREVMRSTLAQVRRGIRTARRAIESGSPLAESVGESWSRSQMITAGLRLPELQ... 225
424 8.000e-38UniRef50_S3YA60 Uncharacterized protein n=6 Tax=Propionibacteriaceae TaxID=31957 RepID=S3YA60_9ACTN  ali  21  13.....................LAASGTSRRAIAREVNEGRLIPLRPGVWANAG---ETTARQHQLDLVTAASFLAPTSALSHVTASAVHALPLPSKGLDHWVTNPRPGGGHRRRLMTTIGRMLPPEHVVVIDGHRTTTLERTVIDMATFGFETGLMTADAALRLG-ADPQVLADVLEGRPRGLGHARQVVAFADGRIESPGESLIRAKWHCVGVPQPVPQF.. 212
425 8.000e-38UniRef50_A0A0B2APR2 Uncharacterized protein n=2 Tax=Sinomonas humi TaxID=1338436 RepID=A0A0B2APR2_9MICC  ali  22  13..................AADLADRLGSPKAAERLVQAGVLTRIRRGSYYLAEEWKSLPPEDQHLAVLSAHNASRRREIYSHLSAARLHGIHLWNPDPHVHLTMPRPSTKGRADDVRIHSAILADDDRSTIRGLPATSLDRTLVDCARLRRGQAQIVMDHGVRLGADRITDLLAEAQ-GKRGVRIARAAWEMASGLCESPGESLLRYLLSRMPFELPAQQV.. 223
426 9.000e-38UniRef50_A0A243Q6X7 Uncharacterized protein n=3 Tax=Gordonia TaxID=79255 RepID=A0A243Q6X7_9ACTN  ali  18  7...........DRYGLVRRETTLRLGIGDDVVRSAVKRGELVRLAPGVCTTATD----DMDDLYRLRSVGVATSARDCLLGHDSAAAVLRLSLLHPERERVHLTRVEPGAGFVRGLRVHAGPLTAAEIVEIDGVRVTNLERTAVDVAMAGFAQALVVFDRALAAG-ADADTMARLLESRWRGVGIARRALSFADSAAESVGESWSRAQMIEAGLPLPRLQHT. 219
427 9.000e-38UniRef50_A0A0Q6K1M2 Uncharacterized protein n=6 Tax=Nocardiaceae TaxID=85025 RepID=A0A0Q6K1M2_9NOCA  ali  21  2...............LLSRRDALARGATDAEIKAALARCEIAVVRRGIYVPAAVLESLDATGRHLLEVRATLLASAPAAAAAHGSAAVHGMSLWRVPERVHLGIPRSSGGHVGRHRHVHADGLTERDVDVIDGLRCTSAARTVADLARLPFEDAVCAGDSALNRHLVTPESVRESLSRSHRRRTAAECVLGFLDGRSESVGESRSRVYLHHLGVPCPELQVT. 212
428 1.000e-37UniRef50_A0A1R4FDQ8 Uncharacterized protein n=1 Tax=Frigoribacterium sp. JB110 TaxID=1434829 RepID=A0A1R4FDQ8_9MICO  ali  18  2..............ETFARSSLIDLGSTDDQLRASVQDGALQRVRRGHYAQVESWRSAYVEERQRALAQAATRARTPPVMCRATAAAMHGLPLFRLEDERVHVLAGHGGSGTQSDAVIRHREHTDGSFVVCDGVRVTPLVRTVFDVARTARPEALACADAALRRRPQRTRQVDEAASRGARGVKQARRIGELMDPRADSPGESVSRLYLVQLRVRAFAVQ... 225
429 1.000e-37UniRef50_A0A2A2EJD9 Uncharacterized protein n=6 Tax=Bifidobacterium TaxID=1678 RepID=A0A2A2EJD9_9BIFI  ali  33  1MRRHAAMEQQLDEAEAARRCLHATDNGVRQALMRRRRAGEIVSPMPGLFIRRTTWEALTPIEQMCHLVRGLAQIHPDWVFGGVAAACILGLWVKEALRSGKVDVMCTMRNGKGDSRHMHRIRSGAGSCIRVDGVKVTTPERTAADCARLPFDAAMQVVCCVLHNGV----ELTSICAAHNGEIGKARAVFQYATPLVENGGEAKALARFVQCGFAVPQMQV.. 226
430 1.000e-37UniRef50_A0A1Y3Y5A7 Uncharacterized protein n=2 Tax=Coriobacteriaceae TaxID=84107 RepID=A0A1Y3Y5A7_9ACTN  ali  24  7.KAWGELLACVTDALSARRCYSPASYGEAQMLRRHIRDKSIVEPFPRLFAPGDAWEQLARLDQERYVIRGYAWAHPNAMFCSLSAAVMHGLPVTYSLLGTLHLYASSPSQRGGKRVEMRYRQHP--SCVKIDGVPVASLVEATVDCLCCDFEDALALADGCLRIARADASYLRREVERGCKGVEKARDVARWADGRAESGGESIARAVMIRAGLPPTDIQ... 227
431 1.000e-37UniRef50_A0A1R4GFX9 Uncharacterized protein n=2 Tax=Frigoribacterium sp. JB110 TaxID=1434829 RepID=A0A1R4GFX9_9MICO  ali  20  61..............................RFDHAVRRGELRRVRSGVYVPSHDWEQLPPWDRYLVRVHAFALKAPYAVLTHESAAALWGLPLLGAQPHIH-AIAPRSGDARLVGDVQWHHLKDEPDVVTTPGAALTPPVDTVVNLARSRHPAARVAADALLRLGDCSSDLLLDANESRQRGRAAARWPLTTTTPLPESPLETLSIVEIEWLGFEAPELQVS. 254
432 1.000e-37UniRef50_A0A1G6J293 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Nocardioides lianchengensis TaxID=1045774 RepID=A0A1G6J293_  ali  16  1MMIPKRDPDDPRNGPVILRQQLLKAGWNDRAIRRRIHSGQWTRIRNGAFIPTEQWKQLDDAGRHGLRARAVQQQATEVVLSHVSGLPEYDAPTWGLDLEVHVTRPDGKAGRHEAGVQQHCGTVEKEDVVTRNGVQVMTATRLVLEVTTFGDAEALVVANHLLHVEATTPEMLRARYESMWPKTLITDLVLRLADPRIETPGESRTFYLIFRQGLPRPQPQY.. 226
433 1.000e-37UniRef50_UPI00082DFA03 hypothetical protein n=1 Tax=Rhodococcus kunmingensis TaxID=408066 RepID=UPI00082DFA03  ali  20  4............PDEFMTRRSALDLGLTDTRIHAATHSGALVRIRHGALADPAKWAALDRDEQQRLRVRAAAARSAECAVSHDSAATLLRLPLLDPWRTIHFTALDDRDGHRSRVRTRHRGPLDARDLAEVEGVVVTSLARTALDVAREGFAQAVCAIESALRAG-VERDDLEETLARMGRGNAMARGALSFADPRPESVGESWSRVLMHWRDIPTPRLQ... 216
434 1.000e-37UniRef50_K0F3S7 Uncharacterized protein n=20 Tax=Actinobacteria TaxID=201174 RepID=K0F3S7_9NOCA  ali  17  4..............GPIQRSEALAEGFSDHELRRLTARCGWHRIRPGSYLPPQVYETLDRQQRYSAFVHAAAAHLSAPVLSHQSAAVVQDLPLWGLALDRVHVTRHRAGGGRRRHLHVHCAPFEEADVVSVGPLRAFTPARTVADIART----------AAFRRFQLSHETLCQALAEGRPGFRAAARAIRLLDGRSESVGESRSRVVLADLDLPTPELQ... 214
435 1.000e-37UniRef50_A0A1G6Q1P9 Uncharacterized protein n=1 Tax=Sanguibacter gelidistatuariae TaxID=1814289 RepID=A0A1G6Q1P9_9MICO  ali  21  17..................................................PTDSPARAAHARTTARIAAVHAGLRTEHWFCGESAALIHGCDTVDLDGSIHLIQRHNQQRGAHPEVKRHTAALRADEMTVVDGIPVTSLARSVVDCARLSERQALVIADSALRRGL-SVDDLESALARGSRGICKACSILPLADARAESPGESLLRLVVVRGGLPAPELQI.. 189
