current user: public

If you have questions about the server, please let us know.

Query: HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# E-value Template Links and tools%idFirst VKVEVHYFDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSVQNKLEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAKNYMTHEEISTLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGREVLENFGTVKREVAEKLALEQYEQYDTHRRALEAADDVDELTADVKRLKRLast
1 3.000e-48UniRef50_A0A2S2DVG8 DNA ligase (NAD(+)) n=262 Tax=root TaxID=1 RepID=A0A2S2DVG8_9BACT  ali  49  134.RIGKDYFDELLERIREIRASERRFYLKITDIYQCSIDYNKDAEITQLFFKTVQNKLHWAITGKTAAELIAQRADASKPNMGLTTWKNGKVLKGDISTAKNYMQEKEIKELERIVTMYLDFAELQAERQIPMNMSDWITKLDAFLQFNEYQILNEAGKVSHEVAMKLVEKEFAKFRVIQD----QNYVSDFENQVKKV.. 330
2 3.000e-47UniRef50_A1WM88 Uncharacterized protein n=243 Tax=cellular organisms TaxID=131567 RepID=A1WM88_VEREI  ali  43  133..FGKDYFDELLERIREIRASERRFYQKITDIYALSMDYSVDAPLAREFFSSVQNKLHWAITGKTAAELIYTSADATKIYMGLATWKHGKILKSDVAVAKNYLSEAHVKELNRIVSAYLDLAENRAERGILMKMADWTGFLHSFLELSNYPILQDKGKVSALEAKLKAESEFDVYRQRQDVE----YLSDFDREIKRLE. 328
3 9.000e-47UniRef50_A0A1Y4VAE7 Hydroxyacid dehydrogenase n=1 Tax=Eubacterium sp. An11 TaxID=1965542 RepID=A0A1Y4VAE7_9FIRM  ali  64  134.KFGEDYFDELLERIRDIRASEKRMYLKIRDIFATSVDYDPKSKQAQLFYKTVQNKLHYSVHGHTAPELIFERADATKDNMGLKSFKGSKVRKSDVTIAKNYLNQEEISNLNRIVTMYLDYAEDQAKQHIPMYMNDWEQRLNMFLQFTGRKVLESGGTISREEADRFAKEQYELFDHNRKKLENSKVIIDD......... 323
4 2.000e-46UniRef50_A0A270MZQ7 Cell filamentation protein Fic n=19 Tax=Bacteria TaxID=2 RepID=A0A270MZQ7_STEMA  ali  45  220..FGRDYFEDLLEKIREIRASERRFYQKITDIYQCSVDYDAKSPITQRFYAHVQDKLHYAIHGKTSAELISARADASKPAMGLTSWKNEKITKSDVTVGKNYLTQEEIKDLEFLVSMYLDWATNFARRRKTMTMADWATRFDGFLEFNAYEVLHGYGHVSRDDAARKAVTEYEKFRVVQD----KDYQSDFDRVVEDVK. 417
5 3.000e-46UniRef50_A0A1H7Y8Y7 Uncharacterized conserved protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1H7Y8Y7_9DELT  ali  47  139.KGQKDYFDELLERIRDIRSSERRFYQKVLDIYATSVDYTPDSEMTQQFFAIVQNKMHWAAHGHTAAEVIYERADSTQPFMGLKTTRPGGIIRKDVSIAKNYLSEEELPTLNRIVTIYIEFAELQAMERRPMTMRDWIAKLDEFLRISGRELLDHAGKISAEMAKAKTETEYRQYHAFLDSQPRAVDV-DFENAVKRLPK 337
6 3.000e-46UniRef50_A0A1Y4SJR9 Cell filamentation protein Fic n=18 Tax=Bacteria TaxID=2 RepID=A0A1Y4SJR9_9FIRM  ali  42  131...GGGYFKELLERIRDIRASEKVFYRQILEIYATSIDYDPTADVSIQFFKKVQNKIHYAIHGETAAEVIYHRADAEKEFMGLTTFAGNQPTLREAKIAKNYLNEKELKAMGQLVSGYLDFAERQAQREQVMTMEDWVKHLDNILTVTGEQLLVGNGSVSHQQAMEKAETEYKKYKARTLSDVERDYLDAI-KELENLK. 325
7 4.000e-46UniRef50_G9XSB1 Toxin-antitoxin system, toxin component, Fic family n=7 Tax=Clostridiales TaxID=186802 RepID=G9XSB1_DESHA  ali  57  145TAFGEDYFDELLERIAEIRASEKRFYQKIQQIYATSVDYDSNLERTRLFFQTVQNKMHYSVHGYTAAELIVKRADATKPNMGLTSFKGARVRKGDVDIAKNYLNEQELSGLNRIVTMYLDYARDQAERRVPMHMADWEEKLDLFLRFTGREVLANAGKVSAEIAKALAEKQYEIYDANRRVQEADIALTEDISLLKVLKK 345
8 4.000e-46UniRef50_A0A1K1SHB4 Uncharacterized conserved protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1K1SHB4_9BACT  ali  48  140..FGKDYFDELLERIREIRASERRFYLKITDIYQCSIDYSKGSEITQTFFKTVQNKLHWAITGKTAAQIIAERANADKPNMGLQTWKNGKILKTDISVAKNYLIEKEIKELERIVTMYLDFAELQASRQISMKMTDWISRLDAFLQFNEYEILKDAGKVSHVVAIKLAGEEYQKFRIIQDENFESDFDKEILK....... 334
9 7.000e-46UniRef50_W4V4Y6 DNA-binding protein n=252 Tax=cellular organisms TaxID=131567 RepID=W4V4Y6_9FIRM  ali  43  133...GGNYFEELLERIRDIRSSEKVFYRKILDIYATSIDYSPDAAISQQFFQTVQNKMHWAAHGHTAAEIVYLRADGNKPFMGMTNFTGSKPTKSEALIAKNYLTEDELAILNRIVNAYIEFAELQAIRRKPMYMVDWVKKLDEFLKMSDNEILTHAGRISHQQATQKAIEEYEKYKERTKNEVEKHFLESIDKTAKML.. 330
10 9.000e-46UniRef50_A0A1V5YM48 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5YM48_9BACT  ali  43  11...GGSYWHELLERIRDIRSSEKVFYRQVLDLYATSVDYDPRTPESLEFFKIVQNKIHFAAHGHTAAEVISQRANAELPFMGLTVFSSEQPVKDEVGIAKNYLTEEELATLNRMVSAFFDLAELRAMQHQPMYMRDWIVELDDFSKRYGKGMLSSAGTVSHQEALAKAEAEYKKYRQKTLSPAERDFLTSIKETQKRLE. 209
11 2.000e-45UniRef50_A0A1I5UAD8 Uncharacterized conserved protein n=51 Tax=Bacteria TaxID=2 RepID=A0A1I5UAD8_9BACT  ali  49  139.RFGKDYFDELLERIREIRASERRFYLKITDIYQCSIDYNKDAEITQKFFKTVQNKLHWAITGKTAAELIAERASAGKPNMGLQTWKNGKILKIDVGTAKNYLIEKEIKELERIVSMYLDYAENQAARQIPMKMVDWVARLDAFLQFNEYQVLQDAGKVSHEVAVRLAEKEYEKFRVVQDQHFESDFD............ 329
12 2.000e-45UniRef50_A0A1G5YLY9 Uncharacterized conserved protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1G5YLY9_9BACT  ali  38  134..FGQDYFDELLERIREIRASERRFYQKITDLYSLSTDYDPKSPQTKEFFGMVQSKLHWAITGKTAAEIIYTEADATKLYMGLKTWPDGKIQKSDVSIAKNYLAHQHIQELNRIVSAYLDLAENNAQRGMAFSMQQWAKFLDSFLELSSYPILRDKGKVSMLEAKLKAGGEFDKFRVIQDQTYQSDFDK-LISNTKKQEK 333
13 2.000e-45UniRef50_A0A1G0ZFT4 Cell filamentation protein Fic n=15 Tax=root TaxID=1 RepID=A0A1G0ZFT4_9BACT  ali  43  143..FGQDYFEEQLARIRDIRSSERRFYQKITDIYQCSADYDRNSEITQNFFAVVQNKLHWAISRQTAAETIYTRADSQKQNMGLTTWPNGRIRKTDVSIAKNYLGEKELKSLNRFVSMYLDFAEMQANNRKVMNMEDWVEKLDAFLQFNEQDILDNPGTISAEIAKTFAEGEFEKYRVIQDRLFESDFDKEIKR....... 337
14 3.000e-45UniRef50_A0A2A4PZV6 Cell filamentation protein Fic n=9 Tax=Bacteria TaxID=2 RepID=A0A2A4PZV6_9GAMM  ali  41  136..FGEDYFDELLERIREIRASERRFYQKVTDLYALSSDYDRNSALSQEFFATVQNKLHWAITGKTAAELIYSKADANSPNMGLLTWPNGKILKSDTHVAKNYLEQDNIKELESLVSAYLELAENRAKRHLVMKMTDWVKFLNGFLELSTYPVLTNKGKISAAKAKLKADQEYGVFRVKQDIE----YISDFDKVVEHIK. 331
15 5.000e-45UniRef50_B3PJN0 RhuM-like protein n=126 Tax=root TaxID=1 RepID=B3PJN0_CELJU  ali  42  147..LTEQYFEEQLQRIREIRLSERKFYQKITDIYTTAIDYDVTAQATQRFFATVQNKLHWAIHGQTAAEVIVNRADAEKPHMGLTNWPHGKIQKFDVVVAKNYLTEHEMAQLTRLVNAYLDVAEDMALRKIPMTMQDWETRLSRFIAATDREVLQDAGRITAEIAKAHAESEFEKYRIVQDRLFESDFDR-LINQMKTLQK 346
16 7.000e-45UniRef50_A0A1W9T798 Cell filamentation protein Fic n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1W9T798_9BACT  ali  40  136...GGNYFDELLARIRDIRSSEKVFWRKVLDVYATSIDYEPNTEQSIQFFKTVQNKMHWASHGETAAETVYRRVDSSKEHIGLTNFKGKVPTKKEVEIAKNYLDEDELNILNRMVTAFLEIAEIQALDRTPMYMTDWVKQLDIFLKMTNKEILQHSGLICHQKAIEKAHTEYEIYKKNRITQVEKDFIKQLDNKTKDLKK 335
17 9.000e-45UniRef50_A0A095YY63 Toxin Fic n=5 Tax=Bacteria TaxID=2 RepID=A0A095YY63_9ACTO  ali  43  141..LGVDYFEQLLEEIREIRLSERRFYQKVTDIFTTAVDYESSSPVAKQFFATVQNKIHYAVHGHTAAELIKERADASQPYMGLTSWPDGKILRSDVTVGKNYLTADELKDLGRLVEAYLNLAESRARRQIATTMEDWVEFLDQVLTLDAREILDNAGTISKKMADDHALREFAVFRKVQDAHYVSDFDRFTIEAAKAI.. 339
18 1.000e-44UniRef50_A0A081S8Z0 Cell filamentation protein Fic n=661 Tax=root TaxID=1 RepID=A0A081S8Z0_STRMT  ali  41  135...GGSYFKELLERIRDIRSSEKVFYRQVLDLFATSSDYNANSLEAKKFFATVQNKMHYAIHHNTASELIYNRVDSEKEFMGLTTFKGDLPTLSEAKVAKNYLTEKELRGLNQLVSGYLDFAERQAEREEVMTMADWVTHVDRILQATGEDLLDNSGSISHEQMKQKVDKEYKSYQAKTLSQVEKDYLEEI-KSIENLAK 330
19 1.000e-44UniRef50_G8T7V4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=G8T7V4_NIAKG  ali  54  133.....NYFDELLSRIRDIRSTEKIFYRKVCDIFATSIDYDPSTSQAKDFFATVQNKFHWAIHAHTAAELIMERADAGHPNMGLTTWPGEQIRKEDVTVAKNYLTTNELDQLNRIVNQYLEFAELQAMNRKPMHMSEWQVKLHGFLTLNDREILQHKGTVSHEQAEKHALDQYKLYQKT----IADNTVDELDKSIKKLQK 323
20 2.000e-44UniRef50_A0A1H6J0W6 Putative DNA-binding protein in cluster withType I restriction-modification system n=2 Tax=Bacteria TaxID=2 RepID=A0A1H6J0W6_9GAM  ali  42  11...GGNYFDELLARIRDIRSSEKVFWRKVLDVYATSIDYDPKTEQSVMVFKTIQNKMHWASHGETAAETVYRRVDSSKEHLGLTSFKGEIPRRKEVEVAKNYLAENELNILNRMVTAYLEIAEIQALDRTPMYMADWIKQLDTFLQMTNKDILQHSGTISHQKAIEKAHSEYEIYKKNRITQVEKDFIKQIETKTKDLEK 210
21 2.000e-44UniRef50_A0A1V2SPQ3 Cell filamentation protein Fic n=3 Tax=Bacteria TaxID=2 RepID=A0A1V2SPQ3_9STRE  ali  42  126.NIGGSYFKELLARIRDIRSSEKVFYRQVLDLFATSSDYSANSPEAQAFFATVQNKMHYAIHQHTASELIVDRVDSEKAFLGLTTFKGELPTLKEAQVAKNYLDEKELRGLNQLVSGYLDFAERQAEREIVMTMKDWITHVNSILKATGDQVLEGSGTVSREQMLDKVTTEYRKYQAKTLSQVEKDYLAELKNLEQLAKK 324
22 2.000e-44UniRef50_A0A1M5GR45 Uncharacterized conserved protein n=39 Tax=Bacteria TaxID=2 RepID=A0A1M5GR45_VIBGA  ali  48  146....PDYFDDMLERIRDIRASERRVYLRVKEIFTMAADYKPSNQETNRFFQTIQNKLHYACTHMTAAELIASRVDANKPDMGLTSFKGDEVRKTDVTIAKNYLREDEIKELNRIVNMWLDFAEDQALRRKQVFLQDWADKLDQFLSFNDRDVLNGAGKISRKAADDKAKQVFDNFAEQRRRLKEAEGEQANITALKAILK 341
23 3.000e-44UniRef50_A0A2A5DJV5 Hydroxyacid dehydrogenase n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5DJV5_9BACT  ali  52  143TAFGRDYFDELLERIRDIRASERRFYQKITDIYATASDYDNKLPDTQTFFGTVQNKLEWAITGMTAAEIIHVRADADKENMGLATWPDGPIRKGDVTVAKNYLSQEEIGDLNRIVTMYLDYAEDQATRHQPMTMNEWANKLDAFLQFNDRAVLRNSGSVKKNVADALAKHHFESYTEKRRTITD-NTDSDFDTFVKKTAK 344
24 4.000e-44UniRef50_C7M5S7 Virulence protein n=68 Tax=Bacteria TaxID=2 RepID=C7M5S7_CAPOD  ali  43  133....PDYFDELLARIRDIRASEKRFYQKIRDLFMLSSDYDKTDKATQMFYAQTQNKILYAITGQTAAELIVSRADASQNNMALTSWEGNIVRKGDIYIAKNYLTDNEIDSLNRFVMVFLESAELRAKNRQDITMDFWRENIDRIIEFNDKKVLKGNGSVSNEQMKTIVRKVYDEFEVKRKQYDAQQADLEDLKEIEELE. 327
25 5.000e-44UniRef50_A0A1E3LAZ4 DNA ligase (NAD(+)) n=664 Tax=root TaxID=1 RepID=A0A1E3LAZ4_9BACL  ali  61  134.NFGKDYFDELLERIRDIRASEKRFYRKITDIYATSIDYDPKEIVSQDFFATVQNKLHFAIHGHTAAELIAERADAEKDNMGLTSWKGIKVRKGDIIVAKNYMSNEEIQSLNRIVTMYLDYAEDQAMRKAPMYMKDWIEKLNSFLQFNERDILMNAGKISQEIAEKLALSEYEKY--NQKRIEKNDDFDEFLKQQK.... 326
26 5.000e-44UniRef50_A0A2I1MR13 Cell filamentation protein Fic (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A2I1MR13_9LACT  ali  44  68TKLTKDYFEKLLVKIREIRLSERRFYQKITDIYATSLDYDPSAKATKRFFAAIQNKLHYAIHGKTAAELIVDRANHKNKNMGLTTWPDSKIHKYDVVVAKNYLNEEELNQMQRIVSSYLDMAELQAERHIPMTMEDWEKRLNGFLQLWDKEILNDAGKVSAALAKKHAESEFEKYRIIQDRLYKSDFDKELEDDTKKLE. 271
27 7.000e-44UniRef50_G6B169 Toxin-antitoxin system, toxin component, Fic family n=6 Tax=Bacteroidales TaxID=171549 RepID=G6B169_9BACT  ali  41  256..FGADYFDDLLDRIREIRISERRYYQKITDIYECSVDYSKDAEETRKFFKMVQNMMHYAVTKQTAAEIIYDRADAERPHMGLTTWPEGRVIKSDVTIAKNYLSEKEVDALNRLSNAFIDIAEQRAEDHILMTMADWFDLLQKYMDLNNRPVLPNTGRVTHEQAVEKALTEYDKFRIIQDREIMSDFDRQLK........ 449
28 9.000e-44UniRef50_A0A016BSB8 Virulence RhuM family protein (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A016BSB8_BACFG  ali  40  32..FGKDYFDDLLERIREIRASERRYYQKITDVYECSADYDPKSETTQLFFKMVQNMMHWAVTHQTAAEIVYSRADAKMPHMGLTTWPDGRVQKSDTIVAKNYLSDKEASALNHLSTAFLDFAELRAERQIITTMADWKKQLDEFLALYKYDTLNNAGTISAEQAKEKAYAEYDKFRLIQDKEYLSDFDKEIKVWKEK... 230
29 9.000e-44UniRef50_D3AAN4 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=D3AAN4_9CLOT  ali  38  45...GGGYFKELLERIRDICASEEVLYRQVLEIYATSIDYDPKAEISIQFFKKVQNKIHYAIHGQTTAEVIYTRVDAEKEFMGLMTFAGNQPILKEAVIAKNYLNEKELRAMGPLVSGYLDFAERQAEREQVMTMSDWAEHLERILTMSGEQLLQGNGSVTHKQAVDKATSEYRKYKTRILSDVEKDYLNSIKILEQKTDK 241
30 1.000e-43UniRef50_M4U1A2 Uncharacterized protein n=48 Tax=Bacteria TaxID=2 RepID=M4U1A2_9GAMM  ali  43  140...NSQYFDELLNRIRDIRSSEKVFWRKLCDIYATSIDYDGKAQSSIKFFAQVQNKMHWAAHGHTASEIVFERINADKPNLGLTSFKGKEPTRKEVVIGKNYLSEKELDTLNRLVTSYLEFSELQARNGKLMKMADWANKLNNFLQLSDFDILTHAGKISAEQAKQKAKKEYDKYRKIIDMQP-SQVDNDLADAIKRLE. 338
31 1.000e-43UniRef50_W0Q1M8 DNA-binding protein n=135 Tax=root TaxID=1 RepID=W0Q1M8_9PAST  ali  46  131.....DYFDELLEQIREIRASELRFYQKVRELFKLSSDYDKTDKNTQMFFAETQNKLIYAITKQTAAELICQRADATKANMGLTGWKGKIVRKGDIITAKNYLNNDELDSLNRLVMIFLESAELRVKNNQDLTLGFWRRNVDMLIEFNGFPVLENGGTITHKQMESFVREQYEKFDTQRKYLKQQEAELEDLKELEQLAK 325
32 2.000e-43UniRef50_A0A2M8F316 Cell filamentation protein Fic n=6 Tax=Bacteria TaxID=2 RepID=A0A2M8F316_9BACT  ali  46  140TIFGKDYFEEQLARIRNIRSSERRMYQKVTDIYQCSADYNPNEEITKLFFATVQNKLHFAITGQTAAEIIHGRVDSKKQNMGLTSWPKGSIREADVIIAKNYLQEKELDYLNRIVTMYLDYAEMQAKRGIIMYMKDWVAKLDAFLQFNEHAILLDLGKVSHEVAEALALKEYEKYRVEQDKNYISDFDTYLEIEQK.... 339
33 4.000e-43UniRef50_A0A2S6Y404 Uncharacterized protein n=5 Tax=Xanthomonas TaxID=338 RepID=A0A2S6Y404_9XANT  ali  45  77LKRGPDYFEDLLGKIRDIRSSEKMFWRKVLEIYATSVDYDASAEASQRFFATVQNKMHWAAHGHTAAELIMERADAGKPHSGMTNWVSAAPRASDATVAKSYLNPDELDALNRIVTAYLEFAELQALNRKPMTMADWIAKLDDFLRLSDREVLTHAGRVSREQALEFGKAEFARHKQ-QKLAEPSAVERDFDAATRELKK 277
34 4.000e-43UniRef50_A0A064AHK5 Toxin Fic n=6 Tax=Fusobacterium necrophorum TaxID=859 RepID=A0A064AHK5_9FUSO  ali  41  135...GGNYFKELLDRIRDIRSSEKVFYRQILDLFSTSIDYDSKSEEARNFFAMVQNKMHYAISHNTASEIIYQRVDSNKDFMGLTIFKGEQPTLTEAKIAKNYLSEKELKSLNALVSGYLDFAERQAQKEITMTMKDWVEHVDNILTATGEELLKDHGKISRKQMIDKVTDEYKKYSQKTLTQVEKDYLDEIKRLEK.... 327
35 9.000e-43UniRef50_A0A1G1LN52 Hydroxyacid dehydrogenase n=44 Tax=root TaxID=1 RepID=A0A1G1LN52_9BACT  ali  56  135VNIGSDYFDDMLDRIRDIRSSEKRFYQKIRDIYKLAVDYDPKAEETLEFFRIVQNKLHFAISGKTAAELIYERADAKKANMGLTSWKGVKVRRDDVAIAKNYLNKKEMEGLNRIVTMYLDYAEDQAKRHLQIFMRDWRKKLDAFLKFNEREILNNPGKVRKEVADQLALDQYEIYHRHRLALEAKQEAFEDDRELKR... 331
36 9.000e-43UniRef50_B3JG09 Uncharacterized protein n=61 Tax=Bacteria TaxID=2 RepID=B3JG09_9BACE  ali  43  130...GGGYWKELLERIRDIRATEKVFYRQVLEIYATSIDYDPRASVSQEFFKKVQNKIHYAVHGHTAAELIVERADAEKDFMGLLTFKGTQPTLAEAKTAKNYLDEKELRAMGQLVSGYLDFAERQAEREQPMTMSDWANYLDRILTMSGEQLLQDSGKVSHTEAMEHATNEYRKYKQRTISDVEQDYLDSI-RMLDNLKK 325
37 9.000e-43UniRef50_A0A0A8E0Z3 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0A8E0Z3_9XANT  ali  44  51LKRGPDYFEELLGRIRDIRSSEKMFWRKVLDIYATSVDYDPSAEASQRFFATVQNKMHWAAHGHTAAELLMERADASKPHSGMTNWVGAAPRASDAVVAKSYLNAEELEALNRIVTAYLEFAELQAMNRRPMTMDAWIAKLDDFLRLSDREVLTHAGRIGREQALEFSKAEFARYRQRTLEEP-SPVERDFEEATRKLK. 250