436 2.000e-37UniRef50_M3VD65 Uncharacterized protein n=2 Tax=Gordonia TaxID=79255 RepID=M3VD65_9ACTN  ali  20  10...........DRFGLVRRAAAFEAGWTDAMLSAAVRRGELIRVAIGVYAIAGVDLDGPEGADRLYRLRSIARDGGATVLSHQSAAAVHGLPLLKPNREIHVTSLTRGGGLIRGGRNVHGGHLDETQIVDVDGIRVTDVVRTAVDVAEAGFAQALTVFDAALRAGADRASLESELGRRRTKGAREARTAIVVADGRSASVGESWSRAQMIEDGLALPDLQVE. 227
437 2.000e-37UniRef50_UPI00085A3550 hypothetical protein n=1 Tax=Isoptericola variabilis TaxID=139208 RepID=UPI00085A3550  ali  21  31..................................AAADEGLQRLRPGFYADPAAPPAATRRELVLARVAATYRTLESYWFSHETAALLHGLWTYRLHDRVHLTQLYPPQVRRRYRLTRHWTPLPRRDRTTVAGLPVTTIERTAVDCARLPPAAALVVLDCALRHG-ADLRLLEQMLERGKRGVVQARRIVALADPGAESPGESLARFLLLEAGLPRPQTQV.. 229
438 2.000e-37UniRef50_UPI000A7C6D3E hypothetical protein n=1 Tax=Phycicoccus cremeus TaxID=587636 RepID=UPI000A7C6D3E  ali  20  3........................TALTRHQVQGCLARGDLTPLRPGLYAVPEPWSSLAPRERHQLLADNVGRADGRAALSHVSAALVWGLPNPHGELPRVELTVTDRPRVSRANAHLHRADLPQRHLREVDGLLVTSPARTVVDCFRLSLGDAVAIGDAALRGGLTSLLEIEDVLDVRWPCLGRARDGIPLLDGGRENWLESYSAAALYRQGIP........ 198
439 2.000e-37UniRef50_A0A1N7GYE5 Uncharacterized protein n=2 Tax=Williamsia sterculiae TaxID=1344003 RepID=A0A1N7GYE5_9ACTN  ali  21  12..................AAFCSSRGLSPSALGR-----DYRRLHRGIYVEP--HSSMSEFDR---IYAAWLRAGPDAVVAGMSAAILHGVQYFDRDADVELIRPATGQGRRRNEVRIIRTCLEPADVQTIRGIPVTTPIRTAYDIGRRPPEWALGRLDDLVRTTGIDLVELWAYIRPRRRGIWQIRELIKHIDPASESPGESWLRHVMITRGLPRPQTQI.. 207
440 2.000e-37UniRef50_A0A0M8MM57 Uncharacterized protein n=12 Tax=Microbacterium TaxID=33882 RepID=A0A0M8MM57_9MICO  ali  20  13.....................ALHRAADLHRPAAAAARGQLHRVRDGIYADAEEWAELTPWRRYLARVQAVAMTRPDAVFCLESASALLGLPVFGDPLT-VHTLGGATATGRECGGVRVHAGCGDRRLVSAGGRTVTSLADTAVDLARHRHPAGVATADAALRLDPTLSTDILTAIRESSRGRRRARDPLREADAAAESPLESVSRCVIRWLGFAPPILQ... 214
441 2.000e-37UniRef50_UPI0003778388 hypothetical protein n=1 Tax=Kribbella catacumbae TaxID=460086 RepID=UPI0003778388  ali  18  18..................RQDAVECGYTVSQIRERLRDGRWISVRRGFYAELVDRAGSPPWERQAAHAAARALAGSPVVISHQSAAVLHGLPTWGLDLDRVHVTRTDRGHGRLARTSHHVGELPARAVTTTEGLPTTTIARSVVDASCSGYEVAVALCDGALQSGRVTKAQLSEELGQGWPGTCTAQAAVAFADGRSESVGESRLRVLMDTHGLPEPELQV.. 230
442 2.000e-37UniRef50_A0A1Q9VTC4 Uncharacterized protein n=3 Tax=Micrococcales TaxID=85006 RepID=A0A1Q9VTC4_9MICO  ali  23  2......................LARDVPRPALAAAVADGTATRLRRGAYLLATTGAAAEARTAALARIEAVSRQLDGAWFCGPSAALLWGLPLWRLPRRVHVVQRNVPGRGAGADLVRHRAAVAPDDLTTVRGLPVTTLARTVVDCARLPPREGLVVADAALRRGFDADLLRRRTVETRGRGVVRARAVLGAADGGAESPGESVTRYAVLRHGLPAPRTQI.. 206
443 2.000e-37UniRef50_L7L5Y9 Uncharacterized protein n=4 Tax=Gordonia TaxID=79255 RepID=L7L5Y9_9ACTN  ali  22  24...........DENGLLRRKKVLETGVTAREFDAAVAGGALLAVGRGVYIDAAGLRELTYRARCLAAVRSDGDDPPIRVLSHQSAASIHRLEVLDTERTRVHFTNGKAAGGRGRRIVIHTGKLNDDDVTVLHGVSVTGLERTAVDIALTSFAPALAVFDSALRHG-ADPDRLRQQLEVARTGVARARVALRYASGLAANPGESWCRAQIIAAGFPVPVLQ... 243
444 2.000e-37UniRef50_A0A0Q5LGY7 Uncharacterized protein n=2 Tax=Frigoribacterium sp. Leaf164 TaxID=1736282 RepID=A0A0Q5LGY7_9MICO  ali  20  9................ATSRQLARRGVDRNAQSRLTRRGVLVRVAPGAYLEGDVWQALDARGRFVARARAVVATRTRLVVSHRSAAVLFGLPVVGGLPDRLDALRTEVSGGRSEASIRAHRSTLPCDPVPIGDFWLTPLARTLVDVALHSLIVSVPMIDHALLHGMVELDELSDELERRPRGARRARSALGLGTPLSQSPLESLVQVRCFEGGWRRPEQQV.. 217
445 2.000e-37UniRef50_UPI00069848EB hypothetical protein n=1 Tax=Arthrobacter sp. IHBB 11108 TaxID=1618207 RepID=UPI00069848EB  ali  19  45..............ELQTRPQLNEAGINHLLLDEFLDLGLVTRVRSGVYLRTEVWKNTQSWERADLQLSAHSLLAPGHYLTHQSAARLHGLRTWGLDQRIHVNLPYRWSRDGAADLVSHYSVVSPNEERLVQVFRVTSLERTVTDCARLGFERAVVIGDHALREG-ANLTQMNTMLAPGSRGVRRARAVLAALDPRSESVGESRTRLLLSTLNIEQPDPQ... 259
446 2.000e-37UniRef50_A0A0B2Y5T0 Uncharacterized protein n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A0B2Y5T0_9MYCO  ali  21  1..........MPASPFLGSVATHAGLVTAHELRTNYRA-----IYRNVYLPNDI--ALTP---ILRAQAAWLFAGPEAVLCGVSAAAVHGIEWLDVQAPAEIV---RTNCHSPDRLRVRSYCLAPDDVCQVDGMRVTTVARTILDLGRLPRDEAVPILDALLNKSGIDPDEVLAEANRGIRGIDRLRVSLAQADGGAESPLETRTRLQLWNMGIPGLRTQI.. 201
447 2.000e-37UniRef50_B6G898 Uncharacterized protein n=1 Tax=Collinsella stercoris DSM 13279 TaxID=445975 RepID=B6G898_9ACTN  ali  32  1.................................................................MLIKTLSKRHPDWVFSSFSAALVHGLQVPYAHLSALHVSVEPGGNRRRCAGKVSCHSSEAPPVTVVQGIRVTTVEHTVMECLCRSFRDGLVVADSALHCSLTTKSLVEREWGRGKRGIRQARATLAYADGGSESGGESLVRAAIIELGFAVPSLQV.. 169
448 2.000e-37UniRef50_A0A0Q7UEC9 Uncharacterized protein n=4 Tax=Agromyces TaxID=33877 RepID=A0A0Q7UEC9_9MICO  ali  21  22.RDHRAMDERIELAGLIRAHDLRELGVHPSAVQRLEQRGLLVRVRSGVYAKHDEWQALTPDDRYRRLVATAGAARHPLVVSHRAAAAMHRLPMVGRTPALVETAAQHRGGGRRTAHVAARRAGPVPTVETIDGVACTSLLRTLVDVAVSPLVRSVPMLDAGLTRPGVTRSALQLELEAPVRGRAKAAQAIGFADEHSGSPGESVSRVRIHELGFVAPELQV.. 250
449 2.000e-37UniRef50_A0A2T6LBM9 Uncharacterized protein n=7 Tax=Promicromonosporaceae TaxID=85017 RepID=A0A2T6LBM9_9MICO  ali  21  8...................AVALTLDHDRNKLAAAARAGEVLRVRRGAYCAPDQPSSAPREERALARVGALHQLRADHVFGHTSAALLLGCRVWRTPAETHVYQRYRASGHAADDVRRHAWTIAPEDITAASGLPVTSLARTVVDCARLHPLEALVIADSALAMGIGRETLLVLAAQPGHRGKRRARRVIELADAGAQSAWETWVRYEILRRGLPRPTTQ... 218
450 2.000e-37UniRef50_D5UTL8 Uncharacterized protein n=13 Tax=Tsukamurella TaxID=2060 RepID=D5UTL8_TSUPD  ali  16  4...............LLTRSYLLATGWTSAGISRAVAGAELIRLATGVYAKADDY---PPWELYRMRVLATA-LSCDGVLSHESAAVLHDIPVLQPSRDVHFTVDRSHGGGRRPGVHVHPRPLGDAEITTVDGARVTSRCRTALDVAMSGLIRAVAAIDSVRLARRVTLTALTETLDRRRRGSAIARRALALSVECSESAGESWSRMLMHAWGMPRPRLQ... 217
451 2.000e-37UniRef50_UPI000D687026 hypothetical protein n=1 Tax=Nocardioides sp. YIM ART13 TaxID=2173172 RepID=UPI000D687026  ali  17  4....ARMDSLLRGIGVFLRREAESFGYHDREMARLVRSGVWHRVRRGAYTFRDSWDQLNPHGQHLLLARAVLRTANTPVLSHASSAIALGADIWDIPLDEVHLTRHDGKCGRRAGVRQHRGVVLPEDLKVSGAVPHMSATRTALEVTTADVEHSLVVVNSLLHRKLTTQEALAERLMQFWPATLATDLVLRLCDDRIESPGESRSAYLFFRGGIPRPKPQY.. 229
452 2.000e-37UniRef50_UPI00048BEC23 hypothetical protein n=1 Tax=Nocardioides sp. URHA0032 TaxID=1380388 RepID=UPI00048BEC23  ali  18  9..........LRDDNLMTTADLLALGYHDKAIARLVKRGELVRIRQGAYTYAAHWEQLEERGRHDLLCRAVLRRAVKPTLAGPTAARVLGAPTWDLGEEIHINSVDRKADRRNAGRRPHRGDLRVEDTTIRSGLPVTSGTRTALDLIMTDEEHALVVIDGLLRAGETTLGLLERRAPGMRPRSLAVPVILMHADGRHESAGETRTAVMLRRANLPRPDPQY.. 223
453 2.000e-37UniRef50_A0A229VY89 Uncharacterized protein n=2 Tax=Bifidobacterium vansinderenii TaxID=1984871 RepID=A0A229VY89_9BIFI  ali  28  1.........MIQTAHQELRCAYASNGTERTRLQRHLKSGIICTPFPRFYADPQYWNALSVRERLLHILRTDAHRHRGWTYCGPSAAVVWGL-TDSTTLCSDIHVVRHTHCKNRDSSRIRFHQRKNYSSVEHEGIPVTSLTETVFDCARLLYPEALAIVDKSLQLYATDIDQTHDHLRRGKYGGGRAMVVLHHADPSSANGGESIARGYMIQWGFLPPDLQ... 220
454 3.000e-37UniRef50_UPI0009D934A0 hypothetical protein n=1 Tax=Aeromicrobium massiliense TaxID=1464554 RepID=UPI0009D934A0  ali  14  79.RQSHGMDDLFDLLGHQGRREALALGWHDRSLRQAVRAGQLVRARHGTYVGAPRWRAASPADRLAMLVATLARLGPGYVLSHASAAAVHGLDLFGTDLTTVHVTSTGPHGRVEAGVVHHEGVLDEADIVVVRGVPVVRAPRAVVETACAATVEGVVTASAALRRGLTDDALLSAERLARHKGIRGARLGLSLADAGCHSAGEARSLYLCWRHRLPRPQCQHE. 306
455 3.000e-37UniRef50_UPI000DD438E9 hypothetical protein n=1 Tax=Kribbella sp. NEAU-SW521 TaxID=2185285 RepID=UPI000DD438E9  ali  19  70............QGGVFSRAQAIGCGYTLEQVRERLRDGRWERIRHGQYAEPLGLAHLAPWDRHRRQVHAVVSKRPDSVVSHQSALVLHGLPVWGLELAEVHLTRDNFRGGLAGGVRHHRGKLTAGELTEVQGLITTTWPRAVAETACTSFEAAVVIADAAVRRSQSGLEEVHSVLDEFWPGSPTARAAVAFADGRSESVGESRLRVLMHNQGLPAPLLQV.. 288
456 3.000e-37UniRef50_A0A0Q9NUX7 Uncharacterized protein n=3 Tax=Arthrobacter TaxID=1663 RepID=A0A0Q9NUX7_9MICC  ali  24  13......................ARLGRDTRALSRRAAAGELRRIRRGVYVQSSDWDRLPSWAKYPVLVAAASTLHSRTVFCRKSSAALWDLPVLGRPQLVHACTTDEGGGRSGAGVVRHYVDPRSLEIEERRGLLVTSRLRTVLDLAAFEFEQATAALDHVLRLPAFSRTELHAGIRDSAAAARRIRTAIDFADPASESPGESVSRALMHRLGFKPATLQAE. 220
457 3.000e-37UniRef50_F6FR89 Uncharacterized protein n=4 Tax=Isoptericola TaxID=254250 RepID=F6FR89_ISOV2  ali  18  19MRAPDSPLRTMLSAALDGPPAVPESLVSTTAVARRVQDGTFQRVRPGVYLSAEPPSDSGYVDRLLAEVRGVNRASGRFWFSHATAALLHGGWLYDVPELVHVTHTFHPHVARDPRLRRHHTTLPERDRAEVGGIPVTSIERTLVDCARLQPTSAVVAADSLFRLG-ADPAIVSRIMSTGKRGIVQARRTLEVCDPRSGSPGESASRVVAVDDGLPRPECQIE. 250
458 3.000e-37UniRef50_A0A1S7B762 Uncharacterized protein n=8 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1S7B762_9MICO  ali  25  19...................RDARRVGAE-RLVSAAHRDGDLVRLRKGIYVPEPIWSSLSPDDRYRVRIAAAVALRKDALFSHYSAARLWGLPIVGPWPPEVHTLTSGDRGGRSAPGIIRHTTQGSVTRRMRYGLAVTDPARTVVDLARARLEDAVAVADAALRLKLTDETALRSLARPGRRGGRQVRFAIEFADPLAANGGESKMRVVIARLGFALPVLQ... 222
459 4.000e-37UniRef50_A0A2S9A5U2 Uncharacterized protein n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A2S9A5U2_9MICO  ali  21  1......MPLLLSDRAALTSPVPLATSAECRMLGIRVAATAHVRVRSGIYAPRTAYLTLPPWERYAARVHAFVRAHPAAVLCLESAAVIWGLPLFGETRDIHVFEADRSRSRRFGDVCVH-TSMHDRVVARRGSLLCTSMIDTVVDLSRLPPAEALAVVDAAMSRGPLDLTELRAAAQTTTRGSARQRWLWERADGRSESPTESVSRAVIEWCGFEDPELQ... 219
460 4.000e-37UniRef50_A0A1H0XU64 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Microbacterium sp. cf332 TaxID=1761804 RepID=A0A1H0XU64_9MI  ali  23  27.................................RAARRGELVPIRRGVYAPASVWNRLPPWDRYVARVHAVGVTRPGCVFSHESAAALLGLPVVGAPRDVHVLADAGVSGGDRGGLRVHTTR-DPREIVEVGGVSLTSATECAIDIARDRCELALSVADAVLRAGHVRSTDVLVARRSTSRGRRRARWSLHRADAAAESTLESLSRGTIDLLGYVEPELQ... 216