38 1.000e-42UniRef50_A0A0E3WXH4 Putative DNA-binding protein in cluster with Type I restriction-modification system n=31 Tax=cellular organisms TaxID=131567 RepI  ali  43  139.RFSTRYFDDLLEEIRDIRSSERMMYQKITDIYATAIDYSPKTEDTRKFFATVQNKLHFAITGQTAAEIIITRARSDKQNMELTSWRDGKIMPRDVTIAKNYLDKTELDHLNRIVNMYIDYAELQAIRNKPMYTKDWIEKLDAFLKFSEYEILTDAGKISHEVALDLAAREYETFRKIQD----KNYISDFDKEVRRIR. 335
39 1.000e-42UniRef50_F8X3S0 Uncharacterized protein n=24 Tax=root TaxID=1 RepID=F8X3S0_9BACT  ali  42  138..NGNRYFRELLQRIRDIRSSERNLYQQVTDIYATAIDYDPRTDMTRQFFATVQNKMHYAAHQHTAAEVIYERVDSDKPMVGMTNFKGDYITRDDVKIAKNYLSEKELQVLNLLVSQYLDFAELQAIEEHSMTMQQWIEKLDNILSVGNRPLLSNAGTVSHKQAIEKAIQEFEEYR----RKEMLQYESDFDRAIKELK. 330
40 3.000e-42UniRef50_U2SV02 Toxin-antitoxin system, toxin component, Fic family n=10 Tax=Bacteria TaxID=2 RepID=U2SV02_9FIRM  ali  45  142...GGNYFDELMDRIRDIRSSEKVFWRKVLDIYATSVDYDPRTEASVLFFKTVQNKMHWAAHGQTAAEKIFYSADSSKPNMGLRSFSGSHPTQSDALVAKNYCTEDELLALNDIVSAYLDLAEMQARRRIPMYMSDWIDTLDGFLKLSKHEILTHAGKISAAAAEKKAKEEYRKYKELQLSRGEKDYIAALESAEQKLLK 341
41 4.000e-42UniRef50_A0A2G2MQB9 Cell filamentation protein Fic n=1 Tax=Sulfurovum sp. TaxID=1969726 RepID=A0A2G2MQB9_9PROT  ali  39  154..FGQDYFDEQLDRIREIRLSERRFYQKITDIYALSADYDKDDEQTKKFYATVQNKMHWAICGKTAAEIIYSEVDAQKIYMGLKTWPDGKILKTDVTVAKNYLNKEHIEQLKRIVSAYLDLAENRAIQGIVMNMKEWIVFLDKFLMLSDYPILLDSGKVSALEAKLKAQVEYEKYRVIQDREYLSDFDKMLAQMEKK... 351
42 5.000e-42UniRef50_B7UEN5 RhuM n=342 Tax=root TaxID=1 RepID=B7UEN5_STRPY  ali  43  160TKLTKDYFEKLLVKIREIRLSERRFYQKITDIYATSLDYDPSAKATKRFFAAIQNKLHYAIHGKTAAELIVDRANHKTKNMGLTTWPNSKIHKYDVVVAKNYLNEEELNQMQRIVSSYLDMAELQAERHIPMTMEDWEKRLNGFLQLWDKEILNDAGKVSAALAKKHAESEFEKYRIIQDRLYKSDFDKELEDNTKDLEK 364
43 6.000e-42UniRef50_A0A1F9L3C3 Cell filamentation protein Fic (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A1F9L3C3_9DELT  ali  41  87.NLTDEFFERQLEKIREIRLSERKFYQKITDIYATSLDYDQTATATKRFFAAVQNKMHYAIHGQTAAEVIVDRADHRKENMGLTHWPHGKIHRYDVAIAKNYLSEFELAQLQRIVSAYLDMAELQAMRKIPMTMEDWEKRLAGFLKLWDREILQDAGKVSAELAKTHAESEFEKYRIVQDRLFE----SDFDRMVKQIE. 283
44 1.000e-41UniRef50_D3IEG4 Uncharacterized protein n=81 Tax=Bacteria TaxID=2 RepID=D3IEG4_9BACT  ali  43  134...GNRYFRELLQRIRDIRASERNFYQQVTDIYATSVDYDPRTDLTHTFFATVQNKLHYAVHEHTAAEIIYDRVDSEKPLVGMTNFKGNYITKDDVKIAKNYLTGKELQRLNLLVSQFLDFAEFQALEERPMRMADWISALDNQIIALRRKLLEGKGSVSHQEAIEKAEREFNIYRQREMAQLE----SDFDKMVKRLPK 326
45 1.000e-41UniRef50_A0A2C6L1I6 Toxin Fic n=13 Tax=Bacteria TaxID=2 RepID=A0A2C6L1I6_9FIRM  ali  41  150..LTEKYYDKLLEKIREIRLSERRFYQKVTDIYATALDYDKDAKTTREFFAKVQNKMHFAVHGQTAAEVIYNRADSKKEHMGLTTWPDGKIQRYDVSVAKNYLSRDELSSLERIVSAYLDLAEDRARRHIPMTMEDWAKRLDIFLQADDREVLTDAGRISAQIAKEHAESEFEKYRIIQDKLFESDFDKQLKLLEQQIAK 350
46 1.000e-41UniRef50_A0A1V6FE26 Uncharacterized protein n=1 Tax=Firmicutes bacterium ADurb.Bin080 TaxID=1852880 RepID=A0A1V6FE26_9FIRM  ali  42  134...GGVYWKELLERIRDIRASEKVMYRQILDLYATSLDYNASMPETYEFFKIIQNKFHYAASGKTASEIVFDRANATLPFMGLTAFKGNRPTKSEVTIAKNYMTEKELFALRRMVNAFFDMAELKAEREEPMYMRDWLHTLDKFSRDFGMGILEGSGTVTHEAATQKAHSEYTLYKAQTLTEVEKAYLETLKQMQKKL.. 331
47 2.000e-41UniRef50_A0A177MZB7 Cell filamentation protein Fic n=10 Tax=cellular organisms TaxID=131567 RepID=A0A177MZB7_METMH  ali  39  145..FGKDYFRELLERVRSIRASERRIYQQITDIFECSIDYDPKSETTKLFYAHVQDKFHFAITGHTAAEIISLKADASKPLMGMSTYKNGRVLKSDSTVAKNYLSEAEIKKLERAVSAFFDYIEGIIERRNTFTMESFAESVNKFLAFNEYQILEGYGTVSRKQAEQKAILEYEKFNKQQRIE------SDFDREVKKLLQ 340
48 2.000e-41UniRef50_A0A257GWJ5 Hydroxyacid dehydrogenase (Fragment) n=2 Tax=Burkholderiales bacterium PBB4 TaxID=2015566 RepID=A0A257GWJ5_9BURK  ali  46  41.....DYFDELMRRIQDIRTSERRFYQKITDIYATSIDYDPTQEVSLLFFKTVQNKVHWAITGQTAAEIVHGRVDAAKPNLGLTNWRGAVIRKQDVSIAKNYLSEPELEALNNLVEQYLIFAQGQAMRRVPMHMADWIEKLNGFLTLNDRDILTHAGRISHEMAQAKAELE............................. 206
49 3.000e-41UniRef50_A6L6I3 Uncharacterized protein n=88 Tax=root TaxID=1 RepID=A6L6I3_BACV8  ali  41  261..FGKDYFDDLLERIREIRTSERRYYQKITDIYECSADYDPKSEDTKLFFKMVQNMMHLAVTHHTAAEIIYQRADSEQPYMGLTTWPNGRVQKSDTIVAKNYLSDSELSQLNLITTAFLDMAESRAARHIVSTMDDWKKFLQQYLATMDYEPCDTAGKVTQEEARDKAYSEYEKYKLIQDKSYISDFDR........... 451
50 3.000e-41UniRef50_A0A2M6IUH8 Cell filamentation protein Fic n=2 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A2M6IUH8_9BACT  ali  43  148.RFSTRYFDDLYEEIKDIRTSERRIYQKITDIYATSFDYSANAKETKEFFATVQNKLHFAITGQTAAEIVAGRVDSKKDKMGLTTWRKGKIMSSDVVIAKNYLNQKELAHLNRIGNMYLDYAEMQVARGKIMRMQDWRTRLDAFLDFSEYEILHNAGKVSHKVAEKLALEEYKKYKPVQDREYLSDFDKEIKKYLEKRE. 348
51 6.000e-41UniRef50_G2EDQ6 Putative DNA-binding protein n=97 Tax=root TaxID=1 RepID=G2EDQ6_9FLAO  ali  43  138.....DYFEELEKRIQDIRTSEKRFYRKITDIYATSVDYDPTLEISISFFKTVQNKLHWAITGQTAAEIISQRANSSKENMGLTTWRGENIRKTDVSIAKNYLKEDELSALNNLVEQYLIFAQGQAQRRVPMYMNNWIEKLNGFLTLNDREILNNAGNVSHELGKENAEREYQKFKEKQKRIREGDFEKAIKKIENKKRK 333
52 9.000e-41UniRef50_A0A1W7M6V8 Uncharacterized protein n=1 Tax=Novosphingobium sp. MD-1 TaxID=1630648 RepID=A0A1W7M6V8_9SPHN  ali  50  133.....DYFEELLARIRDIRSSEKLFYRKVLDIYATSVDYDGSAEASQLFFQTVQNKMHWAAHGHTAAEIVAARADAARDNMGLTSWANGPVRKGDVHIAKNYLNAEEIEALNRIVTAYLEFAELQALARKPMTMRDWIAKLDDFLALGDRDVLTHAGHISAEVAKARALAQYDQWHARQLDAP-SAVEGAFVEATKKAKQ 330
53 1.000e-40UniRef50_A2SRV6 Virulence protein-like protein n=3 Tax=cellular organisms TaxID=131567 RepID=A2SRV6_METLZ  ali  49  143..FGQDYFDELLERIRAIRASEKRLYLKVRDIYALSVDYDKNHPAAKKFFAAVQNKIHFAVHGHTAAEIMVLRANADLPHMGLSTWPNGKIRLADVLTAKNYLSSEEITTMNSLVNQFLEYAEQQARSRKVMTMHDWEVKLEAILRLNDMSILTSAGKVSMERAKSKASREFEVF......................... 318
54 1.000e-40UniRef50_A0A2U9E3V3 DNA methylase n=5 Tax=Haemophilus influenzae TaxID=727 RepID=A0A2U9E3V3_HAEIF  ali  42  922.....DYFDELLEQIREIRASEMRFYQKVRELFSLSSDYDKTDKNTQMFFAETQNKLIYAITKQTAAELICKRADATLPNMGLTTWKGTIVRKGDIVIAKNYLSNDELDSLNRLVMIFLESAELRVKNNQDLTLSFWRNNVDNLIEFNGFPVLQGNGKRTQKQMEAFTYEQYALFDQARKQQKQCQADSEDLKILENWQK 1116
55 1.000e-40UniRef50_A0A0E4BH05 Toxin-antitoxin system, toxin component, Fic family n=17 Tax=Bacteria TaxID=2 RepID=A0A0E4BH05_TANFO  ali  42  133TGSSYNYFKELLDRIREIRLSEKVFYQQIKDIYKTSIDYNPSADMTLAFFKEIQNKLLWAVSGKTAAELVYYRANASLPMMGLTTEQDGKVTKGDVVVGKNYLNEKEIGQLKLIVEQFLAYAEAQALAEKPMYMRDWIQKLRLVLTMNEKNILEHAGTISHKMAVEKATKEYITYKEQQRQIEHLDSIKQLDQDLKRI.. 331
56 1.000e-40UniRef50_K1SNR6 DNA-binding protein (Fragment) n=3 Tax=root TaxID=1 RepID=K1SNR6_9ZZZZ  ali  44  1..........LLARIKDIRSSEKVLYRQVLDLYATAVDYDPKDSKSMEFFKIVQNKLHYATHGHTASEVIYERADAEKPFMGLTTFKGDIPVLQDVVIAKNYLNEEELKVLNNLVSGYFDFAEIQAIRHNPMYMEDYIKQLDIILSSAGGKMLIGAGSVSHNQAIKKAKSEYKKYQVKTISPVEEEYFK........... 179
57 1.000e-40UniRef50_J5W1V5 Toxin-antitoxin system, toxin component, Fic family n=29 Tax=cellular organisms TaxID=131567 RepID=J5W1V5_9FUSO  ali  42  146..FTDEYFERQLQYIREIRLSERKFYQKITDLYVTAFDYDKNSKTTRLFFQTVQNKLHFAVHRHTASELIFERADANKKNMGLMTWENGKIIKADVSIAKNYLNDQEMKYLERIVSMYLDYAELQAERKIPMSMEDWAKRLDGFLEFNGNELLIGAGKISTEQAKLHAETEFEKYRIIQDKLYKSDFDEFLLLEEENQK. 345
58 1.000e-40UniRef50_V5X7P9 2-hydroxyacid dehydrogenase n=21 Tax=Bacteria TaxID=2 RepID=V5X7P9_MYCNE  ali  51  135...GLDYFDELLERIRDIRASEKRFYQKIKDIFQTSVDYDKTSSAATTFFATIQNKLLYAVTGHTAAELVCARADADLPNMGLTTWKGPAVRKCDVGVAKNYLTEAEVTTLNRITTMFLDYAEDRASRRQQITMSEWEGKTDEFLTFNEREVLRNGGKISSSKMKAVTDDRYSDFDRRRKADEEREHIEELESAVKAI.. 334
59 2.000e-40UniRef50_A0A0G1M560 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0G1M560_9BACT  ali  43  138......YFQELLQRVRDIRSSERMFYQKVTDIYATSIDYKVDTELTQKFFATVQNKMHYAVHGCTAAEIITLRANSKKPLMGLTSFKSDYITVNDIVIAKNYLTESEINQLNLIVSLYIDFAELQAASGRLMKMQDWIRKLDEFLTISEKKLLHSAGKVSARQAGDKALGEYKKYRAEQD----KNYISDFDREIKKLLR 327
60 2.000e-40UniRef50_UPI0008A515C2 hydroxyacid dehydrogenase n=4 Tax=Corynebacteriales TaxID=85007 RepID=UPI0008A515C2  ali  49  143...GADYFDELLERIRDIRSSERRFYAEVRELFSLAEDYDPKSEKSKTFFAAIQNKLHYAITGLTASEIIATRCDPHADNLGLTSFRGKKVRKGDITSAKNYLLPDELENLNLLVSQFLDYAESQAKRRKVVRLADWMQKTDDFIAFNEYEPLQDRGRISMTEAKRLAGERYTIYDSRRRAKENDAIESQIIDELKHIE. 338
61 3.000e-40UniRef50_A0A255TJV8 Cell filamentation protein Fic n=6 Tax=Bacteria TaxID=2 RepID=A0A255TJV8_9BACT  ali  39  142..IGEDYFEHLLSEIREIRMSERRFYQKLTDIYATSIDYNRDAPTTRMFYKKMQNKMHFAVHGHTAAELIVDRADASKEHMGLTTWPDGKIVKADVSIAKNYLKEKELDDMGKLVNSILDFAQRMADRHIPMTMEDWAKRIDIVLEAGGDAVLNDAGQVTTEYAKEYAESEFEKYRIIQDRLFKSDFDKFDE........ 334
62 3.000e-40UniRef50_A0A0K2H1L4 Toxin Fic n=21 Tax=Corynebacteriaceae TaxID=1653 RepID=A0A0K2H1L4_9CORY  ali  38  134......HFDELLERIREIRASERQFFRKICDVIAKTSDDYEEKKEVRDFFAGIQNRLHFATHHHTAAELVFKRADHTKPNAGLTTWAAESPHKSDMTVAKNFLTSDELRRMNRLTSMFLDYAEDQAEQRKTILLNDWMTKADAWLVFNDRDVLQGKGDRSHKQAVNKANSEWDKYQRALDAKVNELDMKQLEQEVKELSR 330
63 3.000e-40UniRef50_Q2ITP4 Putative DNA-binding protein n=80 Tax=root TaxID=1 RepID=Q2ITP4_RHOP2  ali  48  136...GFDYFDELLERIRDIRASEKRFYQKVRDLFATSADYDPKAEAAKAFFATIQNKLVFAITGMNAAELIVTRADPARPNMALTSWKGDRVRKSDVTISKNYLTADEISDLNLLTTAFLDFAELRARNRQPTTMAEWMAQTDRFVAFNERGVLQGAGRVSHTSMEQVVAERFETFDKRRRAAETDAAEAEAISELTELEQ 333
64 3.000e-40UniRef50_UPI0009F1A56C hydroxyacid dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=UPI0009F1A56C  ali  39  145....PDYFDELLERIRDIRASEKRFYQKVRDLLALSSDYDKTDKATQMFFAETQNKLLYAVTQQTAAEIVVSRADANAPNMALTSWKGSVVRKQDIYTAKNYLKQEEIETLNQLTVLFLDSAELRVKERKDLTLDYWRDNVDALMSFQNKNLLKGSGSISNAQMKAKVEREYETFNLRRKKLALMEEEQRELTELRQIEQ 340
65 6.000e-40UniRef50_A0A1J5HPQ1 Hydroxyacid dehydrogenase n=9 Tax=Bacteria TaxID=2 RepID=A0A1J5HPQ1_9BACT  ali  43  139.....DYFEELTRRISEIRTSEKRFYRKITDIYATSVDYDPTNENSILFFKTVQNKVHYAITGSTAAEIIAGRVDSKKPNVGLINFRGSKPTKEEIVIAKNYLSEQELLVLNNLVEQYLVFAEGQAMQRVPMYMKDWIDKLHGFLQINNKDILKDAGKVSHELAKELAEKEFDKYYKKSLKAPSKADVDFETFANKAAK. 332
66 8.000e-40UniRef50_D6D563 Virulence protein n=24 Tax=Bacteria TaxID=2 RepID=D6D563_9BACE  ali  42  136...GGYYWKELLDRIRDIRSSEKVMYRQVLDIYATAVDYDPHAKQSIEFFKIVQNKLHFAAHGHTAAEVIYERADADQHMMGLTSFKGDHPTLRDAKIAKNYLSAEELKVLNNLVSGYFDFAEVQAIKHRPMYMNDYIKHLDAILSSTGEVLLMDAGMISHEQAMDKAETEYRKWEVRTLSPVEQAYLNSI......... 323
67 8.000e-40UniRef50_A0A0G0EBS8 Uncharacterized protein (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A0G0EBS8_9BACT  ali  39  166...GGVYWKKLLARIRDIRSSEKMLYRQVLDLYATSVDYDPKSLHSVEFFKIVQNKLHFATHKQTAAEVIYSHADSNKEFMGLTVFAGDLPILEEVRIAKNYLTAKELEKLNRLVSAYFELAELRAMNKQTMDIANHIKALDSLLGDYGEGVLVGSGKISHEKAIEKAEKEYRKYQVKTLSPAEKDYLE........... 351
68 8.000e-40UniRef50_B6IQ09 DNA-binding protein, putative n=5 Tax=root TaxID=1 RepID=B6IQ09_RHOCS  ali  53  128.....DYFDELLERIRDIRASEARFYQKVRDILALSVDYTAKADTVPTFYATIQNKMLHAVTHHTAAELIAARADENAPNMGLTSWKGGRVRKADVTTAKNYLGETEVRELNLIVGMFLDTAELRSTRRQQIHLAEWETILDGFLKANELPLLHNAGSVSAKQAEKIAHDRYALFDTQ...................... 300
69 1.000e-39UniRef50_UPI000DE98181 hydroxyacid dehydrogenase n=1 Tax=Sphaerisporangium album TaxID=509200 RepID=UPI000DE98181  ali  55  160...GVDYFDELLERIRDIRASEARFYQKVRDVFQTSVDYDSKSDIASTFFATIQNKLVFAVTGYTAAELVVKRADPSKANMGLTSWKGAKVRKADTTVAKNYLNADEIDDLNRLTTQFLDYAETRAKRRQQITMAEWVVKTNDFIQFNEYAVLTNAGRVSHKDMEAMVAERFK........................... 330
70 2.000e-39UniRef50_A0A1F1E851 Cell filamentation protein Fic n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1F1E851_9PORP  ali  34  139..FGKDYFRELLERVRSIRASERRIWQQITDIYECSIDYDKRSQTTKDFYSMIQNRFHYAITGQTAAEIIFTKADHTKEHMGLTTWKNGRILKSDVSVAKNYLGEDEIRRLERAVTSYFDYIEGQIERHNTFTMEQFTVSVDKFLSFNDYKILPDRGRISATEAKAKSEAEYDIFNKTQHI------DSDFDKEVRKMLR 334
71 3.000e-39UniRef50_A0A1G7ZME9 Uncharacterized conserved protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1G7ZME9_9FLAO  ali  43  134....PDYFDELLARIREVRASEKRFYQKVRDLFALSSDYDPTDKATQMFFAETQNKLLYAVTNKTAAELIVARANAKDPNMALTTWKGSQVRKQDIFVAKNYLNEDELDSLNRLVVIFLETAELRVKNRIDITMRFWKENVDRVLEFNDKAILKGLGSMSNKQMDEKVRKIYAQFDANRKLEEAKNEDA........... 318
72 3.000e-39UniRef50_F2BAH3 DNA-binding protein n=7 Tax=Bacteria TaxID=2 RepID=F2BAH3_9NEIS  ali  43  131.....DHFDELLAEIREIRASEARFYQKVRDLFALSSDYAKTDKAAQMFFAETQNKLIFAVTRQTAAELVCTRADAALPNMGLTAWKGKVVRKGDIVVAKNYLSADELDTLNRLVMIFLESAELRVKNRQDLTLDFWRGNVDSLIGFNGFPVLQDKGGCTHRQMELFVQEQYALFNQARLAADEAEDLRELESWQKALEK 329
73 3.000e-39UniRef50_UPI000B3819D9 cell filamentation protein Fic n=1 Tax=Butyricimonas sp. An62 TaxID=1965649 RepID=UPI000B3819D9  ali  43  86...SMNYFRELLDRIREIRLSERLFYQQIKDIYATSVDYDPSDEMTLAFYKEVQNKLLWAVSGKTAAELVYYRANASLPQMGLTSTSPNKVSKTDVEIGKNYLTEEEIGLLKLIVEQFLAYAETQAMQHKVMYMRDWIEKLKQVLTMNDKNILEHAGSISHKLAMQKVADEYDKYKVAQKQLEHLESIKELEQDVQKLR. 282
74 3.000e-39UniRef50_A0A0E4GHR2 Putative DNA-binding protein in cluster with Type I restriction-modification system n=142 Tax=Bacteria TaxID=2 RepID=A0A0E4GHR2_V  ali  47  130.....DYFDELLERIRDIRSSEKRFYQKIRDLLALSEDYRANEKETGLLFAEVQNKLFFAVTGHTAAELIVERADSSKPNMNLTSFAGNKVRKADVVIAKNYLQADELENLNRLVSMFFEFAEFRAKNKAHLRLQDWREYVDKFMDFNEQPLLNSAGRISRKQMEQIAHKHYETFN........................ 300
75 3.000e-39UniRef50_A0A1X0U117 Cell filamentation protein Fic n=7 Tax=Campylobacter TaxID=194 RepID=A0A1X0U117_9PROT  ali  47  139..FNKDYFKELLERIRAIRASEKLFYEKVRELFALSVDYDKTSQTAKNFFANIQNKLEYAVTKKTSAEIIKERADHTKPNMGLTTWKGKEPIKSDVSVAKNYLYENELNGLNRLTGMLLDYAENQAEQGKVIQMKDWDIKVDNFLIFNGYEILKGFGKFSADNAKAKAELEYTKFKELKQDDSFKDEVKRIIAKGKK... 337
76 3.000e-39UniRef50_A0A2N1PJ73 Cell filamentation protein Fic n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PJ73_9BACT  ali  35  129..FGKDYFRELLERVRSIRASERRIYQQITDIFECSINYDPKSETTRNFYAHVQDKFHFAITGHTAAEIIYLNVDAEKPLMGMMTHPDGRVLKSDTTIGKNYLQEDEIKKLERTVTAFFDYIERIIENRSTFTMESFAESVNRFLEFNEYRILEGYGSVTRKKAEEKAFSEYDKFNKTQRIE------SDFDKAVKQIE. 323