461 4.000e-37UniRef50_A0A1V1W3J0 Uncharacterized protein n=2 Tax=Nocardioidaceae TaxID=85015 RepID=A0A1V1W3J0_9ACTN  ali  19  21....................ELRAAGYDDRDITRMTRRGDLHRLRHGAYTFGAYWQGLDETERRKLVAHATLRARSPAALAGPSAADLYGVPVWDMGDEVHLARLDHKAGRRKGGKVQHRGTILAEDITVRGGLPATSGTRTALDIALADVPRALVTVNGLLHAQETTPELLARRAAAMRPNTATAPIVLGLADGRCESAGESLTLHLAWRQHLPRPDLQV.. 225
462 4.000e-37UniRef50_A0A0Q9M7F3 Uncharacterized protein n=3 Tax=Intrasporangiaceae TaxID=85021 RepID=A0A0Q9M7F3_9MICO  ali  14  3....PDLRRLLATGGVLDTATARRGGLSPDDLRCAVSAGDLRRVRRGLYAAAPVWDAAPPWERYRLTVVGVMAAHPRWVATHHAALVLHGLPMHGVDLTTVDVAGTVGTTKLRHGLHVHRLAADHQHLVTAQPRAVPPAVACLQVAARDGVEAGVVALDGALHERRCGTDDLVAALAHPGHGIAHARAAVERADGRAESPGESRTRLVLEALGVEV....... 217
463 4.000e-37UniRef50_A0A0Q5S1P6 Uncharacterized protein n=1 Tax=Frigoribacterium sp. Leaf186 TaxID=1736293 RepID=A0A0Q5S1P6_9MICO  ali  19  8...............LIRRTTWLRGGRDDHELRRRVRVGELVRVAPGAFVPASTWTEADPRQRHALRVRGVGRLTSDVVVSHESALALHGFPLLGQWPERVHVVDRRRCRTTSSTLVRHAARVGAGDLTTRWGMPSLVPVRAALDVARTDLRGGLVVIDHGLRSRAFDRVVARSYLEARSRGTKVAALALALADPLSESAGESLSRAGMYEARLARPVLQ... 217
464 4.000e-37UniRef50_W5TM72 Uncharacterized protein n=15 Tax=Nocardia TaxID=1817 RepID=W5TM72_9NOCA  ali  18  28........RTAAVAGVHRRRDVVSDGMSDDEIRRRCAGGAWRRVRRGTYAESTAVADPDPMARHRLAVAALLEMASDAVVSHQSAAVLLGAPMAPALLDRVHVTRNRRNGGRIKT-NVQVHCAPVEFVADRAGLVVTSPARTVVDLARTAFEPAVVVGDALSREFGVTAADLARELARGRRGAHTARRIAGFLDPGSTGVAESRARVLLWRLGFPP....... 238
465 4.000e-37UniRef50_D7C078 Uncharacterized protein n=5 Tax=Streptomycetaceae TaxID=2062 RepID=D7C078_STRBB  ali  19  13.......ALAASQDRVLTTAQLREVGAERADIRRMIRAGQWVPLTRGSCWVGRGARGPSLRARVRGL---LLTCGSQAMAAGLTAARLLGIQGLPPDDGTLHLATPHDTIRSRQGVHIHRTPVPDHAHTTLRGIPLTTPARTCADLLLLPRAEAVSMLDSALHQGVLTSADHLTLHLSGRPGARQARGWVPLADARAESPLETRIRLICLDGGLPPPVLQ... 225
466 5.000e-37UniRef50_A0A1G6GQN1 Uncharacterized protein n=2 Tax=Sanguibacter TaxID=60919 RepID=A0A1G6GQN1_9MICO  ali  17  1MPRRPGPASPAQLNRMPLPRVHLARSYTRSHVAERVRSRAWEQVRPGAYVDAEEPHARRRRHALARIVALAEQSSGPLTFNLVSAALLWGLPLLIMSPQTHIVQRSRPTGHGALDVVRHHPRLPEEHRTTQHGLSVTTLERTLIDCAALPPLAGLVVADAALHIG-ADPDVCAEILASRLRGVVRAREILALADAGAESPGETTVRFTLLQLGLPVPETQI.. 226
467 5.000e-37UniRef50_A0A1S2N1W8 Uncharacterized protein n=2 Tax=Kocuria kristinae TaxID=37923 RepID=A0A1S2N1W8_9MICC  ali  19  1..........MAPHLLLVAAELRAQGHSLAASYRGVREGRLITIRRGVFMETETWNALSPTQQHSAHLQAFHRTHGDYLFSHTSAAHLHGWALLRREPRLHIS-GDPRPGGNPPGVSRHHLPDAAAHATLLHGLPATTVVRTLADCLCMTPLAALILADSALHHG-TPADQVRDLLETRCHGVRRALAALSLADPRAASPAESFARHLIHTHGLPRPELQV.. 215
468 5.000e-37UniRef50_A0A173LPD1 Uncharacterized protein n=1 Tax=Dietzia timorensis TaxID=499555 RepID=A0A173LPD1_9ACTN  ali  17  34................FTHADLRAMGYHQNAIARNVRTGRWTRPLSNVYLL-DDPKEFSNLERHRGLVRAYSRKFGGAVASHWTAAALWGLPTSIFSQNTMAFTENRPRQGRPRYLTVYQRPLGTEDIVTVDGIACTSLARTVLDCSLLGFTQAVCSMESALWEQRLSRDDLAEQLDRGRRHIGLARAAFEFAGTKSQSVFESRMRLFLRHHRIEQPEQQVE. 250
469 5.000e-37UniRef50_A0A1E4M8F1 Uncharacterized protein n=2 Tax=Micrococcales TaxID=85006 RepID=A0A1E4M8F1_9MICO  ali  29  6....................................RGSDFVRVRRGVYAPRGDWA--DEGGRGLLRIRAVLAAVEPPLFSHRSAATVWGLPFLRAGAPIETLVAPARGGRSGRGIVRRCVDLDAVSECFVQGLRVTSLERTLIDLARLPFASAVMAFDFAVRAPLTTIELVTAELARLRRGLARVMRAIEFADPRSESPNESLSRARIFELGFPSPDLQVE. 200
470 6.000e-37UniRef50_A0A1H2ATT0 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=4 Tax=Micrococcaceae TaxID=1268 RepID=A0A1H2ATT0_9MICC  ali  23  2................VSTGQLAEAGLESRMVAEAVKAGVILRLRRGAYVRRSYWNTLKPWNQDWLMIMAHYESTGGVAYTHVSAALLHGCDVWNTGSAVHVTTQSNSRTSAGVDVRTHRLPLAAGDLATLRGILTTGLERTVLDCARLPRAKAAVIGDHALRKG-ASLEGMRRLLDDGTRGSRRAAELLDVLDARSESAGETRTRLLLYSFGLDRFTPQVE. 216
471 6.000e-37UniRef50_G7H7I3 Uncharacterized protein n=3 Tax=Gordonia TaxID=79255 RepID=G7H7I3_9ACTN  ali  21  6..........FDGEGILRIADAKACGIDPRQIYQAERDQRLVRVMPGVYVLP---VERRPEQRHRLRVLAAQ-LPPATVVSHSSAAVVHGLGMLRPDLDQLHLTSVRGAAGYRRKMRLHPGRLGEDDIVEVDGVPVTSKERTAFDVARWGFAGALSVFDSALRAK-ADRAVMEQFCLSRQAGVGVARRALALADARAENPGESWSRAQMIQAGISSPRLQ... 214
472 6.000e-37UniRef50_UPI00069708F7 hypothetical protein n=1 Tax=Luteipulveratus mongoliensis TaxID=571913 RepID=UPI00069708F7  ali  20  27................................RARDESGEWTMVRHGVCIATRHWAQLGPNDRYLAFVHASALMARSGFLSHHSAAAIWGLPIADPWPRAVHVLVPDTTRASRSGLVIRREDEAQVHVA-HRGLRVTPPARTVLDITRGGLLNGLVAGDHALREGVCTRDQLVVELRRHTPGLSDCRNLVDIVDPMAASPGESLSRGQMFLLRFPRPRLQV.. 222
473 6.000e-37UniRef50_A0A2T0UNK0 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Tetrasphaera remsis TaxID=407159 RepID=A0A2T0UNK0_9MICO  ali  17  33....SDAPSPFDPSRLRLASDLRRRG-DDPVAKDDKGRRLWTRVRHGVVIASATWVTLSPEQRHAALVHATALRSSTTVFSHTSAAAVWGLPRVTAWPTHVEVTSTARRVRSS--GRIRRHALPLTGVDEQAGLPVTSLSRTLIDLGRTGLADAVAATDFALHHAMCTRTDLLASLDPGVPGRARAQLSVDLAHPGGTSVGESLSRVQMFRSNIPKPQLQV.. 253
474 6.000e-37UniRef50_A0A1G6MMM3 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Microbacterium enclense TaxID=993073 RepID=A0A1G6MMM3_9MICO  ali  14  1......MRLQPPPLPLIRAVDAARMGRYPHA------DRALRRLRPGVYAEKVAWDALPEWNRYAARVHAYALTNPRAVFSHESAATLLGLPVFGHPRMIHLF-DARRTRSLVHGDVVVHTSLDGRTMCNVGDLRTISASETAIDLGRLPPALGLAVADATIRVHGVTREQLRETADAQRRGRRRLQWVLANADGAAESPAESISRAVAQWCGFPAPILQAE. 212
475 6.000e-37UniRef50_A0A0L7BLG1 Uncharacterized protein n=2 Tax=Bifidobacterium animalis subsp. animalis TaxID=302912 RepID=A0A0L7BLG1_9BIFI  ali  30  1......MATIDAQACTEQRCILPRNPREKRLLTRRCSAGALTRLYPGLYMHPQYLAQLNPFERKMHLVRALHLLHKQWVFAGSTAACIHDLQIPYMALGSKIHIASPSKPHHNDCAQLQRIHNPNAEWDFVNGVPVTSLTRTAVDVNTMEDCCAITVLDSCLRAG-VGEEDLLAACSLPNDNVNLLRAMLPYTTIASENGGEAYTHAVIFRLGFARPRQQVE. 217
476 6.000e-37UniRef50_A0A087ATA2 Uncharacterized protein n=3 Tax=Bifidobacterium cuniculi TaxID=1688 RepID=A0A087ATA2_9BIFI  ali  31  18...............................VRRYQQAGLLTVPYRGLYDDTATWCAKDPHEQARTLLRTLHRLHPQWVATDIAAQDFQGIEHGRQLHTDIVTITDRAKRHTGPGAQLIRMRVPALDIVTVRGLPMPTEVSVMVAVPHLPFTSALPMVDSALRQGLST-ERLEETAAFLRRLDGYVRALLRCGDPLSENGGESYVRAVIMEMGFAAPRLQVE. 213
477 7.000e-37UniRef50_A0A1R3W2I7 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Microbacterium sp. RU33B TaxID=1907390 RepID=A0A1R3W2I7_9MI  ali  21  2............................................RPHVYTDAAAYRRLAPWDRYLTRVHAALMTFPDAVLSHESAAAVLGLPVFGEPRDIHLF-SDRRARSKRFGDVLIHTSLSSRPIWEVGGVVVTSPLATVADLGRLPPAFGLSVADAALRAFGVEARDIRGLVDGWRRGILTLRWLLDRVRPESESVGETVSRVVIEWCGFEPPELQ... 179
478 7.000e-37UniRef50_A0A1Y0HS85 Uncharacterized protein n=1 Tax=Cellulosimicrobium cellulans TaxID=1710 RepID=A0A1Y0HS85_CELCE  ali  20  9...................RTVLAAEVPRPQILAALDAGTAFRLRRGAYLLGADPSRSLPPARAEHRLAAVARQLDGRFLYGPTAALVWGLPLWRAPAHVHVVQRYVPGRGAASDLVRHRVTVAPDDLTEVSGLPVTTLERTVLDCARLPAREGLVVADAALRRGADPEDLRHRSREARSRGAVRARAVLAVADPGAESPGESVTRYAILRHGLPAPRTQV.. 217
479 8.000e-37UniRef50_A0A255H9G2 Uncharacterized protein n=1 Tax=Propionibacteriaceae bacterium NML 130396 TaxID=2016507 RepID=A0A255H9G2_9ACTN  ali  20  2...............LRRTASLTAEGATSAQIRTRLAKGHLYAVRRGVYADDPLPAPRTVERHRQLIEATMPLLLEESVVSHASAAVLHGLPVWRERLERVTVTRPGVPGNRSRHVHLHRAELPDTDVTTVAGFRVTTMARTVLDLARLVRFEEAVALADAALAKEVPRALLQERAAERVRGARLLRSAIEFANPLAASAGESFSRVVLHRLELPAPELQV.. 209
480 8.000e-37UniRef50_A0A2S5YMF2 Uncharacterized protein n=1 Tax=Rathayibacter iranicus TaxID=59737 RepID=A0A2S5YMF2_9MICO  ali  19  6..............ELLVARELSRVGSDARRLRPDRSKGRHRRLAPGVFVEARAFGELPDRDQHLLKARAIVRTRGEAVLALHSAAAVWGLPLLSRSPPQVHLLGAPGVADGVDTIR-HRERIRDGDVVEHDGHLVTSLERTVLDLARLSREDAISAIDHSLRLGGLAQGDLLERIERGYRGVKQARQLIALGDGAAESTGESVSRLRMSDCGVPTPVLQ... 216
481 8.000e-37UniRef50_A0A0L6CPG7 Uncharacterized protein n=3 Tax=Luteipulveratus TaxID=745364 RepID=A0A0L6CPG7_9MICO  ali  25  16.....................................DGAHVRLRRGLYVPRAAFDELTAAERLQLAAYAVDHAAQGATFSHHAAAALWDLPIVGTWPTLVERTTSAGSKGRSPGARR-RRREAEPAPVEHRGLLVTSPARTVIDLARARLESALATADHALRLGLCSRSDLRAEVEAGARGKRKATLVVHLADPLSESVGESLSRARMFQLNVPRPALQ... 202
482 8.000e-37UniRef50_E8N6T1 Uncharacterized protein n=20 Tax=Microbacterium TaxID=33882 RepID=E8N6T1_MICTS  ali  20  2...............LFTREELLDRDVTQRELRAAGVGGRWMRIQPGIYVERAAFDALRPAHRHRAVVAAVGRSRGRGVVSHLSAAVLHGLPQYRRPRPVSVTIPDATHPPSRAGLRRHTDELGEADVIEIDGIRCTSLERTIFDIARTPLETSVSCADAALRRGRTFDADLQVEWRERFARRARARWVGGFADGRAELPGESVSRLQLHRLGFREFDLQV.. 225
483 8.000e-37UniRef50_V8CSY7 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=V8CSY7_9ACTN  ali  18  7..............GLIRRKTVVEGGFSDSQLRAARRAGIIQPVVRGVSAPGGV--ALSQDDEYRRRVIAVAGRSRVRVVSHQSAAVCHRMQLFRPDQRYVHLIAR-TKGKREGDVHVHHALLADTDIVLIDGIRVTSRAVTACDVARAGFEQAVAALDDALRSG-VTLAELHTIAARHAAGIGMFRRALLTADGDAESVGESVSRALMAGWDIPTPTLQTE. 215
484 9.000e-37UniRef50_UPI00041E4328 hypothetical protein n=1 Tax=Cellulomonas sp. URHD0024 TaxID=1302620 RepID=UPI00041E4328  ali  21  4....AEIGLVARASGLVSAGDLRRLGHDSRRLERLAAAGVLVRVRRGTYVEAEVWAGAGPGGRHRLRVLAAAGDLPGAVFSHQXXXXXXXXXXXXXXXXXXXXXXXXNGGGRSSGQLRWHGSELPPSPEAHDGVVVTSAARTVVDLARTSFAAGVTAADHALRTGLVTRAVLSDEVSRSARGVRRAKAVVGFADERAESVGESLSRARIHELGLEPPQLQVE. 224
485 9.000e-37UniRef50_A0A2T0KPV9 Uncharacterized protein DUF559 n=2 Tax=Actinoplanes TaxID=1865 RepID=A0A2T0KPV9_9ACTN  ali  20  1MPRPPTIPTPLRNQPFHGSTAIRDGLIT----RAMLRSPIWQRLMHDVYAHRDTDMD------HLAWCRAVALLPPGAAIGGLSAARLWGVETEGT--QVSVALPRDRWLREDDRLQTHHTTLTPDDVTTVDGIPVTTPERTAFDTGRLRRADALVVLDAMLHRHLLHRERLQPMIVQRWPGITQLTALTRLADPRAESPMESHIRLLLHDARLPPPVPQFE. 214