77 4.000e-39UniRef50_A0A076NLB3 2-hydroxyacid dehydrogenase n=9 Tax=Corynebacteriales TaxID=85007 RepID=A0A076NLB3_9CORY  ali  45  145...GADYFDELLARIRDIRSSEKRLYLELRNIIALADDYDASSKRTHFLFAKIQDKLHYAITGNTAAEIIATRCNPSADNLGLTNWKGKIVRKGDVTTAKNYLTDDELRRLNFLVSGFLNYAQDQADRRKVIHMSDWLTKADHFIEFNDYEPLDDHGRITRKDANTLAEDRYGLYDQGRKEVEYREAESDLIEALKEADR 341
78 4.000e-39UniRef50_A0A2M7JD10 Uncharacterized protein (Fragment) n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2M7JD10_9BACT  ali  44  67..YKSRYFEELLERIRDIRSSERMLYQKVTDIYATSIDYRKDAKETELFFKTVQNKMHFAISGKTAAEIIAERADSKKPLMGLTNFSGIHPIQRDIYIAKNYLDERELEMLNRIVDAYLSFAEIQAKSEHAMTMKDWIHKLDEYLLLLGKGILKNAGSVRAEEAENKALKEYDKYRQERD----KNYISDFDREVKKLSK 260
79 5.000e-39UniRef50_A0A0B2JIN5 Toxin Fic n=16 Tax=cellular organisms TaxID=131567 RepID=A0A0B2JIN5_9GAMM  ali  40  144..FGKDYFKELLERVRSIRASERRIYQQITDIFECSIDYDAKSETTRLFYAHVQDKFHFAITGHTAAEIIALKADASQPLMGMTTYPEGRILKSDTTVAKNYLAEDEIKKLERAVSAFFDYIEGIIERRNTFTMEAFAESVNKFLAFNEYQVLEGYGNVTRKAAEQKAHEAYEQFNKQQKIE------SDFDREVKKL.. 337
80 6.000e-39UniRef50_A0A0G3WFD4 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0G3WFD4_9CLOT  ali  45  129...GGIYFDELLERIRDIRSSEKVFWRKVLDIYATSVDYDPRMESSMLFFKTVQNKMHWAAHGQTAAEKIYYAANADKPHMGMLSFKGEQPTQADALVAKNYCTEDELAALNSVVSAYLEFAEMQARRRIPMYMSDWIETLDGFLKLSKHEILTHAGKISAKTAELKAKEEYKKYKALHISQVEKDYIDALEDMEMKL.. 326
81 6.000e-39UniRef50_A0A1H5M3W1 Uncharacterized conserved protein n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A1H5M3W1_9MICO  ali  49  132.....DYFDELLERIRDIRASEKRFYQKVRDIFATSADYQSASPLAQEFFATIQNKLLYAVTGCTAAELVVHRADADAPHMGLTNWQGDRVRKRDIAVAKNYLKADELSMLNLLTTRFLDFAEDRARRRQQITMAEWVRQTDRFLDFDERPVLSGAGTVSARSAESITAERYRDFDESRRSHERERAHAEEERDLERL.. 325
82 7.000e-39UniRef50_U2SDM9 Toxin-antitoxin system, toxin component, Fic family n=1 Tax=Propionibacterium acidifaciens F0233 TaxID=553198 RepID=U2SDM9_9ACTN  ali  52  131...GQDYFDELLERIRAIRASEKRFYQKVRDFYATAVDYRADSDEARTFFAAVQNKMLWAVTGHTAAEIVALRSDPDAPVMGLTSWRGEVMRKGDVAVAKKYLDRDETKDLDQIVTMYLDYAETQARRRRTMTMAQWAERLDAFLQFNERELLTHAGTVCADVARALAEDR............................. 298
83 7.000e-39UniRef50_Q6N5L6 Putative DNA-binding protein n=849 Tax=root TaxID=1 RepID=Q6N5L6_RHOPA  ali  50  137...GLDYFDELLLRIRDIRASEKRFYQKVRDLFATSVDYDGCADTAKAFFATIQNKLVFAVTGQTAAELIVARADPERPNMALTSWVGERVRKTDVTISKNYLTTEEIDSLNRLTTMFLDFAEDRASRRQETRMADWITQTDRFLSFNEREVLQGKGRMSHERMTEIAHARFDAFD........................ 310
84 8.000e-39UniRef50_A0A0G1I5W9 Uncharacterized protein n=14 Tax=Bacteria TaxID=2 RepID=A0A0G1I5W9_9BACT  ali  45  141......YFQELLQRVRDIRSSERMFYQKVTDIYATSIDYKVDTELTQKFFATVQNKMHYAVHGYTAAEIVARRADSKKPLMGLTSFKSDYITARDIVIAKNYLTEPEINQLNLIVSLYIDFAELQGSSGRLMKMQDWIRKLDEFLTISEKKLLHSAGKVSTKQAEEKALKEYEKYRKEQD----KNYVSDFDREVKKI.. 328
85 8.000e-39UniRef50_U2KZT5 Toxin-antitoxin system, toxin component, Fic family n=2 Tax=Bacteria TaxID=2 RepID=U2KZT5_9BACT  ali  42  13....PDYFDELLEHIRDIKASKKRFYQKLRDLFKLSSDYDTHQKATQMFFAETQNKLLYAVTHHTAAELIASRANSSKSNMGLTSWKGTIVRLQDIMIAKNYLEKDEIDTLNRLVTIFLETAELRVKDRKSLTLDYWRNNVNNLLNFQNMDILPGKGTISNNQMEFFVKKVYEKFDQKRKESEAKEADLDELKALEDLEK 208
86 1.000e-38UniRef50_A0A1L1PUF2 Virulence-related protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1L1PUF2_HYDIT  ali  54  139.....DYFDELLQRIRDIRSSEKRFYQKVRDLFALSVDYADDGHATGLFFAEVQNKMFFAVTGHTAAELIVRRADPEQPNMALTSWKGGRVRKADVTVAKNYLTADELDQLNRIVGMTLDFAELRAKQRQNLRMADWRSYVDKFLTFNEQPILQGNGRMSHEAMTTIAHERYEQ.......................... 307
87 1.000e-38UniRef50_A0A2H0DIA9 Hydroxyacid dehydrogenase (Fragment) n=1 Tax=Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91 TaxID=2014312 RepID=A0A  ali  46  21.....DYFDELLARIREIRASEARVYQRIREIFSLAKDYVEGQKETQVFFATMQNKMHYAAAGLTAAEIVRRRADSRKANMGLTSWSGTRVLKRDVTTAKNYLSAKEIDTLNRIVVMFLDQAEFRAQRRQDIMMGDWTAFLDRFLRHTELPVLPDSGKVSREEAQAWANDQYDAFAERRRLEAEGRYLEDLRSSAKTLE. 218
88 1.000e-38UniRef50_D3E0H3 Uncharacterized protein n=6 Tax=Methanobrevibacter TaxID=2172 RepID=D3E0H3_METRM  ali  39  146.RFTEDYFDELLETIREIRASERRFNQKITDIYATSFDYNKDADITKEFFATVQNKLIFAISNHTAAELIETRSDIENPHMGLTTWPNGKILQSDVVISKNYLNQNELSRLNSLVEGFLNLAESRAEDRIPMGMKDWKELLDDYLKLRRLPILVGKGKISAEEAREHVLEKYEKFRVVQDENFISDFD-QMILDIKRLE. 345
89 2.000e-38UniRef50_A0A2S9SY90 Cell filamentation protein Fic n=6 Tax=Bacteria TaxID=2 RepID=A0A2S9SY90_9PROT  ali  41  130..NSMGYFDELQKRLRDIRISEKFFYQKIKDIYMTSIDYDPKDEKTIEFFKIVQNKLLWAVSSQTAAELVHNRVDMSKPLLGMSSYDKENLTKKDVSIAKNYLNEEEIKLLGLLVEQYLAFAETMAIQRTPMYMKDWIARLDAVISLNGRELLTHAGKISHEMAIAKSGLEYKKFKDEQKKIEKIQSLKELEEDIKRLK. 328
90 2.000e-38UniRef50_A0A1G3IG44 Hydroxyacid dehydrogenase n=1 Tax=Rhodospirillales bacterium RIFCSPLOWO2_12_FULL_58_28 TaxID=1802022 RepID=A0A1G3IG44_9PROT  ali  54  128.....DYFDELLERIRDIRASEARLYQKVRDILTLSVDYDAKADSVQTFYATIQNKMLYAVTHHTAAELIAARADANAPNMGLTSWRGGRVRKADVTTAKNYLGEAEIKELNLIVTMFLDTAELRSTRRQEIHLSEWEPILDGFLKSNELPMLRNAGRVSAKQAEKIANERYTMFDTQ...................... 300
91 3.000e-38UniRef50_A0A221RWP4 Cell filamentation protein Fic n=1 Tax=Lactobacillus curvatus TaxID=28038 RepID=A0A221RWP4_LACCU  ali  45  127LTSNMTYFKQLQKRIRDIRSSERLFYQQVLDIFATSIDYDGKSDEAKGFFQTVQNKMLFAVTGHTAPELIFNRLDATKENLGLTNYKGNYPRKSDLKVSKNYLDETELKRLNLIVSGYLDTAEYQAEMQSAMTMADWKTELDRFLDYQRADILQGKGTVSRKSADARIDDEYRKYQDQHITKVDEDYFRALTKDIKQLK. 327
92 7.000e-38UniRef50_A0A1G6HSU6 Uncharacterized conserved protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1G6HSU6_9FIRM  ali  36  138TVFGKDYFRELLERVRSIRASERRIWQQITDIFQCSIDYDKDSEVTHQFYAMVQNKFHYAITGQTAAEIIHSRADHTREHMGLTVWPDGRVLKSDVTIAKNYLSETQIRRLESAVSGYFDYIEDLIEREITFTMEEFAASVNEFLAFRRYDILQGSGRISRSAADAKAIAEYEEFNKTQRIE------SDFDKEVKKM.. 333
93 9.000e-38UniRef50_A0A2A4YZ73 DNA-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2A4YZ73_9PROT  ali  34  144..FGQDYFDELLDRVRSIRTSERRIYQKITDIFEISTDYDKRSEITKNFYAMIQNKFHFAITGHTAAEIIHSKADHNEPHMGLHTWPEGRILTSDVVIAKNYLEEKEIKKLERTIVAFFDYIENIIENRISMAMEDMAESVDKYLNFNEYKILEGKGKMSKDQAVKKAKKEYKEFNKNQ--TIESDFDKQIKQSL..... 338
94 1.000e-37UniRef50_B0RZN6 Uncharacterized protein n=3 Tax=Finegoldia magna TaxID=1260 RepID=B0RZN6_FINM2  ali  36  142..FGTDYFRELLERVRSIRASERRIWQQITDIFECSFDYDKNSEITRNFYAMVQNKFHYAITGKTAAEIIYEKSDSTKNNMGLTTWPDGRILKTDVTVAKNYLSEKEIRKLERLVTGYFDYVEDLIEDEVLLGMEDFSSSLNDFLNFRRYKILSGNGHISAKKAREKAIGEYMIFNKNQLIN------SDFDKFIKK... 334
95 2.000e-37UniRef50_A0A1W1V919 Uncharacterized conserved protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1W1V919_DESTI  ali  44  129...GGIYFDELLERIRDIRSSEKVFWRKVLDIYSTSVDYDPRAETSMLFFKTVQNKMHWAAHGQTAAEKIFYSVDAEKPYMGMLSFQGERPKQADAMVAKNYCNKEELSALNSVVSAYLEFAEMQARRRIPMYMSDWIETLDGFLKLSKYEILTHAGKISAKTAELKAKEEYKKYKKLHISKAEKDYTRALEDMEMKL.. 326
96 3.000e-37UniRef50_UPI0005314594 cell filamentation protein Fic n=2 Tax=Elizabethkingia TaxID=308865 RepID=UPI0005314594  ali  42  135...GGNYWKELLDRIRDIRSSEKVMYRQVLELYATATDYDSKSDESLTFFKIVQNKLHYAAHGNTASEVIYMRVDSDKPYAGLTSFKGDEPTQAEAMIAKNFLEEKELKVLNNLVAAYFDLAELNAIEEREMQMADYIRELDTILASTGRKVLDNAGRISHTEAIEKAAIEYKKYKAKTLSAVEKDYLKTI......... 322
97 4.000e-37UniRef50_R5TMJ1 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=R5TMJ1_9CLOT  ali  39  139.KSDQEYFNRLLERIKLIRTSERMFYQKITDIFECSIDYDKNSDIAKDFYATIQNKFHYAITGNTAAEIIYNRVDSQKVNMGLTNWPDGKILKSDICIAKNYLEEKEIKNLNNLVNLFLDVAENNAERNLSMSMKDWKNEVETSLKLFHYEILEGKGKISTEKAKQKAESEYEKYKIKQDKKFVSDFDKLLIETQK.... 337
98 4.000e-37UniRef50_A0A1I0MPG3 Uncharacterized conserved protein n=9 Tax=FCB group TaxID=1783270 RepID=A0A1I0MPG3_9BACT  ali  46  133...GNRYFRELLQRIRDIRSSERNFYQQVTDIYATSTDYDPRAKMTKLFFATVQNKMHYAVHEHTAAELIYERVDNEKPFVGMTNFKGNYVTRDDVKVAKNYLTELELQRLNLLTSQFLDYAEFQALEQNPMTMADWIAALDDQILRLRKNILEGSGTVSHQEAIEKAEREFEIYRER...................... 307
99 5.000e-37UniRef50_A0A139TRB3 Toxin-antitoxin system, toxin component, Fic family n=78 Tax=cellular organisms TaxID=131567 RepID=A0A139TRB3_9BACT  ali  47  150....PDYFDELLERIRDIRASERRMYLRIKDVFAMAADYIPSGKETTEFFSSIQNKLHYAITGHSAAELMMMRADASVPNMGLTSWVGDRVHASDITVAKNYLKEEEISDFNRLTSLCLDFVEDQAKNRREIFLHEWENKLNELLLLMGRRVMKGKGERSRKQAQAHVREQYRLYEERRRLSDE................ 329
100 5.000e-37UniRef50_A0A270BFH2 Hydroxyacid dehydrogenase n=1 Tax=Acetobacter syzygii TaxID=146476 RepID=A0A270BFH2_9PROT  ali  45  134.....DYFDELLERIQAIRASEAQFYRKVRDILALSDDYEPSSRAALAFYATIQNKMLYAVTTHTAAELIIERSSATAPNMGLTAWKHGRVRKDDVTVAKNYLGDLEIRELNQIVSMFLDTADLRARRRLTIKLAEWEGILDRFLASNELPVLHGAGNRSKMSADTIAHRRYAEFDAARKEAARKLAESEPDIDV..... 323
101 5.000e-37UniRef50_A0A083WYA3 DNA-binding protein n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A083WYA3_BIFLN  ali  34  139..FGQDYFHELLQRVRDIRASEKRFYVQICEVFQICTDYDKDAPIVRTFYKNVQNRFHYAVTQHTAPEIIHERADAGKPHMGLTTWPDGRIHSSDVTIAKNYLSEDEINKLNRLSSGFLDMIESRIENMQTTTMSECLQLINTYIQLTGGPLMPDIGKVTRKQADVKARAELARYN-----QSSPDQLSDFEKFARGLDQ 335
102 6.000e-37UniRef50_A0A263DAV8 Hydroxyacid dehydrogenase n=13 Tax=Bacteria TaxID=2 RepID=A0A263DAV8_9PSEU  ali  48  134...GTDYFDELLQRIRDIRASEKRFYQKVRDLFVTSADYSSTSGTAKTFFATIQNKLIFAVTGHTAAELVLSRSDARSPSLGLTTWAGDRIRKGDVVIAKNYLTEPEITELNRLTTMFLDFAEDRAQRRRTTLMAEWVAQTDRFLDFNERNVLNGPGSVSASEMKEVAGER............................. 302
103 6.000e-37UniRef50_A0A1F9QHK4 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium GWA2_56_46 TaxID=1797922 RepID=A0A1F9QHK4_9BACT  ali  47  138.KFDTRYFEELLEEIREIRASERMVYQKITDIYATAVDYSPNTAEAEKFFATVQNKMHWAITGQTAAEIISERADKNKPHMGLTTWRKGKILKPDVGVAKNYLQKNEIKELNHIVDMYLDYAELQASRGRLMKMKDWVEKLNAFLKFHEMDVLQDKGKVSREVALTLAEKEYEAFRIEQD----KTYISDFDKAVKMLK. 334
104 7.000e-37UniRef50_UPI0009F6749E DNA-binding protein n=1 Tax=Corynebacterium sp. HMSC071B10 TaxID=1739494 RepID=UPI0009F6749E  ali  36  45...KDTHFEELLERIREIRVSERQFFRKICDVISATSADYKSFNSVRQFFTGIQNRLHFATHGRTAAELIWERADRKKPNAGLTTWQGEQPHKGDMEIAKNFLTEDEARRMRRLTSMFLDYAEDQSEMGKTLLLKDWMEKTDAWLVFNEREVLKGYGKRQHKQAVEKAKTEWVEYQRRLDAEVNAKDMAQIEREVKALKR 244
105 7.000e-37UniRef50_UPI000C775665 cell filamentation protein Fic n=1 Tax=Thiopseudomonas denitrificans TaxID=1501432 RepID=UPI000C775665  ali  44  69.........ELIENIQDFRADGKTYRTKHYNLHATAFDYDRSAPTTRDFFALVQNKLHWAVHRHTAAELIVARADASQPNMGLTHWQGGKIIKTDVSIAKNYLSKDELDYLERIVSLYLDFGELQAQRKIPMSMADWATRLDGFLEFNGNEILTGSGKISHEQAKLHAETEFEKYRVVQDQLYASDFDRFLE........ 259
106 1.000e-36UniRef50_A0A2A4X034 Hydroxyacid dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A2A4X034_9GAMM  ali  43  135.....DYFDELLARIREIRASEKRFYQKIRELFALSADYDKTDHNAQLFFADVQNKLLYAVTEKTAAEIVQDRADPNAANMALTHWSGLRVRKHDVIIAKNYLKENEIDHLNRLVVIFLEQAELRTKQRQQLTLEYWQQNIVRLLEFNEQSILTHKGNISAEAMKNRAHEKFETFDAHRRKAEAILADETDIRVLEELAK 329
107 1.000e-36UniRef50_R7M5L3 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=R7M5L3_9CLOT  ali  40  130.KYDSKYFDELLERIKTIRVSERMSYQKITDLFITSTDYNPKSEEAYTFFKIVQNKLHYAISGHTAAELIYSRANSEKEHMGLTNWPDGLIYKYDVGIAKNYLNKEELEKLNDLTNIFLVFAEDEAKERHVMTMKDWINATDDLLKFRRKEVLQNSGNISHKQAVEKAENEYEKYRVMQDQKYISSMDEFYNKYLEE... 329
108 2.000e-36UniRef50_K5ZXK1 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=K5ZXK1_9BACT  ali  45  140......YFKELLDRIRAIRISERLFYQQIKDIYMLSIDYDKNDQLTLDFFASVQNKLLWAVSGKTAAELVYYRSNASLPMMGLTSTEKEGIVKSDINIGKNYLTKDELDNLKLIVEQYLSFAEAQAINHIPMRMKDWGDNLNIILTMNRKSILEGLGKVSKELARKKAQKEYALYKESQK.................... 314
109 2.000e-36UniRef50_X5DWB3 Uncharacterized protein n=2 Tax=Corynebacterium TaxID=1716 RepID=X5DWB3_9CORY  ali  36  145...GSDHFDELLDRIRDIRASERRFYAKITDVISATADYRPSETATKDFFAALQNKLHWATFGKTAAEIVCERVDHMKPNCGLTTWSGEQPRLQDTRVAKNYLQDEELRTVNRLTTMFLDYAEDQTGKRKQLFLSDWALQTDKFLEFNDREILTHRGKRSNAQVKTITKREWDAYRHRHTAEMEEKEMAAIEAIV..... 337
110 1.000e-35UniRef50_A0A099TY37 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A099TY37_9HELI  ali  41  136...KQDYFDELLERLRDIRSSETRMHAQVLKIFSTAIDYDKDSLQVQELFKTIQNKLHYSAHGYTASEIVFQRADSDKINMGLTNFKGKMPTKKESEIAKNYLNQEELEALNRIVTAYFEFAELSALNREQKSMQEHLEKLNEFLKLSGREVLQNAGKISHQKALDKAHKEYNLYKQKTKEEIEIAY-EEFNAKTKALRK 331
111 2.000e-35UniRef50_A0A0R1S090 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0R1S090_9LACO  ali  43  127LTNNVTYFKQLQKRIRDIRSSERLFYQQVLDIFATSVDYDGSNIVAKTFFQTVQNKMLFAVTGQTAPELIFSRLDAQKDDLGLTNYQGHYPRKSDLKVSKNYLNEQELNRLNLIVSGYLDTAEYQAETQTAMTMADWQAEIDRYLDYQRADILKNKGAVSRQTANLKVNQAYEHYQKNHHTQVDEDYFKALKNEIHQLK. 327
112 2.000e-35UniRef50_W5Y0Q9 Putative DNA-binding protein n=12 Tax=Corynebacterium TaxID=1716 RepID=W5Y0Q9_9CORY  ali  39  15......HFDELLERVREIRTSERQFFRKVCDVIAATSADYKSYETVRRFFAGIQNRLHFATHGQTAAELIYSRADRDKPNAGLTVWSGEEPHKGDMKVAKNFLTEDESRRMRRLTSMFLDYAEDQAEMRKTMLLKDWMAKTDAWLVFNDREVLEGNGTRSHEQAMDKANTEWDAYLDRRDREVNEIDMRQLQAEVEAIRR 211
113 3.000e-35UniRef50_A0A174RZZ2 Virulence protein n=1 Tax=Parabacteroides distasonis TaxID=823 RepID=A0A174RZZ2_9BACT  ali  36  20.......................NFYQQVTDIYATATDYDPRDEMTKLFFATVQNKLHYAVHENTAAEVIYNRVDNEKPFVGMTNFKGNYVTKDDVKIAKNYLSEIELQRLNLLVSGFLDFAEFQALEMNPMTMKDWIEALDNQIIAHKRKVLIGKGNISHKQAIEKAEKEFAIYRKREMELLESDFDKEIKKL...... 190