486 9.000e-37UniRef50_A0A1T4XUZ5 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=4 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1T4XUZ5_9MICO  ali  21  8..............RPRATDLLLARDLDPDTLRQLQRSADTRRLRRGVYVATDSWVGFDTHSRQLANILAVDSTHRHPVFGHVSAAAIWGLPLADRAWPAEVHVIAGQSARSKNGVVVHRQQVDDGDVVERNGVLVTSLERTTIDLARMPFPVAVAAIDLTLRAGRLAREQLIEALLRSPRGRARARRAIDAARVGADNAGETLSRLAIIKLGFPEPLLQV.. 226
487 9.000e-37UniRef50_U7V2M9 Uncharacterized protein n=5 Tax=Rothia TaxID=508215 RepID=U7V2M9_9MICC  ali  21  28.........................GIGARRLQQLLREGHARRLAHNQYLSTLRWQKMTPEEKHLARVIAYAKSCENPVFTHLSAAILHGIPVLKIPRTVHV---RSVAGSPHSGISSHRHTLEAPITYFYGGVKATDVLSTVIGCARLPLEEALVVADGALSRQRVTRSALYEALTHSHKGSAKARRVAQLMSDKSDSPGETLTRLRLHEFGL......... 221
488 9.000e-37UniRef50_A0A2U0H4D5 Uncharacterized protein n=1 Tax=Microbacterium sp. Gd 4-13 TaxID=2173179 RepID=A0A2U0H4D5_9MICO  ali  18  8.............AHLLSTAELRATGRTRASIEADLREGRLVRVHRGWYMDAAYWATLYSEGRQVAQGLAVAARSERAIASHTTAAAFLLLPIARISPKKVHLVSARANGRVASDVARHRADLTASDVTTRFGVSVTSLMRTVCDLGHLPLESAVSLADAAMRAAELWRTEMREHLARRGRGIVQARWVLEFADGRAQRPGESISRLYLERLGFGRPRLQV.. 236
489 9.000e-37UniRef50_A0A0P0EDZ8 Uncharacterized protein n=4 Tax=Microbacterium TaxID=33882 RepID=A0A0P0EDZ8_9MICO  ali  22  27.................................RAIARGEAVKVRRGVFAEREAWRALAPWDRYLARVHAVALDHPGAVFCDESAAALLGAAVFGDPHVVHVSVPAGATSRQSGGIRTRVRT-ETDGILSSAGMTATDAVVTAVTLARHRHPVGLAVADSILRLRSLTRDMLRAEHRASGRGRACARWVIDRATPLAESPLESVSRAVTEWLGFPDPVLQ... 216
490 1.000e-36UniRef50_UPI0004C30C3F hypothetical protein n=1 Tax=Phycicoccus jejuensis TaxID=367299 RepID=UPI0004C30C3F  ali  20  3......LTRLQALPQPFFLDDAADAGVTRHQVARAVEREVLTRVHRGLFAVTDTWHGTASWDQHLGLADAAHRAHPGYVTSHVSAAGLHGLPLPRRLPLAVLTVDDDSTTSHHEWLDLRRGGLPDDERTSLAEVDLTSVARTVVDCSRLHLPESVAIADAALRSGACSAAELTSVRRRRWPGVTGADSAFAFADPRRESWLESASAVTFHGWGMPLGVPQV.. 221
491 1.000e-36UniRef50_A0A0Q7UBL4 Uncharacterized protein n=1 Tax=Microbacterium sp. Root53 TaxID=1736553 RepID=A0A0Q7UBL4_9MICO  ali  17  3...........EPLTVYTRADLEELGMTDRAIRKAVAERRAHRIRPGAFVKASEWRAAHSEQRQRAGAQAALQAARRPVFAGVTAAAVQGLPLFRERDDRVHVLAGASRAAAANAFVVRHAPLDDQDVVDFDGMLVTSLDRTVFDLIRMRPEAGVALTDAALRLVPVERDRLRERIARGARGIRRARIVADFADSRADSPGESASRWFLHVLGFRVIRLQV.. 220
492 1.000e-36UniRef50_UPI000C7849C3 hypothetical protein n=1 Tax=Nocardioides sp. 78 TaxID=2045452 RepID=UPI000C7849C3  ali  15  18..........IRRHGVFLRRDALDLGYRDRDLVRARKERVVHRIRHGAYVDQSLWDSASAEERHRLHVQAVLLSHRPGAVSHCSAASLHELAMFRTPLDRVHLTLGGASGRTTNDVVYHQGAIEDRDLVTVNDVLTVEPVRASLEVASSDLEPGVVVLDSQLARPAGDLAATWAAFERHWPHTLRLQMMVRLARPGSMSVGETRVRLLCWRCRLPEPVLQHE. 235
493 1.000e-36UniRef50_A0A087AGC3 Uncharacterized protein n=1 Tax=Bifidobacterium choerinum TaxID=35760 RepID=A0A087AGC3_9BIFI  ali  31  1MRDHAEMSRQLDEAERERRCLHPSGDPVRKALLRRVRTGEIETPMPGLFIRAQLWRSLGLVDQFKYIVRALAHWHPDWVFGGVAAACMHGLWIEYRLHALSVTVISKPEGTHCSSTYIDRRCRSGVHSVVVDGVRVTSLAQTVAECASMSFVDGMTLACCALRKG-IRAEMIMMCAVENSLMNDVLRKVLQYANANAENGGEAKTLAVFIECGFVPPAQQVE. 227
494 1.000e-36UniRef50_D0L6S5 Uncharacterized protein n=21 Tax=Corynebacteriales TaxID=85007 RepID=D0L6S5_GORB4  ali  20  1MDPDARLVRPIDRHGLIRRTAALGSGFCDNELSAAVKRGELIRLIPGVFVENGTRFAGHEGRQELHRAAAALTVRDDVPLSHSSAASVLGVPSLKPDLSHVHFVTGSPSGGSIKTRHLHAAAIDADEVVEVDGIAVTCLERMAADVAVCGFAQALVVMDQARRAG-ADAEMIGTILERRRRRGVRTARALLLSDPASESVGESWSRAQMIEAGLPIPRLQHE. 237
495 1.000e-36UniRef50_UPI000833476A hypothetical protein n=1 Tax=Sanguibacter suarezii TaxID=60921 RepID=UPI000833476A  ali  19  1MPRRPGPPSPTQLDRAPLPAVHLSRHYPRPHIADRVRRGEWVQVRPGAYVDTVPGEARRRRLALARIVAVADQSAGGLTFTRASAALLWGLPLHSVPAQTHVAQSSRPTGHGAPDIARHHGRPSQRQSTLRHGLPVTTLEHTLVDCAALSPLAALIVADAALHVGADPAACAEILRRAGQRGVVQAREILTLADAGSESPGETTLRFTLLVLGLPVPETQI.. 226
496 1.000e-36UniRef50_A0A1C7FTB6 CTP synthase n=1 Tax=Bifidobacterium animalis subsp. animalis TaxID=302912 RepID=A0A1C7FTB6_9BIFI  ali  30  1......MATIDAQACTEQRCILPRNPREKRLLTRRCSAGALTRLYPGLYMHPQYLAQLNPFERKMHLVRALHLLHKQWVFAGSTAACIHDLQIPYMALGSKIHIASPSKPHHNDCAQLQRIHNLNAEWDFVNGVPVTSLTRTAVDVNTMEDCCAITVLDSCLRAG-VGEEDLLAACSLPNDNVNLLRAMLPYTTIASENGGEAYTHAVIFRLGFARPRQQVE. 217
497 2.000e-36UniRef50_A0A2V5LDD9 Uncharacterized protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2V5LDD9_9MICC  ali  18  21................ATTAQLVGAGLADRVIAAALKHGIVYRLRRGAYVQAEHWRGLKPWDQDKLRLLAHLVTRGTPTYSHFSAARLHGLFVWHCGPGVHLTAASSVSGTSNPDVMGHREDLAACDVQSLRSVQVTTMEWTVVACARTGFAEAVIIGDHALYKG-ARIEVMRGMVDAMPGRRGVRRARLRALDGRSESPGETRTRLIIAEMDIPQPELQV.. 234
498 2.000e-36UniRef50_A0A0Q5VCN1 Uncharacterized protein n=2 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A0Q5VCN1_9ACTN  ali  19  11...........RQHGVVCTRDLVRAGIGPQEVRRLVDAGAWVRLRRGAFVATDVLAAADAEGRRPVLEASAVLARPSAVLSGLSAARVWGLPTSRR-LRGTVTLTDPTQHRRGRGYEVTHAPLPPGSTTTRLGLPVTTLARTVVDCARWTLEEALILTDAARWGGRLSEAELAEALAAGQRGVAAARRVADLSCDGADSPLETRTRLRLVEASIEIPQLQV.. 225