114 3.000e-35UniRef50_A0A1Y4CUJ7 Uncharacterized protein n=1 Tax=Desulfovibrio sp. An276 TaxID=1965618 RepID=A0A1Y4CUJ7_9DELT  ali  40  147LKYGDGYFRELLDRIRDIRSSEKLFYRKVRDLIAATYALSKNEESVRNFFAHLQDCMLYAVSGHTAAEIKFLRADGTKPCMGLTHFRGDKPKLDDADIAKNYLTASELDDLNRLVTMFLDYAEMRASRHQDMTLADWQEQAQRFLEFNERRMLTGYGTRRSNDAREYVRQQYNLYRQNCTALEEQSDARQDNEEEARL.. 350
115 8.000e-35UniRef50_A0A1Y0VR75 DNA ligase (NAD(+)) n=272 Tax=cellular organisms TaxID=131567 RepID=A0A1Y0VR75_PEDPE  ali  34  137..LDKDYFDELLERVRSIRASERRIWQKITDIFEISTDYDKNSVVTRNFYATVQNKFHYAITGQTGAEIINSHANHNKPHMGLTTWPNGRILKSDAQIAKNYLSKDQIKKLERNVSSYFDYVEDLIERHHVFTMQNFAESIDRFLEFREYKVLPNNGIVSMTTAKTKAKAEYDEFNKTQKIN------SDFDKQIKHIEQ 332
116 9.000e-35UniRef50_UPI0009FAB300 hypothetical protein n=1 Tax=Hyphomicrobium sp. NDB2Meth4 TaxID=1892846 RepID=UPI0009FAB300  ali  37  154LKNEPDHFADLRRLIQDIRASEANLYAELRRIVSMCNDYDPGSKESRNFFALFQNRLLFAITGHSAAGILTSRADARQPNMGLKAWKGNEPLQTDVLTAKNYLGDLELEDLNRLVGMVLDFFEDQVKRGFLVSMADAEAKLQEIFTVNRRLMMPGLGKPSHNAAEKHVKEQYKIFDLARRDERKRLALDDLNTAFAQL.. 351
117 1.000e-34UniRef50_UPI000373B0F2 hypothetical protein n=1 Tax=Ahrensia kielensis TaxID=76980 RepID=UPI000373B0F2  ali  41  164.....DHFKELREIIRDIRASEANVYKEVRAICALCSDYEMHDDKANQFFATVQNKLHYAVTSMTGAEIRVNRADHRKPNMGLTTWKGVKPLSSDCNTAKNFLGEAEIRDLNRFTNMLLDYFEQETDLQRLVKMSDAEAALDKFIKNNERPLLNHAGKISKKVADSHVTSEYKIFAENRRKFLDGDGGEE.......... 349
118 2.000e-34UniRef50_A0A2E2X5L7 DNA-binding protein n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E2X5L7_9RHIZ  ali  33  141.....DRIAELREIIRDIRSDEANVYRELRRVCSMCQDYGGNADAARQFYQRTQAKLIYAVTSHTPAEIVTTRADHAKENMGLQTWPNTEIRKMDAGVSKNYLAEGELRELNRLTTILLDIFEDQLDMGRLVLMQDAQELLDRQLDQLGRTVLRSGGNVSAADAQKVADTEYEKFNAQRKLGRHREADERIAALAKEAK. 334
119 2.000e-34UniRef50_A0A1J1DQN6 Uncharacterized protein n=2 Tax=Candidatus Desulfovibrio trichonymphae TaxID=1725232 RepID=A0A1J1DQN6_9DELT  ali  50  138...GAEYFDELLARIRDIRSAEKVFYRKLRDIFALSTDYAQQNQGAHKFFQTVQNKLHWAAAGKTAAEIIQSRADAAEPNMGLTNWTGNRIRKADVGTAKSYLNADELDTLNRIVTMFLDQAEFRARRRQVVYMADWETWLDKFLADQELPVLTHAGRISA....................................... 296
120 2.000e-34UniRef50_A0A1Y5PXT9 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5PXT9_9SPHN  ali  35  138...NRDRIAELKEIIRDIRSDEANVYRELRAICAMCQDYDGTSPAWRDFYRNTQAKLIYAVCSNTPAEVLRLRADAGEPNMGLQSWPNANIRKADVGTSKNYLAEGEIRELNRLTTILLDIFEDQADIGRLTSMAQAGELLDRQLSSLGRAVLRSGGSVSMTDAARHAEREYEKFKAAQRQLRHEQADRDIKAAQKDLKK 337
121 3.000e-34UniRef50_N0B232 Uncharacterized protein n=1 Tax=Hyphomicrobium denitrificans 1NES1 TaxID=670307 RepID=N0B232_9RHIZ  ali  42  138LKGNVDRLRELREIIRDIRSDEANMYAELRHICAMCQDYDPKSKLCQEFFANFQNRLLYAVTAHTSAELIKARANAKSENMGLTAWKGDRVLKADTDVAKNYLGKIELQDLNRLVGMVLDFFEDQTERGLLVTMTDAEKKLLEILTLNSRVMLKGFGRVTAKKAKDHAHTQYELYKETQRMKN----VAELGNAAKALPK 333
122 4.000e-34UniRef50_A0A0G0W8Z2 Uncharacterized protein n=1 Tax=candidate division CPR2 bacterium GW2011_GWC1_41_48 TaxID=1618344 RepID=A0A0G0W8Z2_9BACT  ali  45  3...................TSEKRFYRKITDIYATSVDYDPTDETSILFFKTVQNKVHYAITGQTASEIISSRADSTRPYMGLTSWRGTKPRKDDVTIAKNYLTEPELLALNNLVEQYLVFAEGQAMRRVPMYMKDWIEKLHGFLKLNDRDILTSAGKVSHELAVETAEKHFDEYKKNEAKSLDTDFD............ 171
123 1.000e-33UniRef50_A0A0J6WU93 2-hydroxyacid dehydrogenase n=8 Tax=Bacteria TaxID=2 RepID=A0A0J6WU93_9FIRM  ali  44  127....PDYFDELLAQIRDIRASEKRFYQKLRDLFSLSVDYDKTDVATQQFYAETQNKLIYGVTGQTAMELIINRADAKQPNMALTSWKGSVVRKQDIYTAKNYLASDELDVLNRLVSIFLESAELRTKIHKTLTLTYWRHTVDKLLTDHDIPVLHTAGSRSREQMKSYVNTE............................. 293
124 2.000e-33UniRef50_UPI0008A45E62 hypothetical protein n=1 Tax=Corynebacterium TaxID=1716 RepID=UPI0008A45E62  ali  40  131......HFDELLERIREIRASERQFFRKICDVIVETYQERKSFKEVSNFFATLQNRLHYAIHGSTAAELIFTRADRAKPNAGLTNWQGEKPHLTDMYVAKNYLDDPELRRLNRLTTMYLDYAEDQSEMGKTLLLKDWEQKTAEWLAFNERNVLQGLGKRTKEQAKTKAKTEWNAYLAQLD.................... 307
125 2.000e-33UniRef50_A0A0E2NCX7 Toxin Fic n=1 Tax=Mesorhizobium sp. LSHC414A00 TaxID=1287287 RepID=A0A0E2NCX7_9RHIZ  ali  39  149...SRDHLKELKETIRDIRSSEANLYREVRSICAMCQDYDPQSEEWRNFYAGMQNKLLWAVASKTGPELILERANADAENMGLTTWANENIRKNDVWIANNFLAGAEIREKNRLTTMLLDYFEDQVDIGRLVMMAEAEERMNGFIKFNNRPLLTHLGSVKREKAQAHAERQFEKFKEKRRTLRQ................ 329
126 2.000e-33UniRef50_A0A256WHB1 Cell filamentation protein Fic n=1 Tax=Bacteroidetes bacterium 4572_77 TaxID=1972459 RepID=A0A256WHB1_9BACT  ali  41  127...GGNYFDELLARIRDIRSSEKVFWRKVLDVYATSIDYDPKTDQSIMVFKTIQNKMHWASHGETAAETVYKRVDSAKEHIGLTNFKGEIPTKQEVEIAKNYLVEDELNILNRMVTAFLEIAEIQALDRTPMYMADWVKQLDAFLKMTNKDIL----------------------IKNRITQVEKDFIKQIEESTKRIK. 300
127 2.000e-33UniRef50_A0A0J1FJK7 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J1FJK7_9FIRM  ali  45  97...GGNYWRELLERIRDIRSSEKVFYRQVLDLYATSVDYDPRTPESLEFFKIVQNKIHFAAHGHTAAEVITQRANAELPFMGLTVFSGEQPTKGEVGIAKNYLTEEELATLNRMVSAFFDLAELRAMQHRPMYMWDWVAELDKRTILRDMSKWEKWTTGFLRTLPFHARE.............................. 263
128 3.000e-33UniRef50_F9D636 DNA-binding protein n=34 Tax=Bacteria TaxID=2 RepID=F9D636_PREDD  ali  45  132.....NYFKELLDRIREIRLSEKVFYQQIKDIYATSIDYNPSDELTLAFYKEVQNKLLWAVSGKTAAELVYYRANASLPMMGLTTEREGKVTKADALVGKNYLHEKEIGGLKLIVEQFLAYAEAQALAEKPMYMRDWVQKLRLILTMNEKNILEHAGKISHQLAXXXXXXXXXXXXXXXXXXXXXDSIRQLDRDIRRL.. 325
129 4.000e-33UniRef50_D2ZMY2 Uncharacterized protein n=1 Tax=Methanobrevibacter smithii DSM 2374 TaxID=521002 RepID=D2ZMY2_METSM  ali  36  21TRFGKDYFDHLLSRIREIRASERRFNQKITDLYATSANYNLDADETKDFFATVHNMLLFAITGQTAAEIIKSRSDKNKINMTLEDAPHGKILQADVVISKNYLNEMEIDSLNTLVDGFLTLAETRANSQKPTFMKDWKTLIYGYLELSQLPLLEGKGKVSSIEAN................................... 188
130 4.000e-33UniRef50_A0A1G9PLK1 Uncharacterized conserved protein n=1 Tax=Pedobacter steynii TaxID=430522 RepID=A0A1G9PLK1_9SPHI  ali  40  134...KSNYFDELYDRVKSIRISEKNFWQKIKDIFAFSIDFESDSEIAKTFFATVQNMFHYAIHEHTAQELIKERADGHKENMGLNAWSGNEITKDDTTIAKNYLTELELKRLNLLSDQFLSFAELQSVEKRAMYMSTWVAKLIEFLKLNEKPILQDAGKVSKSIGEQIALSEFQKFEEIRKEERQK............... 316
131 4.000e-33UniRef50_W6EHI4 Virulence RhuM super family protein n=2 Tax=delta/epsilon subdivisions TaxID=68525 RepID=W6EHI4_SULMU  ali  42  131...KPDYFDELLERIRDIRASEKRFYQKVRDLFMLSSDYDKSDKATQLFF-----------------------ADAQEPNMALTRFKGSIVRKQDIYISKNYLNADELDSLNRFVVVFLKTAELRAKNRQEITMDFWRENIDRIIEFNDKKVLQGHGSVSHPKMVKVADAVYETFDANRKVIEAKQADVDDMEELKQIE. 303
132 6.000e-33UniRef50_X6P7R9 Uncharacterized protein n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6P7R9_RETFI  ali  31  533..FGKDCFRELLERVRSIRASERRIWQQITDIFECSFDYDRNSSVTKDFYAMVQNKFHFAISGQTAAEIIYLNADRNKDHMGLTTWPDERILKSDVTIAENYLAEKDIKQ-------------DLIERENSFTMEEFSKSVNEFLAFRKYKILTDKGKINKQQADNKAEKEYKAFNQTQKIT------SDFDKAMKSIEK 715
133 6.000e-33UniRef50_A0A1V6IUD7 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin018 TaxID=1852925 RepID=A0A1V6IUD7_9BACT  ali  39  3TGRNMTYFDELQARIREIRLSERVFYQKIKDIYTTSIDYDPSAEETLRFFKVVQNKLLWAISKQTAAELVARRANAILPFMGMQSYDKKNITQQDAVTAKNYLTETEMKALGLLVEQYLAFAEAQAQQQIAMTMSDWVARLDAILTLNGRELLTHAGSISHALAEEISTKQLAQFRQRLREEERLSSLAELEHDIQA... 202
134 8.000e-33UniRef50_A0A172YB59 Cell filamentation protein Fic n=1 Tax=Halotalea alkalilenta TaxID=376489 RepID=A0A172YB59_9GAMM  ali  43  142..LGEDYFERLLAEIREIRLSERRFYQKITDIY--------------------------AIHGHTAAELIRKRADSSKPHMGLTSWPEGKILKTDVAVAKNYLTKDELDSLGRIVNAYLELAEDRARRKIPMSMEDWSKRLDAFLEFDEREVLQNSGKISAKLAQTHAESEFEKYRIVQDRLFESDFDKAVKKL...... 310
135 1.000e-32UniRef50_D4RWF6 Uncharacterized protein n=7 Tax=Firmicutes TaxID=1239 RepID=D4RWF6_9FIRM  ali  45  142TMFTDGYFDRQLEYIREIRLSERKFYQKVTDLYATAFDYDKDAKTTRRFFKTVQNKMHYATHRHTAAELIVERADAEKEHMGL----------------------------------YLDYAELQAERHIPMSMEDWAKRLDGFLEFNGAEILTGAGKISAEQAKLYAETEFEKYRVIQDRLFMSDYDRYLPELEEKAK. 306
136 2.000e-32UniRef50_A0A0R1GRK2 Uncharacterized protein n=2 Tax=Lactobacillales TaxID=186826 RepID=A0A0R1GRK2_9LACO  ali  37  14..LDKDYFSELLERVRSIRASERRIWQKVTDIFEISSDYDKNSPVTKNFYATVQNKFHYAITGETGAEIIYHHADRNQANMGLTSWPDGRILKSDTQVAKNYLSKKEITALERNVSSYFDYIEDLIERRNTFTMVEFADSIDRFLTFREYKVLSNHGSIAMKTAKEKASTSNMQYSTKHKRSLLIS-IKQLENSL..... 209
137 2.000e-32UniRef50_A0A1Q5VK22 Uncharacterized protein n=2 Tax=Yersiniaceae TaxID=1903411 RepID=A0A1Q5VK22_SERFO  ali  34  132LRESPEKVNELAAKVRAIRSEEKQVYEKVRECFKISSDYDPSSQEVRSFYALLQDKFHHAVTGLTSSKLIQDRADHTSENMGLYSMKGSFPTMAEIKVGKNYLKPDEIYKLHLLSEQFLLYAESTALRGKNMTMGSLHKQLDRLLTLNDYDVLPGYTDYIKDQAIEQARQEFEMYKKRRHIENQGYVYD........... 321
138 4.000e-32UniRef50_A0A1E4U8Z2 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1E4U8Z2_VIBPH  ali  33  121LKSDPKKLSELAAKIRELRANEKNVYASVRECFKIATDYEPSSAEVRRFYSLLQDKFHHAITSMTSSQLILDRADHTDVNMGMQSINGAVPTKNEVTVGKNYLKESEIYRMHLLSEQFLLFAESTSLAGKDMTMSMLHSQLDKLLEINGYEVFEGYSDYIKEHAVEHAQQEYEKFLEIKKLEHLGIDVD........... 310
139 1.000e-31UniRef50_A0A0G0FFX2 Toxin-antitoxin system, toxin component, Fic family n=7 Tax=root TaxID=1 RepID=A0A0G0FFX2_9BACT  ali  41  137...KKRFFEEWLERVRKIRASEKNLYEKVKDIFATSVDYDLRTDFTKEFYATMQNKFHYAITGSTAAELVVSRISGKKENLGMTNWKGVVPTRKEAEVAKNYMLEKELRQLYLLVEQFLSFAEFQIERKNIMRMKDWVLYLHEMLKANKLEVLSNKGKISHDKMEKTVKNELRRFIEQKR.................... 313
140 1.000e-31UniRef50_B3H0D1 Putative DNA-binding protein n=6 Tax=Bacteria TaxID=2 RepID=B3H0D1_ACTP7  ali  41  132...GGNYFKELLERIRDIRSSEKVMYRQVLDLYATAIDYDPKSEESLQFFKIIQNKLHYAAHGHTASEVI-------------------------------YLSEQELKVLNNLVSAYFDFAELNAIEEREMKMKDYVIGLDRILSGAGRKLLENAGEISHQQAQEKAKIEYKKYKAKTLSDVEKDYLDVIQDLNQQVKK 297
141 2.000e-31UniRef50_A0A1F5T938 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F5T938_9BACT  ali  37  1............................MLDLYATSLDYNPKALESIKFFKIVQNKLHYAAHGNTAAEIIARRANAGRPFRGLLSFSNGGVSKKDVAIAKNYLTEKELKVLNNMVSAFFDLAEVKAMDHEPTYMKDWISRLNQLIGVFDKKVLTAAGSVSHAEAMKKAEAEYTKYQTRNLSEVEKAYLDTIKTLQKRVEK 172
142 2.000e-31UniRef50_A0A1J5EV75 Uncharacterized protein n=1 Tax=Candidatus Gracilibacteria bacterium CG2_30_37_12 TaxID=1805211 RepID=A0A1J5EV75_9BACT  ali  38  132TINGKVDFETLLERVRTIRFSEKQIYEKIKDVFRTSTNYNAKSQETQDFFAKIQNKFVYAITGHTTAELIYKRASADKPALGMKGAKKDHITKGEATIGKNYLLEKELKQLYLLCEQFFSFAELQLSLERSLTMKDWINQLDDILRMNKLDILEGAGKVSKVKMEEKIAEEMRKYQEKWGSL---DVYIEAIQEIKKLK. 328
143 3.000e-31UniRef50_A0A1G2YLW8 Cell filamentation protein Fic n=6 Tax=cellular organisms TaxID=131567 RepID=A0A1G2YLW8_9BACT  ali  49  129......YFEELLQRIRDIRSSERNFYQKITDIYATAIDYRKDDKLTQEFFATVQNKIHYAVQGHTAAEIISKRANSMKPMMGLTSFKGSYITADDITIAKNYLTEDELKQLNLIVSMYLDFAELQAGKGRLMKMMDWIVKLDEFLKISERKLLTDAGXXXXXXXXXXXXXXXXXXXXXRD----KNYISDFDMAVKK... 315
144 3.000e-31UniRef50_Q4ZSL8 Uncharacterized protein n=15 Tax=Proteobacteria TaxID=1224 RepID=Q4ZSL8_PSEU2  ali  30  139LRESPEKLNKLAAAVRALRSEEKQVYAKVRECFKICSDYDPNSKEVRSFYALLQDKFHHAVTGMTSSKLILDRADHHLENMGMLAIKGTNPTAEEAKTGKNYLNNEELYRLHLLSEQFMLYAESTALTKRPMTMSSLHEKLDALLIFNDYPVFSGYEDYIKEEALSHARQELGLYKKRLKIESLGYKYDEDA........ 331
145 4.000e-31UniRef50_UPI000B4B2945 DNA-binding protein n=1 Tax=Rhodomicrobium TaxID=1068 RepID=UPI000B4B2945  ali  32  146.....DRIKQLREIIAEIRASDVNLYGELGQICSFCQDYDPKSQTWRDFYARMRAKLYWAVTSQTPSMLMAERANSDAPNMGLQSWAAEDIRQSDALSAASYLSEREFRELNSVTVILLDVFADQAELGRLTTMAAAESLFEKQLKLLGRSILTHGGNVSRAAADDRAKSEYQKFDAKRKAETELDALKELKNQAKDLPK 343
146 5.000e-31UniRef50_A0A1W9LS43 Cell filamentation protein Fic n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9LS43_9DELT  ali  39  132TGNSMNYFNELQERIREIRLSERFFYQKIKDIYTTSIDYNPKDEKTVAFFKIVQNKLLWAISRQTAAELVYRRIDASLPLLGMQSYDKKQIRKSDISIAKNYLNEDEMKLLGLLAEQYLAFAETMAQQHTPMYMKDWIQRLDAIIHLNGKELLSHAGKISHEMAXXXXXXXXXXXXXXXXXXXXXESLKELEKDITDLIK 334
147 7.000e-31UniRef50_M4V8V3 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=M4V8V3_9PROT  ali  47  137...GWDYFDELIERIKDIRASEKRFYQKVRDLIKTSTDYDKDAPQTREFFATIQNRLLFAQTGKTAAELIIERADGSKPNMGLTTFDGEVVRKKDIDIAKNYLTEEEVKELNSLVNMFLDFADDRARQRKAITLAEWVEQTEQFLKFYNRDVLQNAGKKSQHQM.................................... 298
148 9.000e-31UniRef50_UPI0009E82857 DNA-binding protein n=1 Tax=Devosia sp. A16 TaxID=1736675 RepID=UPI0009E82857  ali  41  164...ERDHFRELRELIREIRASEANVYHELKQIISLCSDYAADDTRKNAFFATVQNKLLYAIAGMTAAELRVERASAAKDNMGLTAWKGRQVRKSDIGIAKNYLGDAEIRDLNRFTNMLLDYFEQETDRRRLVLTSDAEAAVDRFIRNNDRHLLRGAGTVSKREADAHCESEYDKFEDMRRRRYLQSDEE........... 350
149 3.000e-30UniRef50_T1CCN6 DNA-binding protein (Fragment) n=13 Tax=root TaxID=1 RepID=T1CCN6_9ZZZZ  ali  49  6.................................QCSIDYDKYAETTQTFFKTVQNKLHWAVAGKTAAELIAERADAEKPAMGLTTWPKGKILKGDVSVAKNYLIENEIKELERIVSMYLDYAENQAARQIPMKMADWVARLDAFLQFNEYEVLANAGKVSAEVAKRLAEEEYDKFRVHQDREFESDFEAEVKRIESKRPR 175
150 5.000e-30UniRef50_UPI0009A92273 hypothetical protein n=1 Tax=Streptococcus suis TaxID=1307 RepID=UPI0009A92273  ali  39  1............................MLDLFATSSDYNARSSEAQQFFATVQNKLHYAIHHHTASELIYTRVDSEKEFMGLTTFKGELPTLSEATVAKNYLTEQELGGLNQLVSGYLDFAERQAQRQIVMTMADWIQHVDRILLATGEDLLTHAGTISREQMMEKVSQEYRKYKAKTLSQVEKDYLAHIKYLEKTAQ. 171
151 5.000e-30UniRef50_A0A2D2M6C8 Uncharacterized protein n=1 Tax=Pseudomonas sp. HLS-6 TaxID=2049589 RepID=A0A2D2M6C8_9PSED  ali  27  138LRESPEKLNQLAAAVRALRSEEKQVYAKVRECFKCSSDYDPGSKQVRSFYALLQDKFHHAVTGMTSSKLILDRADHHAEGMGVQTMRGDFPTLDEAKTGKNYLRSDELYRLHILSEQFMLFAEGTALAKREMTMDSLHKQLDRLLVLNDYPVFSGYEDFIKEEAVNHAKQELGLYKKRKKIEALGYAYDE.......... 328
152 9.000e-30UniRef50_A0A2T9JMR7 DNA-binding protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2T9JMR7_9CAUL  ali  35  172TPEENDRVRELREIVRDIRASEANLYAELRRICAMCQDYVPSSQAATTFYRRTQAKLFYAVTNQTPSETLNERADAAAPNMGLQAWPKDEIRQADALVAKNYLAPAEIRELNRLTDILLGIFEDQLDIGRLLVMDDATRLLDQQLANLNRVVLDHGGNVRHDEAAAAAKAQYKLFDDRRRAARRAETDRDLAEADKTLPK 374
153 1.000e-29UniRef50_A0A099F895 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A099F895_9RHOB  ali  31  125LRESPEKLNKLAAQLRALRSEEKQVYAKVRECFKISSDYEPSSQQVKTFYALLQDKFHHAITGMEGSKLILDRVDHRQPNMGVQTFKGKEPTLAEATTAKNLLDKDELYRLHILSEQFLLYAEATALAGRKMTMGSLHKQLDRLLELNDYPVFEGWKAFIKDAAERHARQELTLYKKRRKLEELKIDYDE.......... 315
154 1.000e-29UniRef50_UPI0009BBAD08 hypothetical protein n=1 Tax=Yersinia intermedia TaxID=631 RepID=UPI0009BBAD08  ali  45  1...............................MLALAADYLPSLQETTRFFQVIQNKLHFACTGKTTAELIHQRADANLPNMGLTSFKGNAVRKGDVIIAKNYLSQSEVDELNRVVNMWLDFAEDQARRRQQIFLRDWEDKLDQFLPFNDRDVLQGAGSISKKKVDEKAQVEYQHFIDQQR.................... 149
155 2.000e-29UniRef50_A0A1X6WM36 Putative DNA-binding protein in cluster with Type I restriction-modification system n=1 Tax=Vagococcus fluvialis bH819 TaxID=1255  ali  49  132.....DYFKKLQKRIRDIRTNERIFYKQVLDIFATSIDYDGSSKAAMEFFATVQNKMIYAVTGHTAPELIFNRIDADKENLGLTVQKGDYPTKTELKVSKNYLDEKELTDLNLIVSAYLDTAERQANQKIKMTMNDWKSELDRYLDFQRVDILQDKGKIS........................................ 286
156 2.000e-29UniRef50_S3LQ35 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=S3LQ35_TREDN  ali  38  2..............................DLFATSIDYNANTEEAKLFFATVQNKMHYAIHNHTAAELIYGRVDSEKEFMGLTVFKGKLPTLKEAKMAKNYLTEKELKGLNNLVSGYLDFAERQAQKEIPMTMKDWVEHVDKILAAAGENLLTDSGTVSRPQMESKVETEYKKYSMKTFSQVEKDYLNELKRLETLVKK 171
157 2.000e-28UniRef50_Q9I0A9 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=Q9I0A9_PSEAE  ali  39  1........................................MTAQATKRFFATVQNKLHRAIHGQTAAEVVHTRADANKQHMGLTTWTDGKIQKFDVAVAKNYLTEDEMAQLSRLVNAYLDVAESMALRKIPMTMQDWETRLNRFIEATDREVLQDAGRVTAEIARAHAESEFEKYRIVQDRLFE----SDFDRLLKQIE. 158
158 3.000e-28UniRef50_A0A101GSB8 Uncharacterized protein n=1 Tax=Methanoculleus marisnigri TaxID=2198 RepID=A0A101GSB8_9EURY  ali  39  118.................................STSLDYNRNAPTTREFFANVQNKLHFAIHGNTAAELIMARADSRKKHMGLSTWPDGKILKTDVSVAKNYLNATELESLGRIVNAWLDLAEERARRKIPMTMEDWAKRLDRFLEFDERKLLEDRGKATKEMAKEFAESEFEKYRVVQDRLFESDFDRMLKEA...... 281
159 8.000e-28UniRef50_U2Z8R8 Putative DNA-binding protein in cluster with Type I restriction-modification system n=1 Tax=Brevundimonas abyssalis TAR-001 TaxID=139  ali  30  150....PDFFDELLERVRDIRSSEKRMWTRILELASFCVDYDPRDKTQHEFFAEIQNTLHWAVVQKTASELVVERVDHQKERAGVITFKGNLPTVDEAKTAKNLLLEPEIKALNHITSLMLEFFDSQAEQRRATTLGEFQIKLRELIKLDGRPLWGAATSVSHAQAAAHASKEIKAFKQRKRVEAESAGEDQLANSQK.... 344
160 1.000e-27UniRef50_A0A1E3AC31 Uncharacterized protein n=1 Tax=Eisenbergiella tayi TaxID=1432052 RepID=A0A1E3AC31_9FIRM  ali  35  77.............RIFRITASDGKEYDTKRYNLKVSIWNKVDSPRAVQFRK-------WVIHGETAAEVIRNRADSEKEHMGLTTWPDGKIQQFDVIVAKNYLTEKELSAMSRIVSAYLDLAENMALDNIPMTMEDWAKQFEGVLRLSKKEILTNAGKISKDVAKRHALAEFEKYRVKQDRLFESDFDRFLNE....... 254
161 2.000e-27UniRef50_A0A126NWI3 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A126NWI3_9BRAD  ali  28  142LKDAPHNLAKLAADVRALRADEKNIYASVRDCFKVSSDYDAQSPACRSFYARLQDKFHFAVTGKTASQIILDRAKHTEPNMGIQAFEGNRPTIDEAKIGKNYLDGEELYRLHILCEQFLLFVESAALRGRQLTMGQLEQKFDSLMVMSDYPVFQGYKDFLRERAVKHAQAEYARWLVRLKQ................... 323
162 3.000e-27UniRef50_A0A1X7ITR8 Uncharacterized conserved protein n=2 Tax=Fibrobacter TaxID=832 RepID=A0A1X7ITR8_9BACT  ali  41  148TILTEDYFERQLEVIREIRVSERRFYQKVTDIYSTALDYDSSAKITQDFFKKVQNKFL----------------------------------KSDVIIAKNYLEKDELKALELIVSGYLDFAEMQANRHIPMTMEDWAKHLDRILEATQHELLTNAGKISMEVAQAHAITEWEKYRIVQDKLFHSDFDYFLELHEKMAQ. 312
163 3.000e-27UniRef50_A0A1F8JM85 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A1F8JM85_9BACT  ali  50  81.....................................HYNPKSDQAQLFFKKVQNKMLWAATHHTAPEIIAERADPNQPNMGLTSWKGSRVRQQDVTIAKNYLDQPEIEELNEIVVMYLDYAENQAKRRKTVTMVEWEQKLDAFLAFNEKDLLGHGGKVSAQVAEQLALSRYDEFDQKRRQEERQIADADDLTLLEALQ. 242
164 7.000e-27UniRef50_A0A0W8EZN6 Putative dna-binding protein in cluster with type i restriction-modification system n=19 Tax=root TaxID=1 RepID=A0A0W8EZN6_9ZZZZ  ali  64  144..IGADYFDELLERIRDIRASEKRFYQKIRDIYRLAIDYDPRADTTLAFFKTVQNKLHWAITGQTAAELIAERSDARKSNMGLTSWKGAKVRMRDVTVAKNYLNEEEIRNLNRIITMYLDYAE............................................................................. 264
165 3.000e-26UniRef50_W1G3Z6 Putative DNA-binding protein in cluster with Type I restriction-modification system n=21 Tax=Bacteria TaxID=2 RepID=W1G3Z6_ECOLX  ali  62  132....PDYFDEMLERIRDIRASERRVYLRVREIFALAADYQPSLKETTQFFQTIQNKLHFACTGHTAAELIHKRADASKSHMGLTSYKGEEVRKGDVTVAKNYLTQDEVSELNRVVNMWLDFAEDQARRRQQVF................................................................... 260
166 6.000e-26UniRef50_UPI0006900487 hypothetical protein n=1 Tax=Pectobacterium carotovorum TaxID=554 RepID=UPI0006900487  ali  28  153LRDSPQKVNELAAKIRALRSEEIHVYDKVKECFKESSDYDKDSGEVRSFYAKMQDKFHYAITGLVGARLVLDRANHEDDNMGMNTFKGVSPTLAEAKIGKNYLKENELYRMHLLSEQFLLHAESTALQGKKMTMRSLNEHIDKLLVFNEYALLTEYDGYIKDAAIEHATTQYQLFKRKKLIQPESDAMGDFDFLFEK... 358
167 9.000e-26UniRef50_UPI0009EDC7E8 hypothetical protein n=2 Tax=Gluconobacter TaxID=441 RepID=UPI0009EDC7E8  ali  34  138LKHDPNALQELAAKVRGLRSDEQNIYRSVRDVFAFSSDYDSKSPIVRSFYARLQDKFLYAVTGQTAAQVILERANAKSPNMGLTSFSGSKVRKVDINTGKNYLQDDELYLLHILCEQFLLFVESSALRGKKLTMSELDKKFDELLRVQDQKVLTTYDGFFKGRANQHAEREWARWQTERLTK.................. 320
168 1.000e-25UniRef50_A0A0F5J9A2 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0F5J9A2_9BACT  ali  34  108..............IFAHTAEDGKIYQTQHYNLVISVGYRVNSVRATQFRQWCTAVLQFAIHRHTAAELIRERANAEKEHMGLTTWPNGKIVKTDVSIAKNYLKEAELDDMGHLVNAFLDLAESRAKRHIPMTMEDWAKHLDRILSLDDRALLSDNGKVSAEEAKMYAESEFEKYRIVQDRLFESDFDREIK........ 291
169 7.000e-25UniRef50_A0A2T4Z1J5 Uncharacterized protein n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2T4Z1J5_9PROT  ali  32  156LSSDPAALLRLAQEVRALRTSEKAIYEQVREAFKMSADYDGSSEEARLFFARSQDAFHYAASENTAAQIVLARCDAAKPNMGMTTAGNVMPTFADAKVAKNYLTSEELRTMQILGEQWLLYTESMSMRGKPLTMARLLAKLDELIGVHEYPVFPGYSGALAPRRDQHVREQLEIYRKLSRNLPAA............... 341
170 8.000e-25UniRef50_A0A1T4WLE3 Virulence protein RhuM family protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1T4WLE3_9BACT  ali  45  1........................................................MHWATHGHTAAEVIAERADASKPFMGLQTTRPGGIVRKDVGIAKNYLTESELQVLNRIVNLYIEYAELQALERKPMTMRDWIAKLDEFLKASGRPLLEHAGEVSAEDARQKAEREYEHYRKLLDAQPQQIDV-DFEKAAKELKK 144
171 1.000e-24UniRef50_A0A2U2AJU1 Uncharacterized protein n=1 Tax=Ignatzschineria indica TaxID=472583 RepID=A0A2U2AJU1_9GAMM  ali  28  134LENDPEALRSLAEEVRALRSSEKSTYAILRDCFKICSDYDGDSQKARSFFALLQDKFYHAITSMTASKIILDRANAENKDIGLVTFNSEIPTKEEVKVAKNYFENKELKELHLLSEAFLVLAESLISRGVKMTMKGLHKKIDKVLKLHEYDVFGGYEDYTRDEADAHALRERDNYIEILKLQTLELD............. 321
172 1.000e-24UniRef50_UPI000B984F81 hypothetical protein n=1 Tax=Wohlfahrtiimonas chitiniclastica TaxID=400946 RepID=UPI000B984F81  ali  28  131...DPEILKKLAAEVRALRSSEKATYSILRECFKICSDYNEASNEARSFFSLLQDKFYHAIFNMTAANIILDRADAREPNMGLKHFNGDIPTKEEACTAKNYFGSIKLFELNLLSESFLVLAESLVARGIKMTMNDLHRKIDEMLKLHEYSVFGGYENYLKNEANCKARSEHDKYIDILKLQMLDLD............. 315
173 6.000e-24UniRef50_UPI000B77B3BF hypothetical protein n=1 Tax=Desulfovibrio mexicanus TaxID=147047 RepID=UPI000B77B3BF  ali  56  10..LGIDYFDKLLERIRDIRSSEKVFNRKVRDIFALSTDYGDHAQEAPHFFQKMQNKMHWAATGQTAAELIRSRAKAEKPNIGLTAFAGDKVQRKAVTTAKDYLDAEELDTLNRIVSMYLEYAEMQAKRRQVIYH.................................................................. 142
174 7.000e-24UniRef50_A0A1I1M3W0 Virulence protein RhuM family protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1I1M3W0_9SPHI  ali  40  1........................................................MHWAAHGNTAAEVIYKRISADLPHLGLTYFKGETPTLQETQVAKNYLNEEELNVLNRMVTAYLELAELQALNRKPMYMKDWIARLDDFLRMTGNDVLGHAGTISHEQAVKKAEAEYAKYKAKTLSKAEKDFVEFIDQTAKTLE. 146
175 7.000e-24UniRef50_A0A0E1NMY0 Virulence RhuM family protein n=8 Tax=Yersinia TaxID=444888 RepID=A0A0E1NMY0_YERPA  ali  57  78....PDYFGEMLERIRDIRASERRVYLRVREIFALAADYEPSLQETTRFFHVIQNKLHFACTGQTAAELIHQRADANLPNMGLTSFKGNAVRKSDVIIAKNYLSQSEVDDRQ........................................................................................ 185
176 1.000e-23UniRef50_A0A166FFZ0 Uncharacterized protein n=1 Tax=Methanobrevibacter filiformis TaxID=55758 RepID=A0A166FFZ0_9EURY  ali  29  138..IKKDYQSEALKYLKSIRAEASNVQKALNSFLKLARDYNTDNIKVKIFYSTMQNKIYQFVTGQTSSEIIYSRANHKKENMGLTTWKGKKVTKSDVQIGKNYLIELELEYLIKTVNAMIDLIDLYVYRGDDITIDYIVKVFDETLEMIAREKLTGYGKVSSSEAKNHAKYEYVQYKDKLLS................... 317
177 1.000e-23UniRef50_UPI000B4B0275 hydroxyacid dehydrogenase n=1 Tax=Rhodomicrobium TaxID=1068 RepID=UPI000B4B0275  ali  40  145....PDFFDELLAKIRQIRASEKRMWTRVLELASFCSDFHMMKQNDRDFFATIQNAMHWAVTQETAAEVIHSRVDASKPHAGLTHFRGEIPMIDDARIAKNYYQKAEIHTLNLLTSATLEFFESQAEQRRTTTLAQFLEKMRDFIRLDGRPLIRSRGTVTKAAA.................................... 307
178 2.000e-23UniRef50_N0B4Y8 Uncharacterized protein n=1 Tax=Hyphomicrobium denitrificans 1NES1 TaxID=670307 RepID=N0B4Y8_9RHIZ  ali  36  183...DPGLVAELRDIVDEIRASGANAYREVKRLCTLCPDYKGSGEAAEHFFASIENKMLWVATAMTSAELIMSRADVTKPDMGLTYHKRGVPTQKDVTVGTNYLLPDEQKTKYRVIEMILRYFEDQHRQNLTVPMAEMEAKLDEFILFNGWPLLKTLGSVKGEKARDHAKRLLKEYKELK..................... 364
179 2.000e-23UniRef50_A0A098EBP8 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=A0A098EBP8_9ZZZZ  ali  40  1........................................................MHFAVTGKTAAELIAERVNSKKPLVGLTNFSGLHPIQRDIYIAKNYLNENELRMLNRIIDAYLSFAEIQAKNEYAMTMKDWTNKLDEYLTLLGKGVLKNAGKVMAEEAEKKANREYEIYKKEQ----NKKYISDFDREVNNLKK 140
180 3.000e-23UniRef50_C8N9I3 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=C8N9I3_CARH6  ali  47  1............................MREIFTLAADYQPDYKETTQFFKVIQNKLHFACAGHTAAEIIHARADANKPMMGLTHTAGDEVRKKDITVAKNYLNETEISNLNRVVTMWLDFAEDQAKRQKQIFLRDWQEKLEQFLTFNDLEVLQGAGNISKKQVDE.................................. 138
181 4.000e-23UniRef50_A0A1F8UDF5 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWD2_32_19 TaxID=1797679 RepID=A0A1F8UDF5_9FIRM  ali  45  11LKFGKDCFDELVEIIKEIRVSERRAYPKITDIFECSSDYSKDSEEVYIFFKIVQNKLHYVITGKTAAELIYESVDSEKVNMGLTSWPEGKILKYDISIAKNYLEKNEIERLNNLTNLFLDIAETEAKEQQVMTMKDWINVTDDY........................................................ 158
182 5.000e-23UniRef50_R7BFY1 Toxin-antitoxin system toxin component Fic family n=3 Tax=Firmicutes TaxID=1239 RepID=R7BFY1_9FIRM  ali  32  63..........................KKIFEDSELQEDSVIRKIRITAFDRKSYNTNHYSLEMIIAVGFKVERADADKPHMGLSTWPDGKIVKSDVSIAKNYLSEEEMHSLERIVSAYLDLAEDRAERHIPMTMEDWSKRLDLFLMADDREVLQDAGKITAEIAKAKAETEFEKYRVVQDRLFMSDFDKYMLELEENAKK 241
183 5.000e-23UniRef50_R7HH71 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R7HH71_9MOLU  ali  50  134...GGKYFYELLNRIKDIRSSEKVLYRQVLDLYATAIDYNPKAAETIKFFKMVQNKFHYAAHGNTAAEVIYNRADSNKPFMGLTSFKGELPSINDIEIAKNYLTEEELKMLNNLVSGYFDFAEFQAMKHKTMRMK................................................................. 265
184 6.000e-23UniRef50_A0A2D8RHW0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D8RHW0_9GAMM  ali  42  76...............................................................ITAAELVKLRADSSKPNMGLTSWPEGKILKTDVATAKNYLSQDELSSLGRIVNAYLELAEDRAKRRIPMTMEDWAKRLDAFLQFDEREILQDSGNISARLARQHAESEFEKYRIVQDRLFESDFDK........... 204
185 1.000e-22UniRef50_R7JYA6 Toxin-antitoxin system toxin component Fic family n=4 Tax=root TaxID=1 RepID=R7JYA6_9FIRM  ali  48  16.....EYFDHLLEQIREIRLSERRFYQKITDIYATALDYDRTAKTTKQFFAKVQNKMHYAVHGHTAAELIYERADADKPHMGLTTWPEGKIVKSDVSIAKNYLTDKEMCSLERIVSAYLDLAMERCRHQ....................................................................... 142
186 1.000e-22UniRef50_A0A101K064 DNA-binding protein n=46 Tax=root TaxID=1 RepID=A0A101K064_9BRAD  ali  36  172............................LRQICSMCQDYDGSAAVAREFFQRTQAKLVYAVTSHTPAEVVSHRADCEVSDMGLRSWPAENIRKQDVTVSKNYLTEAEIKELNRLTSILLDIFEDQLDIGRLVLMEEARQLLDRQLQNLGRAVLRGGGSVSADQAKVRAEAQYEEFDRRRKLERRREADAELAAEAKRLPK 346
187 3.000e-22UniRef50_UPI0009D750D3 hypothetical protein n=3 Tax=Xanthomonas campestris TaxID=339 RepID=UPI0009D750D3  ali  28  26..........................RAIRTTALPGLQRWASLSQARIEASIVKDNVTTAADGQTAAQPAVEPAKPSKPNIALTGGKASRVRKNDLIFARNALDPEKVAQLNRISLMFFGYAKDRASQRRDLRMDDWRQHVDRFVEFNERPLLKDASTVSHERMQQIAHERYAAFETKRRTAEALAADVEDIKALESL.. 198
188 4.000e-22UniRef50_A0A2L2WS68 Cell filamentation protein Fic (Fragment) n=1 Tax=Prevotella sp. MGM2 TaxID=2033406 RepID=A0A2L2WS68_9BACT  ali  47  10...GNRYFRELLQRIRDIRSSERNFYQQVTYIYATATDYDPRDSMAKMFFATVQNKLHYAVHENTVAEVIYNRVDNEKLFVGMTNFKGSYVTKDDVKIAKNYLSEIELQRLNLLVSGFLDFAEFQALE........................................................................ 134
189 4.000e-22UniRef50_A0A235H556 Uncharacterized protein n=1 Tax=Azospirillum brasilense TaxID=192 RepID=A0A235H556_AZOBR  ali  29  138........DALIAKLRQLRTEDKALYKKILDAIKETSDDYNFPKRLQAFFAAIQNKFHYAVAGKTAAELVCEHADGAKPYAGMVAYTGDPITAADVAIGKNYLGERDFRKLENLYEQLWLTIEARMLNGGKMTIAKWESELQNLLLFNGYQVMTTYSEVTRQHAESVARREVKVYKSRLRLQ.................. 318