499 2.000e-36UniRef50_A0A1M4S0J2 Transcriptional regulator abiei antitoxin n=2 Tax=Actinomyces glycerinitolerans TaxID=1892869 RepID=A0A1M4S0J2_9ACTO  ali  21  123...........DLAGQGRRSDVLAQEAARS-------GGELIRIRRGVYVRRSEFSSLSRQQAHVVKVIAAQLTGDGAVLARESAAVIHGIPLVGAIPQQVQVVRPGRDGGRMSSGIRTLRAGHGFQTVLDDGVPVASVAQTLADLGRRPLRDVLAGFDAMLRAGRVTKEDIAAAAPERSRGRPRLYRTIEVADPNAESPGESLSRAVMIEHHLPMPALQ... 327
500 2.000e-36UniRef50_A0A0Q7JSG1 Uncharacterized protein n=1 Tax=Angustibacter sp. Root456 TaxID=1736539 RepID=A0A0Q7JSG1_9ACTN  ali  17  23................FSTAQAVAAGLSHREITTRVARAEWVRLRRGAYTTRQVHEASDEAARHVLAARAAHLLTARHAFSHTTSAVLHDLPLHELDLSEVHHLDGEGSGRHESKVWHHMGTVPPGDLTRAGDLPALSLSRTAFDVARVAAPSALVVADAALRRG-TTSADLRRQLEAGWPGARSASRLLPLADGRAESAGESLARLVFHDIGLDPNELQ... 231
501 2.000e-36UniRef50_A0A2U1ZWN6 Uncharacterized protein n=2 Tax=Miniimonas sp. PCH200 TaxID=2135789 RepID=A0A2U1ZWN6_9MICO  ali  16  2...DHPQPDLINDGAPFLVSRAPTLGLDRYGVRRLVQTHRLRRVFRGVLVDASVPDS-----RELRVAALALVLPAHAIISDHSAAWVYGVDTYPPGALRELVVKHGTSRSHPSRAAMRQTTMPDPDVVTIAGLPVTSPLRTIADLLRLWRPHALAAADALVRAGVARREDVMAYVGRGLRGTRQAQELAPLIDPRAQSHGESWMRLRMIDAGLPVPE..... 218
502 2.000e-36UniRef50_A0A1G6GF66 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6GF66_9ACTN  ali  21  15................RTRHELLDQGRDDAQIRAALKAGTLVRVRRGCYVDARPEGSMARAVSAAAATAAVAAQLGPVVFSHATAAALWQLPFLGAPPEIHLTLPREAGGIVRAGVHRHTGALAPEEVVEHRGIRLTSLARTLVDVARTGFRDGLVMADHALH-GSRDPEALRQARLRGAVGIGNARRMADFAVVAAESPGESLSRIVFREQKVPEPLLQF.. 241
503 2.000e-36UniRef50_A0A2N3QXC7 Uncharacterized protein n=5 Tax=Bifidobacterium pseudolongum TaxID=1694 RepID=A0A2N3QXC7_9BIFI  ali  38  1..........MHAAQQQRRCAFATDQSTYAAMTRRTAAGEYVSPYQGLYANRTHWQTLTECERSAYMVRALHCKKPHWVFTGFSALDVQGITHSRSSHDGAVWIADHQRHNSPRTPLRRIHLPSDVGTRIIDGIPVTAGAVTVVSIAHLPFMHALPLVDDALRKG-ATVEQLEECCRQLRVLTPALRTLLHCGNPKSESGGESIARAAIRLLGFAEPQLQVE. 216
504 2.000e-36UniRef50_A0A1B1NDB9 Uncharacterized protein n=2 Tax=Serinicoccus sp. JLT9 TaxID=1758689 RepID=A0A1B1NDB9_9MICO  ali  16  13.................ATRDLRALGLGSTEAEGLVRSGDLVRVRRGAFVSGPVWRAAPPWERHDLRARAVLRGGARVALSDHSSLAVQGVDLHGVDERVHLCRTDDGRSRQDAGVRVH-GRVPDAFVVDLHVGPVVTIALAVLQVARSGVEAGLVSADAALRERRTTRAELEAALATGWRAHAAAARVVELASPLSESAGESRTRWVLLTLGLGIPEQQAE. 222
505 2.000e-36UniRef50_A0A1H2L118 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=3 Tax=Jiangella TaxID=281472 RepID=A0A1H2L118_9ACTN  ali  17  13.....................ALAAGLTESAIRHQVRQGRLIVVRHGVYCSRDVWERMGADQRHELEIRAVLMSLGGAWVSHYSGAALQQLPLPSGWDEVVTLTRPVRAAGRPPGVRFRTAAVPPAHRTTVFGLPVLTVARNVLDIARTGVAAGLVVGDAALRRDLATPAQLAATVAAGWPGVSAARLVAEHASGLRESPVESVSYAVFVRRGLALPE..... 216
506 2.000e-36UniRef50_A0A2A9EDJ3 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=2 Tax=Sanguibacter soli TaxID=442709 RepID=A0A2A9EDJ3_9MICO  ali  23  14.......................SRDHLPSDVAARRRTGEWVRIRRGASIAAHPAGTDAHERRDRELRAALATLGPHACFSHTTAALLWDLPTWGTSSRIHVTSRSRSSVRRGAPVARHVALVPDDERTEIRGLPATTLARTVADCAMTSPAEGLVIADAALRSG-ADPAEVAALLTRGRRGVRLAREILACADVGAESPGESLTRLILLAAGFPRPTTQLE. 218
507 2.000e-36UniRef50_A0A0Q4VAA0 Uncharacterized protein n=1 Tax=Curtobacterium sp. Leaf261 TaxID=1736311 RepID=A0A0Q4VAA0_9MICO  ali  20  2...............................................................................ISHASAAALWGLPDFDPDDGRLHLTPYRTRTHSGPGVVRHAAPLHDDEVVHVGPARVTTAVRTLVDVIRSSFTHAVMVLDHSLATGLVDRSELEAALVRGPRGTARALRALDFADPRSESPGESFSRVRFREFRLPPPELQHE. 147
508 2.000e-36UniRef50_UPI00068EE292 DUF559 domain-containing protein n=4 Tax=Catenuloplanes japonicus TaxID=33876 RepID=UPI00068EE292  ali  18  1MVHDGGMVPAIRQLRSFRRRDAVDAGLTTPG---ALKGPHWQRLYRGVYIARAAF---TPDLHRMWCAAAQLAMPSSAAIGGLSAAYLWNVDLLAPDEPVSIIVPGRQGIVNQSMLRVIRGELPRGDVEMFTGLRVTTPARTAFDLGRADRVHAAIAVDAMLHRRAVSLAELHRAADAGWRGVMKFRDILRLAEPGAASPMETRLRLVITDGGLPRPVAQY.. 220
509 3.000e-36UniRef50_A0A1V1WB46 Uncharacterized protein n=3 Tax=Nocardioides TaxID=1839 RepID=A0A1V1WB46_9ACTN  ali  16  9.........LTHQHGLILRRQAIAAGMTPKEIAALLRRGEWVAVRRGVYTTRAHWDSLDPVGRPRLEVAATLTTRTPHMISHDSAAYLHGLPILEARPRLVHVTRVGVGGRTRHGIKHHKAPVRTGLIDFVDDHAVLNVPRTVADIGRHGLRHAIVAANSALRAGETRRALSAAVGDTSWPYVTVPRLAVEWADGRCESPGEDLTMLMLKQLGVGYVQPQF.. 225
510 3.000e-36UniRef50_A0A062VWM8 Uncharacterized protein n=1 Tax=Microbacterium sp. CH12i TaxID=1479651 RepID=A0A062VWM8_9MICO  ali  20  14......................RDEGVSHTE--RGWRSGALKRLARGVYVETARWDALPPWEKQLVRVHAALATDPRRVICGESSATLLGV-LIAYPSRPVHVLVSEGTAREYRGIRTHV-SVDTREIIVIDGIRLTSPAVTAVDIARRPPAEALAYADALLRIDVAAPASLLAESLGSGRGRRQARWALERATGTPESVLESASLAVIEWLGYERPILQQE. 213