190 4.000e-22UniRef50_A0A1T4L6J6 Virulence protein RhuM family protein (Fragment) n=2 Tax=Pilibacter termitis TaxID=263852 RepID=A0A1T4L6J6_9ENTE  ali  37  1.................................................FQIIQNKLHYAITGHTAPEIVFSRANAQQVNMGLTTMKSNYPQKADITVAKNYLLKNELEDLNQMSSAFLDIAERQARRKKQMKMIDWITQVDRYIELTDDILLQDKGKITRKQANEKALEEFMKYKTLNNSTIVKDYLENLSKEIERLE. 152
191 4.000e-22UniRef50_A0A1N6M7R4 Uncharacterized protein n=1 Tax=Vibrio spartinae TaxID=1918945 RepID=A0A1N6M7R4_9VIBR  ali  54  146....PDYFDEMLERIRDIRASERRVYLRVKEIFTMAADYEPSNQETNRFFQIIQNKLHYACTHMTAAELIASRVDASKPDMGLTSYKGDEVSPSPKTICVKTKSK............................................................................................... 246
192 5.000e-22UniRef50_UPI0006D13C46 hypothetical protein n=1 Tax=Methanobrevibacter arboriphilus TaxID=39441 RepID=UPI0006D13C46  ali  27  110..IKEDKKEQALQHLKKLRSESTHVQKVLNELFIHATDYEPSSLKIGEFYGTMQNKLYQAVTDSTAKELVYYRADHTKPHMGLTTWEKKDVTKSDVKIGKNYLTKDELDLLVRIINMMIDVIDIKLRMKKEFTIDYVISVFDHYLKLVSEKEVTGYGVINKIEAENNALSELKKYR........................ 284
193 7.000e-22UniRef50_A0A1V6A2W4 Uncharacterized protein n=1 Tax=bacterium ADurb.Bin157 TaxID=1866935 RepID=A0A1V6A2W4_9BACT  ali  44  73.....................................................HTTQHGAIEGKTAAELIESRSNPDKPNMGLTSWRGSIVRKHDVSIAKNYLNDEEMKDLNEIVTMYLDYAERQARKRRTVTMAEWSDKLDAFLKHNEEDLLTQAGTVKAEVAKKIAEERYEAFDKKRKIAEAKISDVEDLKELEEIEK 219
194 2.000e-21UniRef50_R7IIM1 Uncharacterized protein n=1 Tax=Sutterella sp. CAG:351 TaxID=1262975 RepID=R7IIM1_9BURK  ali  25  129.QLTEKNFEELIRRIREIRASDARFRRTIEDLVSHHLAGPVEKKVAERFFTRARTLLYLASVHETPAGILLTRPDHRKAGMRLRESKDGRIHERDALDPARYLNSEEYTTLCRWIVMFIDYLTLQAERRGRLTTDDFDHCLTAFMTFHECQGLTNETDLDGRNAKAFALKELRLYQKRELAITEVSARPDLDQ....... 325
195 2.000e-21UniRef50_A0A2U1AEB3 Virulence RhuM family protein n=1 Tax=Victivallis vadensis TaxID=172901 RepID=A0A2U1AEB3_9BACT  ali  42  180..LDRDYFEHLLAEIREIRLSERRFYQKITDIYATSMDYDPDSPTTREFFAKIQNKLHYAVHGHTAAELIMERADAAREHMGLVSWPDGKIVKTDVVIVKNYLKKMNWKILDASSTLIWTW............................................................................... 301
196 3.000e-21UniRef50_A0A0R1YVN1 Virulence protein n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A0R1YVN1_9LACO  ali  38  54..LNQDYFDELLERVRSILASERRIWQKITDIFQISSDYDKNSPITRNFYATVQNKFHYAISGHTGSEIIYNKANKDQPHMGLTTWPDGRILKSDAMVAKNYLTEPQIKSLERNVSGYFDYVEDLLERRHNFTMQDFVTSINQY........................................................ 199
197 4.000e-21UniRef50_A0A2M7TGB9 Uncharacterized protein (Fragment) n=1 Tax=candidate division WWE3 bacterium CG_4_10_14_0_2_um_filter_41_14 TaxID=1975072 RepID=A  ali  37  4................................CSTSIDYNTKTNDATEFYATVQNKFHYAVTGETAAEIVVHRIGGAKTNAGMTNWKGDLPKSEDAKTAKSYMLQEELEILYLLVEQFLSFSELQIKLKRPMYMSDWRQYLDDFLNLNKLGILNHKGSVSHKEMEKIVKKEMAHHQK....................... 148
198 5.000e-21UniRef50_A0A1B7JSK5 Putative DNA-binding protein n=1 Tax=Proteus hauseri ATCC 700826 TaxID=1354271 RepID=A0A1B7JSK5_PROHU  ali  48  1..................................MAADYEPSNKETTRFFQSIQNKLHFACTGMTAAELIVSSADASQPNMGLTNYKFDEVRKTNVTVAKNYLRENELKELNRIVNMWLDFAEDQALRHKLVFLQDWDTKLDQFLSFNDREALQGTGGIRKK...................................... 128
199 5.000e-21UniRef50_A0A180EUD4 Virulence protein n=6 Tax=Bacteria TaxID=2 RepID=A0A180EUD4_9BACT  ali  30  1...................................................MIQNKFHFAIVGQTAAGIIYAHADSNKENMGLTTWPDGRILKSDVTIAKNYLPEKDIKHLERAVTEYFDYIEDLIERENTFSMKEFTTSVDEFLAFRKYQILTDKGKLSKQQADSKAEAEYEEFNKNQKI------VSDFDKAIKSLKQ 146
200 1.000e-20UniRef50_UPI000DE2E393 cell filamentation protein Fic n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DE2E393  ali  34  99LNSDPAALLKLAQDVRAIRASEKNLYTQVRETFQCSIDYDKDDPAARRFFADSQNVFHFAAAEQTAAEIVRSRADASKPNMRLVGPGNRAPTAADVTVAKNFCTPTELRKMELIGESWRLYAEGMAMQGKQVSMQRLLDKLSELVGTHEFPFFQ.............................................. 253
201 4.000e-20UniRef50_R5T1B2 Virulence protein n=1 Tax=Clostridium sp. CAG:75 TaxID=1262836 RepID=R5T1B2_9CLOT  ali  38  98TAFGKDYFRELLERVRSIRASERRIQQQITDIFACSIDYDRDSDTAYHFYVTIQNKFHYAITGKTAAEIVYNQADHNSENMGLTTWPDGRILKSDTPIAKKTIWTKNRFVNWNV...................................................................................... 215
202 4.000e-20UniRef50_A0A0B7IK68 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0B7IK68_9FLAO  ali  59  132....PDYFDELLARIRDIRASEKRFYQKVRDLFKLSNDYDKTDKSTQMFFAETQNKLLYAVTHQTAAEIVVSRANAEKPNMGLTSWKGSIVRKGDIFTAKN................................................................................................... 228
203 5.000e-20UniRef50_A0A061YQ58 Uncharacterized protein n=3 Tax=Xanthomonas arboricola pv. pruni TaxID=69929 RepID=A0A061YQ58_9XANT  ali  33  9...............................................................KTVAQPAVEPAEPGKPDMVLTGGKAGRVRKSDVIVVKHYLHAEEITQSNRIAAMFLDDAEDRASQRQDLRMDDWRQYVDRFVAFNERPLLKDAGTVSHERMQQIVHERYAVFDAKRRKAEALAADVEDIKALEPLEK 145
204 6.000e-20UniRef50_T0YGR0 DNA-binding protein (Fragment) n=4 Tax=root TaxID=1 RepID=T0YGR0_9ZZZZ  ali  50  106LKRGPDYFEELLARIRDIRSSERMFWRKVLDIYATSIDYDPSAEASQRFFATVQNKMHWAAHSHTAAEIIKTRADADKPHMGMASWSAGRPR............................................................................................................ 199
205 8.000e-20UniRef50_G5HQF0 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=G5HQF0_9FIRM  ali  56  123...GGNYFDELMARIRDIRSSEKVFWRKVLEIYATSIDYNPKAESSVQFFKQVQNKMHWAAHKHTAAEVIYQRADADKDNMGLTTWSGNHIKR........................................................................................................... 212
206 1.000e-19UniRef50_A0A2N3RYU7 Virulence RhuM family protein n=2 Tax=Fibrobacter TaxID=832 RepID=A0A2N3RYU7_9BACT  ali  40  1.........................................................................................MPKQGDAEIAKNYLSKTELDTLNRIVSLYLDFAELQAQSHTPMYMKDWIQKLDDFLKLSGKALLNHAGKISADVAKKKADSEYEKFSERQLSPVEKDFLDNFEKMQKKIK. 113
207 2.000e-19UniRef50_A0A2P7NTW1 Uncharacterized protein n=1 Tax=Nitrosomonas sp. APG5 TaxID=2116706 RepID=A0A2P7NTW1_9PROT  ali  28  27.................................................FIPLQNKFHHAITKMTASQLLLDRANAEIENMDLISLKNLIPTKSEAQTGKNYLTEDEIYRMYLLSEQFLLFAESSALMGKHLTMKQLHNQLDILLELNGYPVFVGYRDYIKDEAMKHAESEYKTFIELKKLEMLGLDVN........... 166
208 2.000e-19UniRef50_A0A1C6JNY5 DNA-damage-inducible protein D n=1 Tax=uncultured Bacteroides sp. TaxID=162156 RepID=A0A1C6JNY5_9BACE  ali  48  264..FGKDYFDELLIRIREIRTSERRYYQKITDIYECSADYDPKSTDTKNFYRIVQNTMHWAITHKTAAEIIYERADAEKPNMGLMTWKHAP.............................................................................................................. 352
209 3.000e-19UniRef50_B8GIK5 Uncharacterized protein n=7 Tax=cellular organisms TaxID=131567 RepID=B8GIK5_METPE  ali  49  137LKEARDYFDELLKRIRDIRASERRFYQKIADISATSVDYDPKDPMTLEFFRTVQNRMHRTIHGHTPAETISLRADARKPHMGLSTWPKGRIHRTEVGVAKNTL................................................................................................. 242
210 4.000e-19UniRef50_A0A1H9JZH2 Uncharacterized conserved protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1H9JZH2_9SPIO  ali  53  131...GGEYWKELLARIRDIRSSEKVMYRQVLDLYATSADYDPKSKESVTFFKMVQNKLHYAINRQTAAEIIYERADSNKEFMGLTSFKGADITLEDVRIAKNYLSEKE............................................................................................. 234
211 5.000e-19UniRef50_UPI0009D97CAF hypothetical protein n=2 Tax=Neisseria TaxID=482 RepID=UPI0009D97CAF  ali  57  67........DELLERIRDIRASEKRVYLRVREIFALAADYQPSFKENTQFFKTIQNKLHFAATGYTAVELVYRRADASKPLMGLTHITDGVVRKKTLKQPKTI.................................................................................................. 160
212 6.000e-19UniRef50_A0A1V6I0T1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin028 TaxID=1852798 RepID=A0A1V6I0T1_9BACT  ali  41  22TLFGKDYFRELLERVRSIRASERRIWQQITDIFECSIDYDRNSPTTRTFYAMVQNKFHYAITGQTAAEIIYNKADRNKEHMGLTTWPDGRILKSDVTIAKNYLPEKDTQTKQLLKEQLEKLENLQ........................................................................... 150
213 7.000e-19UniRef50_F7K500 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=F7K500_9FIRM  ali  34  1................................................................................MGLKSFSGDFPVLKDIGVAKNYLDDKELKVLNNIVSGYFDFAEVQAMRHNPMYMADYVEHLDRVLRSTGEEVLQGAGKISHAQAIEKATREYKKFQVQNLSPIEKEYLESIGNMYNAVKK 120
214 9.000e-19UniRef50_B0PBY9 Transposase n=7 Tax=Bacteria TaxID=2 RepID=B0PBY9_9FIRM  ali  30  27..FGRDYFNELPERIREIRASGRWAYQKIADVFQCSYDYDKNRETTKAFYAFVQNKLRFAFTGKTAAGLISERAALDSPTMDLDAIVVNAAHMKALPGLKTDMKDAEWADLLRHGLLKASYIPSRGQREIREITRYRKSLTEEWCRESNRKILEGA............................................ 184
215 3.000e-18UniRef50_A0A2X0WJ16 Virulence protein n=1 Tax=Anaerobiospirillum thomasii TaxID=179995 RepID=A0A2X0WJ16_9GAMM  ali  32  144..LSKDYFADMLERISDIRESSRTFYQKLTDIYQCSVDYSKNAAITLSFYKRVSCRLYWAITQHLH--NISVQADAIQPDFKM------------------------TDNLKHLVSMYLDYAQSLASHDIGLTMADWVARIDVLLQFNKEDLLYDPGRVCKAITQALSINDYQLYKTQWAESYQPDYDSFID........ 309
216 3.000e-18UniRef50_A0A2H0E1W9 Uncharacterized protein n=2 Tax=Candidatus Beckwithbacteria TaxID=1752726 RepID=A0A2H0E1W9_9BACT  ali  32  36...........................................QKLMAELFDTTAANVNMHLKNIYKEREIDKTSTIKEFLIVQKEGGRKILQSDVSIAKNYLRKNELKQLNQIVSMYLDYAELQASRGRSMTMHDWRDKLEAFIKFNEREILRDKGKISHEAAQSLAEKEYEIFRIKQD----KNYVSDFDKIVKQLK. 187
217 4.000e-18UniRef50_H1BN01 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=H1BN01_9FIRM  ali  51  11...DGNYWKELLDRIRDIRSSGKVMYRQVLDLHATSVDYNPKSSESIAFFKMVENKLHYAAHGHTAAEVIYERADVSKPFMGLKSISGDFPALKDISIAKNYLNDKE............................................................................................. 115
218 5.000e-18UniRef50_A0A011M196 Uncharacterized protein n=2 Tax=Mannheimia haemolytica TaxID=75985 RepID=A0A011M196_MANHA  ali  36  8....................................................................................KSPYGKILKSDVAVAKNYLTAEELKELGLIVNAFLDLAERRARRKIPMTMEDWAKRLDIFLNADDLPLLANKGKISLESAKLHAESEFEKYRIVQDRLFESDFDKVLKEAL..... 118
219 1.000e-17UniRef50_A0A1V1NSN7 DNA-binding protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1V1NSN7_9DELT  ali  45  77..LGEDYFDHLLEEIREIRLSERRFDQKITDIYATSIDYNKDAPTTKVFFAKVQNKLHFAIHGNTAAELIMQRADSAKINMGLTSWENSPSGKIVATSYNN................................................................................................... 175
220 1.000e-17UniRef50_A0A1F3MV52 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F3MV52_9BACT  ali  58  134.....NYFDELLSRIRDIRSSEKVFYRKVCEIYATSADYDPSQPKTLDFFAIVQNKFHWAVTGQTAAEILLNRADAGKPN........................................................................................................................ 208
221 1.000e-17UniRef50_A0A0Q9YC36 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A0Q9YC36_9COXI  ali  37  10......................................................................................PDGKILKTDVSIAKNYLTSEELESLGKIVNAYLELAEERAKRKIPMTMEDWATRLDKFLEFDDRVVLKDAGKISAKIAKDHAESEFERYRIIQDKLFESDFDRETKALEKQIVK 123
222 3.000e-17UniRef50_N1ZTB3 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=N1ZTB3_9FIRM  ali  32  12..........................................................................SSAAEYLTYVAAVGDSADSMEMPIAKNYLSDKEMSYMERIVSLYLDYAELQAERQILTSMEDWAKRLDGFLEFNGNEILTDAGKISAEQAKLYAETEFEKYRIVQDRLFLSDYDKFLLELEEQAK. 136
223 4.000e-17UniRef50_A0A0G1SRG4 Uncharacterized protein n=1 Tax=Parcubacteria group bacterium GW2011_GWA2_47_26 TaxID=1618844 RepID=A0A0G1SRG4_9BACT  ali  51  55.KVAKTYFKEWEERIRKIRTSEANFYQKVRDVFATSVDYNSKSDYAQKFFAVVQNKFHFAITGLTAAEIVASRVDGAKKNLGLTNWKGEVITREQAEIAKNYLEELE............................................................................................. 160
224 4.000e-17UniRef50_UPI0009B3F902 hypothetical protein n=1 Tax=Burkholderia ubonensis TaxID=101571 RepID=UPI0009B3F902  ali  26  1..........................................................MPYLRHSSAGFRPASASFKMPMICSSVNRFFIAVPLWNGLYTVTVLNAGSRSLNRIVVMWLDFAEDQARRRKEIFLNDWAEKLDAFLMFNDRNVLTDAGHISKNQADAHAEHEYERFAARRRALLEEDAAKALPESEKKKKK 153
225 5.000e-17UniRef50_K2AJB8 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=K2AJB8_9ZZZZ  ali  31  1................................................................................MGLLSFSNNGVSKKDIVIAKNYLTEKELKVLNNMVSAFFDLAEVKVMDHEPTYMKDWIVRLDKLIGVFDKKILTEAGFVSHAEATKKAEAEYKKYQTQILSPVEKSYLDTIK........ 112
226 6.000e-17UniRef50_A0A1H3G3L6 Virulence protein RhuM family protein n=1 Tax=Lachnobacterium bovis DSM 14045 TaxID=1122142 RepID=A0A1H3G3L6_9FIRM  ali  37  1....................................................................MISERASIDSPTMGLTTWPDGKILKSDIIVAKNYLNEKEISRLNRLVTMFIDYAELMAEDEVLMSMKDWLDETDIFLKNNRREVLSGKGTVSHEAAVKKVSKIYEEFRKKQDEEYISEFDREMEK....... 128
227 8.000e-17UniRef50_A0A2N3D5I8 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16 TaxID=2013662 RepID=A0A2N3D5I8_9PROT  ali  24  119........EKAIDELRKLRTSDRVMYRKITDAIATTSEQENRPHRVRSLFAAIKDTFHVAVSGKTARALVIDNVDGTKPLLGMTSYDGDPITERDVKTGMNYLDRNAFARLQNLYEQLFLFAEQHMLRGQQMAMVNWEERLNSLLKANGYESFTLYADYLAPVADKRVREEWKVYKQRIKQLPAA............... 302
228 9.000e-17UniRef50_A0A2I0NWQ2 Cell filamentation protein Fic (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2I0NWQ2_9EURY  ali  41  1..........................................................................DSRNDHMGLTSWPEGKILKTDVVVAKNYLTSQELESLGRIVNAWLDLAEDRARRQIPMTMEDWAKRLDRFLEFDDRKLLEDGGKVPAETAKEFAETEFEKYRIVQDRLFESDFDRMLKE....... 122
229 2.000e-16UniRef50_A0A136MFY6 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A136MFY6_9BACT  ali  31  9...................................................................................KQSPEGKILKSDVSIAKNYLSEQHIKELNRIVSAYLDLAENRAQRQIVMKMTDWIQFLHNFLELSNYPILEDKGKISMLEAKLKAEQEYEVYRKIQD----KNYISDFDREIKKIE. 120
230 2.000e-16UniRef50_V2YKI5 Uncharacterized protein n=11 Tax=root TaxID=1 RepID=V2YKI5_9FIRM  ali  43  1...............................................................................................MTIAKNYLREKEMSYLERIVTLYLDYAELQAERKIPMSMEDWAKRLDGFLEFNGNELLIGPGKISAEQAKLHAETEFEKYRIIQDQLYESDFDRFLA........ 97
231 3.000e-16UniRef50_R5BJN2 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:1060 TaxID=1262734 RepID=R5BJN2_9BACE  ali  32  7...................................................................................KNAPDGRVQRSDSIVAKNYLSEKELSELNSITTSFLDFAESRARRHVITTMEDWKQRLEQFLTMNDYKATESAGTVSQGEAREKAYGEYDKFKVIQDRTFVSDFDK........... 112
232 4.000e-16UniRef50_G2DI25 DNA-binding protein n=2 Tax=Neisseria TaxID=482 RepID=G2DI25_9NEIS  ali  57  4........DELLERIRDIRASEKRVYLRVREIFALAADYQPSFKENTQFFKTIQNKLHFAATGYTAVELVYRRADASKPLMGLTHITDGVVRKKTLKQPKTI.................................................................................................. 97
233 5.000e-16UniRef50_A0A1B1Q348 Type-1 restriction enzyme R protein n=1 Tax=Prosthecochloris sp. CIB 2401 TaxID=1868325 RepID=A0A1B1Q348_9CHLB  ali  20  234.........................................................VNQHLKRIYSDNELTREATIKKYLIVQTEGNRQVKREVDHYSLQAIIAVGFKIENERAVQFRKWANQIVKDYTIQTMADWEKRLGGFLKLWDREILQDAGKVTAEQATAHAETEFEKYRIVQDRLFE----SDFDRLLKQIE. 373
234 5.000e-16UniRef50_A0A258AKY0 Virulence protein n=2 Tax=Bacteria TaxID=2 RepID=A0A258AKY0_9BACT  ali  36  1.................................................................................................MAKNYLTDNEIAQLHRLVYAYLHVAEDMALGQIPMTMQDWETRLNRFIAATDREILQDAGKVTAEIAQAHAESEFEKYRILQDRLFESDFDRAIKQLPEK... 100
235 6.000e-16UniRef50_A0A1J8PN42 Cell filamentation protein Fic (Fragment) n=1 Tax=Bathymodiolus thermophilus thioautotrophic gill symbiont TaxID=2360 RepID=A0A1J  ali  40  1..................................CSIDYDKNSNTTKNFFASVQNKFHYAITGQTAAEIIYTHADKSLPHMGLKTWPNGRVLKSDTKIAKNYLTENEIKNLEQSISSYFDHIEIVIGNCTTMTMQDLADSVNKFLAFNAYKILE.............................................. 123
236 6.000e-16UniRef50_A0A0F9GF99 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0F9GF99_9ZZZZ  ali  42  2..................................................................................LTSFSGERPRKSDASIAKNYLNQQEIDVLNRIVTAYLEFAELQALNHNPMTMADWITKLDDFLKLSDREILDHAGRISHEQAKEKAEAQYEIHRQQQAALPQSVDEEQSLDELRRIEK 121
237 9.000e-16UniRef50_A0A2M7FRU9 Cell filamentation protein Fic (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7FRU9_9BACT  ali  48  141..FGKDYFDEQLARIRNIRSSERRFYQKITDIYQCSADYDPHDQTTKDFFATVQNKLHFAITHNTAAEIIIDRVKINKPNM....................................................................................................................... 220
238 9.000e-16UniRef50_E9CM05 Uncharacterized protein n=1 Tax=Serratia symbiotica str. Tucson TaxID=914128 RepID=E9CM05_9GAMM  ali  43  1................................................................................MGLSSYKGEEVRKSDVTVAKNYLNQDEVRELNRVVNMWLDFSEDQARRRQQVFLRDWQDKLDQFLQFNDREVLQDAGTVSKKTADEKAQAEYVQFAEQQRRLKEAEGEKDIA........ 112
239 1.000e-15UniRef50_A0A1U9UJ36 Uncharacterized protein n=1 Tax=Cupriavidus sp. NH9 TaxID=2036817 RepID=A0A1U9UJ36_9BURK  ali  47  1................................................................................MGLTSWRGGCVRQGDVTVAKNYLQQPEVDALNRIVVMYLDYAESMAERRKVMTMHQWAEKLDAFLDFNERDVLRNAGTVSAQVAERLAVERYAEFNSKRREAARVAADAHDAHALEQLAR 120
240 1.000e-15UniRef50_A0A238VG05 Virulence protein RhuM family protein n=1 Tax=Flavobacterium sp. ov086 TaxID=1761785 RepID=A0A238VG05_9FLAO  ali  33  1...............................................................................MQCFDKKEAKAVLKTDVSISKNYLNEDEIKLLGLLVEQYLAFAETMAQQQTPMYMKDWAERLDSILQLNGRELLTYTGKISHQMALDKSTLEFEKFKESRKTIETEQSLKEIEADIKRLKK 121
241 1.000e-15UniRef50_A0A0G0JJU1 Uncharacterized protein n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0JJU1_9BACT  ali  46  40..YKSRYFEELLERIRDIRSSERMLYQKVTDIYATSINYRKDVKETELFFKTVQNKMHFAVSGKTAAEIIAERADSKKSLMGLTNFIVCKRGYHKKIDADKYD................................................................................................. 140
242 1.000e-15UniRef50_A0A0Q0V9P7 Virulence protein RhuM family protein n=1 Tax=Rhodobacter capsulatus TaxID=1061 RepID=A0A0Q0V9P7_RHOCA  ali  40  146.....DRVRELREIIRDIRASEANLYAELRRICSMCQDYDGSDEASRQFFQHTQAKLVHAVVSMTPSELIHDRADHRLANMGLQDWPKDKIRKQDVTTSKI................................................................................................... 241
243 2.000e-15UniRef50_E8LE92 Uncharacterized protein n=12 Tax=root TaxID=1 RepID=E8LE92_9FIRM  ali  41  138..FGKDYFRELLERVRSIRSSERRIYQQITDIFECSIDYDKEADITKKFYATIQNKFHYAIAGHTAAEIIYYQANHEKEHMGLTTWPDGRILKSDVSYC..................................................................................................... 238
244 2.000e-15UniRef50_A0A1F3C9U6 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F3C9U6_9BACT  ali  33  1............................................................................................MKDVVVAKNYLNENELRSLGQIVSGYLDFAERQAEREQAMTMKDWAEHLDRILTMSGENLLIGAGSISHEKALEKATTEYKKYQQKTFSEVEKNYLESLKVLEKKTKR 108
245 4.000e-15UniRef50_B5CP15 Uncharacterized protein n=2 Tax=Ruminococcus lactaris TaxID=46228 RepID=B5CP15_9FIRM  ali  44  138......................................................GKDYFAVTGKTAAELVYERVNAEKPAMGLTTWPDGKILKRDISVAKNYLNEKELSRLNRLVTMFIDYAELMAEDEVLMSMQDWVEQTNQFLRNNRREVLEGKGKVSHDMVQK.................................. 252
246 5.000e-15UniRef50_A0A1G2IU85 Uncharacterized protein n=1 Tax=Candidatus Staskawiczbacteria bacterium RIFOXYB1_FULL_37_44 TaxID=1802223 RepID=A0A1G2IU85_9BACT  ali  28  60...........................................................ELNQNLVTEEYSATADDGKNYKTKFYSLEAIIAVGYRVNSERGAQFRQWATGILKSYFHKGYAELQAAKGRAMTMKNWTEKLNAFLKFSEYEILTNAGKISYEVAEALALKEYEKYRIVQDKNYISDFDREI......... 191
247 5.000e-15UniRef50_UPI0009FE595F hypothetical protein n=1 Tax=Lamprocystis purpurea TaxID=61598 RepID=UPI0009FE595F  ali  37  23.................................................................................................VRRLYLDEAELAALNNLVEQYLIFAEGQAMRRIPMHMGDWISKLHAFLNINDREILTHAGKISHQMAQQRAEDEYERFHQRRIAEQDRTG-NDFDTLVERLP. 123
248 6.000e-15UniRef50_A0A1F3YMG1 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RBG_16_64_18 TaxID=1797477 RepID=A0A1F3YMG1_9PROT  ali  37  7............................................................................................................AMLLDAVHAYLEFAELQALNRKPMTMRDWIAKLDDLLRMGDRDILTHAGTISHEQALRKAELEFEKFRALQLALP-SPVENDFEAAVKRLPK 97
249 9.000e-15UniRef50_A0A1G7KEF4 Virulence protein RhuM family protein n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7KEF4_9DELT  ali  35  1..................................................................................MTVFSKTQPMKHEIAIAKNYLKGDELARLNRMVSAFFDLAELRAMNHQPMYMKDWVIELDDFAERYGQGVLENAGAVSHESALKIAQAEYEKYRQKTLDEAERDFLISIKTTQKKLE. 120
250 1.000e-14UniRef50_A0A254RXI0 Uncharacterized protein n=1 Tax=Fibrobacter sp. UWB4 TaxID=1964356 RepID=A0A254RXI0_9BACT  ali  22  65.........................................DMILAIGFRVRSKRGTQFRIWANQHKQFLVKGFDIDDERLKNPDDYFDELRKQDIYIAKNYLTHDEIDSLNRLTVLFLDSAELRVKERRDLTLDFWRNNVDALLNFQNKNVLRNAGRISNKQMESHVSEIYDEFALRRKKQDAIDADKADMEELRQIEQ 227
251 1.000e-14UniRef50_A0A1B6BFR9 Putative DNA-binding protein in cluster with type I restriction-modification system n=12 Tax=cellular organisms TaxID=131567 RepI  ali  57  131...GGIYFDELLERIRDIRSSEKVFWRKVLDIYATSVDYDPRMKSSMLFFKTVQNKMHWAAHGQTAAEKIYN................................................................................................................................ 199
252 1.000e-14UniRef50_A0A254M7W9 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A254M7W9_PHOLU  ali  15  27..............................ECRFEQETLWLPQATIANLYRVTPQAITQHIKAIYEEGELEQNATC-KSYLQVQQEGNRQVSRNMLHYSLPVILAVGYRVRSPRGTQFRQWATQTLQEYFLIFLRDWQDKLDQFLQFNDRAVLQGAGKISKKMADEKAQAEYSQFGEQQRRLKEAEGEKDIANLLQ.... 195
253 1.000e-14UniRef50_A0A2X0V0F6 Virulence protein n=1 Tax=Anaerobiospirillum thomasii TaxID=179995 RepID=A0A2X0V0F6_9GAMM  ali  32  1..........MLERISDIRESSRTFYQKLTDIYQCSVDYSKNAAITLSFYKRVSCRLYWAITQHLH--NISVQAYAIQPDFKM------------------------TDNLQHLVSMYLDYAQSLASHDIGLTMADWVARIDVLLQFNKEDLLYDPGRVCKAITQALSINDYQLYKTQWAESYQPDYDSFID........ 158
254 1.000e-14UniRef50_R9JLZ0 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium M18-1 TaxID=1235792 RepID=R9JLZ0_9FIRM  ali  35  1................................................................................MGLTSWAGREIKRSDVEVAKNYLNEKEIDALNKIVTAYLDIAEVHALNQEPMYMKDWLETIDDYLKMTRRDILTTKGNVTHKQALEKAHGEYDKYRKKQLSPVECHFLESIEELQE.... 119
255 2.000e-14UniRef50_A0A1J4Z873 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1J4Z873_9PROT  ali  34  1...................................................................................................................MQHLDMAEMQAMRKMPMTMGDWEQRLNGFLTLWDRKILQDAGKVSAEIARAHAESEFEKYRIVQDRLFE----SDFDRMVKQLEQ 81
256 2.000e-14UniRef50_A1ANH5 Virulence protein-like protein n=2 Tax=Bacteria TaxID=2 RepID=A1ANH5_PELPD  ali  35  1...........................................................................................................MKLLGLLVEQYLAFAETMAQQRIPMHMADWIQRLDAIIQLNGRELLTHAGKISHQMAQEKAALEYDKFRESQRRIQHEESLKELEEDIKKLK. 92
257 2.000e-14UniRef50_A0A1I2QEA0 Virulence protein RhuM family protein n=8 Tax=cellular organisms TaxID=131567 RepID=A0A1I2QEA0_9FIRM  ali  42  142..FAKDYFRELLERVRSIRASERRIWQQITDIFECSIDYTKDSDEAYHFYATIQNRFHYAITNHTAAEIVYQSADHRKEHMRSMIF.................................................................................................................. 226
258 3.000e-14UniRef50_A0A239ZU49 Virulence protein n=1 Tax=Clostridium cochlearium TaxID=1494 RepID=A0A239ZU49_CLOCO  ali  37  137..FGKDYFDELLERIREIRASERRFYQKITDIYECSIDYDKNSQVTKTFYATVQNKLHWAITGHTAEVAKKLAEGEYEKFRIEQDRLYESDFDKEIKSYLKGYK................................................................................................ 239
259 3.000e-14UniRef50_M4R6E6 Conserved virulence protein n=1 Tax=Bibersteinia trehalosi USDA-ARS-USMARC-192 TaxID=1171377 RepID=M4R6E6_BIBTR  ali  29  137.......................................................................................................KHFGQDYFEQLVSAYLDLAENRAKRQILMNMAEWETFLNNFLMLSNYPILQDHGKISAEMAKIKAESEYDKFRVIQDRTFKSDFNRFLEEAEK.... 229
260 6.000e-14UniRef50_J9FV86 DNA-binding protein (Fragment) n=9 Tax=root TaxID=1 RepID=J9FV86_9ZZZZ  ali  49  119TLFTDEYFDRQLENIREIRLSERKFYQKVTDLYATAFDYDKDSKTTRLFFQTVQNKMHYATHRHTAAELIVERADAS........................................................................................................................... 195
261 6.000e-14UniRef50_A0A0F2J8K3 Putative DNA-binding protein in cluster with Type I restriction-modification system n=12 Tax=root TaxID=1 RepID=A0A0F2J8K3_9FIRM  ali  47  140TFLNQEFFDHLLEEIREIRASERKFYQKITDIYATAMDYSVEAITTISFFKTVQNKLHFAIRGKTAAELIVDRAKAEIEHMGLTTWKN................................................................................................................ 227
262 8.000e-14UniRef50_A0A0P7WFX6 Virulence protein RhuM family n=1 Tax=Rhodobacteraceae bacterium HLUCCA12 TaxID=1666916 RepID=A0A0P7WFX6_9RHOB  ali  36  22...........................................................................................RKSDVGTAKNYLGEAEIRELNLIVETFLNTAELRATRRQTMRLAEWEGVLDNFLTSNELPKLQGAGSISAEAAKRIAHDRYDAFDTKRKEARQASAEVDDLEELKRI.. 129
263 8.000e-14UniRef50_A2STV6 Virulence protein-like protein n=1 Tax=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) TaxID=410358 RepID=A2STV6_METL  ali  42  7....................................................................LLMLRANADLPHMGLSTWPNGKIRQADVLTAKNYLSSEELTTMNSLVNQFLEYAEQQARSRKVMTMHDWEVKLEAILRLNDMSILANAGRVSMERAKSKASREFEVF......................... 116
264 1.000e-13UniRef50_A0A2A5B5G9 Cell filamentation protein Fic n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5B5G9_9FLAO  ali  41  135TGNSMNYFNELQERIREIRISERFFYQKIKDIYTTSIDYNPKDENTLTFFKIVQNKLLWAISQQTAAELVYRRADANLPLLGIQSYDKDNKKLK.......................................................................................................... 228
265 2.000e-13UniRef50_A0A2A4SUI5 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SUI5_9BACT  ali  51  144..FGKDYFQELLERVRSIRTSERRIYLQITDIFECSLDYDKTTQTAKDFFATVQNKFHFAITGNTAAEIIYKKADAKKDKMGLTSWKNSPKSFY.......................................................................................................... 236