511 3.000e-36UniRef50_A0A1I4GID1 Transcriptional regulator, AbiEi antitoxin, Type IV TA system n=1 Tax=Leifsonia sp. CL147 TaxID=1798215 RepID=A0A1I4GID1_9MICO :_  ali  20  1MTRDSSLPMLVLVRHLVGHDE------TRQQHARAARRGVEVRVGRGAYVERETWEALARAEKQWVRLSAYARTRARAIFSHWSAAVLHGLPFADERTDIHVAVGSTAGGRSARGVRAHSVQVPEEDIVQIDGMLCTDLARTVVDIAATSPREAVAATDHVLRSEEVRRGLLAAWMRAQPRGHRRALDVLSFADGRSESVLESVSRLAMYEAGLPKPELQ... 228
512 3.000e-36UniRef50_A0A2W5T8L6 Uncharacterized protein n=1 Tax=Leifsonia xyli TaxID=1575 RepID=A0A2W5T8L6_9MICO  ali  22  4...........TTLRRITRADALAQGFTDRQLAQLIRIGELHRVRPGEFALPAEWNSIERHQQHRELVRTAERVTAPQVYSHFAAAALWGIRIRKEWPKRVVLVDRADGGRSSGRLRRRALGFDEREIIELNGLLVTSPAQTAVDLARLPLIDAVVAADSALRPPLTTQDELLRRADARGRGAIRARIVAAEADGRAESPPESESRITAALLGFPRPELQ... 221
513 3.000e-36UniRef50_A1SMI5 Uncharacterized protein n=14 Tax=Nocardioidaceae TaxID=85015 RepID=A1SMI5_NOCSJ  ali  16  9...........RRGRVMLRKELLENGFNDKAIAQRVKGGEWVKIRHGAYTDASTWDALDKAGRHALVARAVAQSRTNVVVSHVS-----GLPFVDAPDLVHITRKDGKAGRSEAGVDQHCGKILDGDAVELDGLTVMAPTRTVVDV-----EAAVCVVSHLLHAGTTTMEALRAELMQHWPETLRTDLVLRLSDRRFESVGESRTYYLCFREGLPMPIPQYE. 224
514 3.000e-36UniRef50_A0A0Q5VLN2 Uncharacterized protein n=8 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A0Q5VLN2_9ACTN  ali  19  2..NPRLLAALRRHHGVFATADALASGVDRNAIGPLLRQGSLHRIRHGVMTLPRVWDAARGTTHHLECAAVLRRLRPQSVISHTSAARLHGL-VLPGDVDQQVWLTDPEQYRTGRGYRVLEAPVPPSETTVVDGLPVTTLTRTLADVGRWSFVDTVVAADDALADGRCTRAELTAAAMSHWVGAGKTARALGAARVGAHSPHETRSRLAVVGAGLPEPLLQV.. 225
515 3.000e-36UniRef50_E9UWW0 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=E9UWW0_9ACTN  ali  15  2....DELDLAVERAGFFTTQHAKAAGYADREITKMVRRKEWHRIRRGAYASAAAWADLDDVGRHRVRSSAVLALGPNVALSHASGVVRHDIDLWRVPLDRVHVTRLDGGPGRIEGDVVHHGFTGHDDIIEVEGQRVVRPERCVLETARIDSEAAWCLLDSGLRSKRFNREQLDAAIMEHWPFMRRVGTVLPYADGRSGSVGESRGTAMFKRYGVPRPVLQYE. 224
516 3.000e-36UniRef50_A0A286EN84 Putative AbiEi antitoxin of type IV toxin-antitoxin system n=1 Tax=Jatrophihabitans sp. GAS493 TaxID=1907575 RepID=A0A286EN84_9AC  ali  18  1MRSVPEISRQ--QHGAFTLAQAAVAGWHPSAIDRAVRAGRLTRVRRGVYCLPDVLDVSSPRQALRTRVCAVLLAKPDCVASHASAALLSDLATLNLPIRPCVTV-RPRSTGDTASVHLHRATLCADDLSSRQLLRRTSETRTVYDIARSGHVAAVVTADAGLRRGSITRAGLCAYRERGWPGIRRAANLADLVDGRSESALESVSRLRMLEHSLPPAELQAE. 228
517 3.000e-36UniRef50_UPI0003B739DA hypothetical protein n=1 Tax=Gryllotalpicola ginsengisoli TaxID=444608 RepID=UPI0003B739DA  ali  21  8........AAAQELGLELTSDARGRATESTAIRRDAGKGKYVRVAPSVFLDRGRWEGLGPDDRFRAFVVGMATTMPDVVFSHFSAAALLGLPSLHAWPRRVQVTIPPASGGRSTGVQRYGAALRDDEVVEVAGFLVTSPARTVMDVARMPFAPAVALADAALHRPLLTMADLAAELDRGRYAFGKMRRVAEFSTTLSDSVRESESRVLIHELGFPQPVLQ... 229
518 3.000e-36UniRef50_A0A1A9GI81 Uncharacterized protein n=1 Tax=Nocardioides dokdonensis FR1436 TaxID=1300347 RepID=A0A1A9GI81_9ACTN  ali  17  8....RRRDHDARQTPIRLRRELCESGMSDANIRHEVHAGRLTRVRHGAYVDTAAWEALTGDGRHEVLTRAVLRARAPVVVSHTSALPLYAAPTWGMDLSEVHVTRDAKAGRHDAGTVQHCGLVREGDVETHHGVPVMSPTRVALEVTTVERTPALVVVNDLLHRGLTTQEQLEERYAAGWAHTLATDLVLRLANPACESVAESRAWAFFFEQHLPRPEAQY.. 230
519 4.000e-36UniRef50_UPI00080D8D3E hypothetical protein n=1 Tax=Microbacterium oleivorans TaxID=273677 RepID=UPI00080D8D3E  ali  20  1......MPRHISFAEARRRATLERAGWRSRDITDAVKDGRMRRIQRNRYVLAERFDDLWPEARHLVEVAAAERKDGTGVFSYQSAAVLWGLPLARVPDAVHVSMPADDRMTSRPALRRHADRLDPSEMTDRFGVPCTTLARTVWDLSRLPPSSGVAAADAALRDSGGDPEVGERWRQRGSRGAARAEAVIAFANGLAESTGESIARWMLAEIGFARFRLQV.. 236
520 4.000e-36UniRef50_A0A126YX17 Uncharacterized protein n=2 Tax=Frondihabitans TaxID=447237 RepID=A0A126YX17_9MICO  ali  19  11.................RSAEFEAGGLNSRGLRHLAAKGTMARVVPGSYINGLTWKALDKRERYALRVREHARVSPRLVASHWSAAALWGMPVIDSWPETQVTDPSRSTSSRTPALLRRPGAVPDVELVRVDGILVTSAVRTAVDLALAGFETGVVLFDHGLHAKMYTREQLERCLESRARRHRAATRALEFASGDAQYPGESFSRIGMAARGFPTPILQ... 218
521 4.000e-36UniRef50_A0A1W6DNV6 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1W6DNV6_9MICO  ali  17  4.......DDPLAPGGPRRPALLLAAEHPPQLVRQAASSGSWERVRRGVYRETGTTRRADERDLVLDRATALHRLRADHVLSHTTAALAHGLRLWTAPRDVHVVQPYRRSGRADPTVARHLGLVDASDRCVVGGLPVTTPARTVADCLRLSPLEGLVVADAALARGLA-REDVAACLARRAAGTPRARHVLRLADAGAESAWETWLRYLVLRLGLPRPSTQV.. 223
522 4.000e-36UniRef50_C5C6K4 Uncharacterized protein n=1 Tax=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) TaxID=471853 RepID=C5C6K4_BEUC1 :_  ali  24  25...........................DRREIEHRLRRGELQSVRRGCYRVTGHALGTEREQRILAQVAALARLRTPHWFSHTSAALLWGCWTWRLAEEVHLVQGTRPGVSRRPGVMRHVGRLPASDRAEIAGVPVTALPRTIIDCARLPIASALVIADSGLRIG-TSAEEVRDRAARGARGILRAERVLRLMDARSGSPGETLVRLIAHEAGLPRPDL.... 227