266 2.000e-13UniRef50_R7BL57 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=R7BL57_9FIRM  ali  49  10......................KVFWRKVLEIYATSIDYNPNAEESILFFKQVQNKMHWAAHQHTAAEIVFFRADAEKENMGLTSWEGKHLKKSDSEIAKNYLNDQELDALNKIVSAYLDIAEVRALNHEPM.................................................................... 119
267 2.000e-13UniRef50_A0A2M8L2F6 Cell filamentation protein Fic (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2M8L2F6_9BACT  ali  45  135TRFSTRYFDDLYEEIKDIRSSERMVYQKITDIYATSIDYSPKAFESKQFFATVQNKLHFAITGQTAAEIIYQRVSYKKE......................................................................................................................... 213
268 2.000e-13UniRef50_UPI0009E84BDC hypothetical protein n=1 Tax=Bacillus sp. JCM 19034 TaxID=1481928 RepID=UPI0009E84BDC  ali  43  53.NFGQDYFDELHESIRDIRASEKRFYLKITDIYATAVDYGAKEEIAKEFFATIQNKLHFAIIVQTASEIVVSRVKFIKEKKEERHH.................................................................................................................. 137
269 3.000e-13UniRef50_V2YJH3 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=V2YJH3_9FIRM  ali  44  12..FTDEYFERQLQYIREIRLSERKFYQKVTDLYTTAFDYDKDAKTTRQFFQTVQNKLHYAVHRHTTAELIVERADAAKEHMGLTTWES................................................................................................................ 97
270 3.000e-13UniRef50_A0A2M7C6V7 Cell filamentation protein Fic n=1 Tax=Elusimicrobia bacterium CG03_land_8_20_14_0_80_50_18 TaxID=2014306 RepID=A0A2M7C6V7_9BACT  ali  57  147TNIGSDYFDELLERIRDIRASEKRFYQKIRDIYKLAVDYDPKAEETLEFFSIVQNKLHFAI........................................................................................................................................... 207
271 3.000e-13UniRef50_C5ZY49 Conserved virulence protein n=1 Tax=Helicobacter canadensis MIT 98-5491 TaxID=537970 RepID=C5ZY49_9HELI  ali  36  145.......................................................................................................YFDELLELNRIVGMYLDYAEDRAKKNIAMTMQDWKDKLDSFLEFNEREILKDNGKISKKIADDFAKEEFHKFRVIQDKNYKSDFDKAILKALKD... 238
272 3.000e-13UniRef50_R6HCC7 Toxin-antitoxin system toxin component Fic family n=1 Tax=Clostridium sp. CAG:575 TaxID=1262823 RepID=R6HCC7_9CLOT  ali  41  7...................................................................................KNAPDGKILETDVTIAKNYLLQEEITELNNLVSMYLDYAERQVKLGKIISMKEWKEKLEVFLKINEYNILKDNGKIKKEIADKLALEEYKKYRVIQDQNYISDFD-ELVIETKNLK. 121
273 3.000e-13UniRef50_UPI000A365CBF hypothetical protein n=1 Tax=Streptomyces vinaceus TaxID=1960 RepID=UPI000A365CBF  ali  28  144..................RAREMVDYRLFRDMMAENADYEPSSKTTRLFFATMQNKLYLHVVGMTAEEIKQARTLATWPGID-EGKPEPSARSAARKVAKNYLTELELRKLNRLVGRLCLRAEDIADDDLHLSLVQWQNLIEAELAMATRQL................................................ 277
274 3.000e-13UniRef50_UPI00069998B2 hypothetical protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00069998B2  ali  29  117..................RAREMVDYRLFRDMMAENADYEPSSRATQLFFAATQNKLYLQVVGMTAQEI--------KEARCLATWPGAAEGKPEPKVAKNYLSEPELRKLNRLVGRLCLRAEDIADDGLHLSLVEWRHLVEVELRMLNRQI................................................ 250
275 4.000e-13UniRef50_R5HBZ2 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R5HBZ2_9MOLU  ali  25  7...................................................................................KNSPDGLIYKYDVIIAKNYLNEEEMNNLKDLTNLFLVFAEDEAKQRHVMTMKDWIDATNDLLKFRRKKILDNSGSISHKEAVEKAEKEYEKFRVIQDQKYISSMDEFYNKYL..... 118
276 1.000e-12UniRef50_K2CR20 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2CR20_9ZZZZ  ali  44  1..........MLSRIRDIRSSEKVFWKKVLDIYATSIDYTPNTEMSQQFFKTIQNKMHWAAHGKTAAEIIVQDRPKMKIFCS...................................................................................................................... 72
277 1.000e-12UniRef50_A0A0N0D3D7 Toxin Fic n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A0N0D3D7_9DELT  ali  41  2......................RRFYQKITDIYATSIDYNKDAPTTKVFFAKVQNKLHFAIHGNTAAELIMQRVDSAKVNMGLTSWPNGKIVKSDVSIAKNYLTKGELDSLGRIVNAYLDQYNAKFYRKVKDKI.................................................................. 116
278 1.000e-12UniRef50_A0A261FUF8 DNA-binding protein n=1 Tax=Bifidobacterium lemurum TaxID=1603886 RepID=A0A261FUF8_9BIFI  ali  28  10......................................................................................PAGKIHSSDVTIAKNYLSEDEITHLNQLVSGFLDAAELRVRNHQLTTMTECAELCNQYILFTGGQALEGLGSISKAQADEKALDEFRKFNETQLSDFDK............... 108
279 2.000e-12UniRef50_R7LPH4 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=R7LPH4_9CLOT  ali  43  25...............................................................................................................NRIVTMYLDYAELQAENHNAMTMKDWGEKLNAFLQFNDKEILCNAGKISASVAKELAYKEYDKFKVKQDKLYKSDFDNFLNE....... 106
280 3.000e-12UniRef50_A0A2A4UW98 Uncharacterized protein n=1 Tax=Moraxellaceae bacterium TaxID=1889775 RepID=A0A2A4UW98_9GAMM  ali  41  13...........................IFTHQRALSTDYDPTLDASIQFFKTVQNKVHWAITGKTAAEIIHTRVSSDKDNMGLSNWRGSKVRKQDVANAKNYLSEEELGSLNNLVDLKLAHHRL-MLGKRQALQPDWSVKSRCRL....................................................... 129
281 3.000e-12UniRef50_A0A0G0EMM4 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0G0EMM4_9BACT  ali  35  1..............................................................................KNLGLTNFRGIKPKKEEVVIAKNYYNKEELTQLNALVEQYLIFATEQARRRIPMKMSDWIEKLHGFLTINDRNILQDAGKISHELMAEIAEKKFDEYKQIQDVDFDEVALDAIKNAKKRIK. 124
282 4.000e-12UniRef50_A0A1V5SBQ9 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium ADurb.Bin292 TaxID=1852854 RepID=A0A1V5SBQ9_9BACT  ali  18  58....................................................................................................ELVRETTVSKMEIVRPEGAREVAREAERGIITQMTEWVEFLNHFLELSNYPILNDKGKVSALEAKLKAEAQYEVFRQRQDRE----YISDFDREIRRLE. 152
283 5.000e-12UniRef50_A0A0F2J7N2 Putative DNA-binding protein in cluster with Type I restriction-modification system n=6 Tax=Firmicutes TaxID=1239 RepID=A0A0F2J7N  ali  45  1....................................................................................................................MYLDYAENQAKRRIPMTMEDWANRLNAFLQFNEYELLNNAGKVTAEIAKSFAESEFEKYRIVQDRLFQSDFDK........... 73
284 5.000e-12UniRef50_A0A1V1V1Y5 Uncharacterized protein n=1 Tax=Brevundimonas sp. SH203 TaxID=345167 RepID=A0A1V1V1Y5_9CAUL  ali  35  1......................................................................MARADAAEPDMGLRTWKGDRIAAADVTVAKNFLAPSEVRELNRLTDLLLTIFEDQLETGRLTTMGEATRLLDAQLQGLGRVVLSNGGRVSKEDADRHAKAAYKAFDTQRRTLEKARVDQEYAELRKA... 127
285 5.000e-12UniRef50_A0A1X3DIY5 DNA-binding protein n=4 Tax=Neisseria TaxID=482 RepID=A0A1X3DIY5_9NEIS  ali  36  1...........................................................................................................MSQLNRIVTMWLDFAEDQAQRKKQVLLKDWTEKLDQFLAFNEREVLQGAGKISKKQADAKAEGEYERYMAVQRQIKEQQGEGDIAE....... 86
286 6.000e-12UniRef50_S3BG86 Uncharacterized protein n=1 Tax=Capnocytophaga sp. oral taxon 336 str. F0502 TaxID=1203603 RepID=S3BG86_9FLAO  ali  30  2.....................................................................................WEGNIVRKGDIYIAKNYLTDDEIDSLNRFVMVFLESAELRAKNRQDITMDFWRENIDRIIEFNDKKVLKGNGSVSNEQMKTIVRKVYDEFEVKRKQYDAQQADLEDLKEIEELE. 115
287 7.000e-12UniRef50_A0A174LVJ6 DNA-binding protein n=5 Tax=Bacteroides TaxID=816 RepID=A0A174LVJ6_BACUN  ali  22  13....................................NDGLTKIDVKLEEDTLWLTQAQMCELYQTSKSNVSEHIKHIFEEGELQEDSVVRKFRTTATDGKSYMTTF---YNLDMIIALLDFAERQAEKEQPMTMDDWANYLNRILTSTGEQLLLDGGRVSHQEAMDHATTEYRKYKQRTLSDVEQDYLNAIKA....... 166
288 9.000e-12UniRef50_C9L9W0 Uncharacterized protein n=1 Tax=Blautia hansenii DSM 20583 TaxID=537007 RepID=C9L9W0_BLAHA  ali  39  1........................................................MHFAAHGHTATEVIYERADAEKSFMGLTSFSGELPALKDISIAKNYLSADELKILNNLVSGYFDLAEINAIEHKPMYMNDYVGVSVVILSIIGVIHIDGRNQISM....................................... 105
289 9.000e-12UniRef50_A0A2W7NLA1 Virulence RhuM family protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2W7NLA1_9BURK  ali  51  133...GWDYFDELIQRIRDIRASEKRFYQKIRDIYATAVDYDGTTEQAQRFFAKTQNKMLWAITANVRS..................................................................................................................................... 196
290 1.000e-11UniRef50_A0A1V4SFH0 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1V4SFH0_CLOHU  ali  27  1..............................................................................................................MNLLVSQFLDFAEFQVLEQNPMSMNDWIEALDSQILALKRRVLAGSGSISHKQAITKAEKEFEIYRSREMKQLESDFDRAIKELMKK... 87
291 1.000e-11UniRef50_UPI0009DB8B17 hypothetical protein n=1 Tax=Mycobacterium sp. UM_RHS TaxID=1370118 RepID=UPI0009DB8B17  ali  40  100...GLDYFDELLERIRDIRASEKRFYLKIRDIFATSVDYDSSSADAQTFFATIQNKLIFSVTGHTAAELNERDVLRGAGKVSSEKMKKLAYAEYVKFDARRQEAALEASELEHAKELERIIADAEERKRQ...................................................................... 227
292 1.000e-11UniRef50_K1LCI0 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=K1LCI0_9LACT  ali  31  1.................................................................................................................MVTAYLDFAETMTLRHIPLTMQDWEKRLNSFIEMFEYGILQDAGKVSAEIAKIHAETEFEKYRVIQNQLFVLDFDKYLLELENKRK. 86
293 2.000e-11UniRef50_X1HBH5 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=X1HBH5_9ZZZZ  ali  52  139.RFSTRYFDDLLEEIRDIRSSERMAYQKITDIY--------------------------AITGQTAAEIIATRAKSDKPTMGLTSWRKGKIMPGDVAIAKNYLDKPELDHLNRIVTMYFDYAELQ........................................................................... 239
294 2.000e-11UniRef50_W2CLC7 Uncharacterized protein n=14 Tax=cellular organisms TaxID=131567 RepID=W2CLC7_9BACT  ali  37  136TIFGKDYFKELLERVRSIRTSERRIWQQITDIYECSTDYDRTSPETKEFYTMIQNRFHYAITDIQQKSCITKRITTSKT......................................................................................................................... 216
295 2.000e-11UniRef50_A0A0F2SI59 Uncharacterized protein n=5 Tax=cellular organisms TaxID=131567 RepID=A0A0F2SI59_9FIRM  ali  44  17................................................................................................................LFVTMYLDYAESQAERNIPMTMEDWAKKLNAFLQFNEKDILENAGNVTAAIAKEFAESEFEKYRIIQDRLFQSDFDR........... 93
296 2.000e-11UniRef50_UPI000DDB9F8A hypothetical protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DDB9F8A  ali  43  99LNSDPAALLKLAQDVRAIRASEKNLYTQVRETFQCSIDYDKDDPAARRFFADSQNVFHFAASEQTAAEIVRSRADASKPNMGL..................................................................................................................... 182
297 3.000e-11UniRef50_A0A1M6J9F3 Virulence protein RhuM family protein n=1 Tax=Tessaracoccus bendigoensis DSM 12906 TaxID=1123357 RepID=A0A1M6J9F3_9ACTN  ali  43  1............................MLDLYATIIDYNPQAEETVEFFKIVQNKLHYAAHGHTAAEVIASRA-AAQPNMGLTAFAGTRPVKAEVSVAKNYLDELELKKLNTLVSAYFDAAEFRRRITSPTCGADHRHR............................................................ 111
298 3.000e-11UniRef50_W1XW31 Uncharacterized protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=W1XW31_9ZZZZ  ali  31  1.......................................................................................................TEKELRGLNQLVSGYLDFAERQAEREEVMTMADWVAHVDRILQATGEDLLDNSGSISREQMNQKVDKEYKSYQAKTLSQVEKDYLKEIK........ 89
299 4.000e-11UniRef50_A0A1W9MML3 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1W9MML3_9EURY  ali  24  19................................................................................VNFKNSPKGRILKSDTVIAKNYLEEVEIKKLERTVSSYFDYIERMIEARTTFTMKKLIESINEFLKFNKFDILDGQGKVSHKKAEQTAFAEYDEFNKTQKI------DSDFEKQIKKLK. 131
300 8.000e-11UniRef50_A0A017H4W9 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A017H4W9_9FUSO  ali  29  1...........................................................................................................MKSLNALVSGYLDFAERQAQKEVTMTMRDWVEHVDNILTATGEELLKDHGKISRKQMIDKVTDEYKKYSQKTLTQVEKDYLDEIKRLEK.... 89
301 8.000e-11UniRef50_A0A1I6XSU0 Virulence protein RhuM family protein n=2 Tax=Rhizobiales TaxID=356 RepID=A0A1I6XSU0_9RHIZ  ali  34  1................................................................................MGLQTWPNDKIRKQDVAISKNYLAEAEIRELNRLTMILLDIFEDQLDLGRLVVMQDAQNLLERQLEQLGRSVLRHGGSVKAMDAKRAAEKQYEKFRKLQRQKEAEQLISSLASEVKKLPK 123
302 9.000e-11UniRef50_UPI00035EC93C hypothetical protein n=1 Tax=Actinomadura flavalba TaxID=1120938 RepID=UPI00035EC93C  ali  23  208..................RAREMVDYKVFRDMMAENADYAPSNRETGIFFGMMQNQIYRHLTGMDANQIKQARPIYHWPGRENGKDEPGPNSKH-RKVAKNYLTLPELNKLERIVGRLCLRAQDIAEDGARLNMSQWLALVDAELELLARPL................................................ 341
303 1.000e-10UniRef50_W1JCC9 Uncharacterized protein n=1 Tax=Xenorhabdus cabanillasii JM26 TaxID=1427517 RepID=W1JCC9_9GAMM  ali  26  1................................................................................MGLYFISGTFPTKNEIEVGKNYLKPDELYRLHLLSEQFLLYAESTALQGKAMTMHSLHAQLDRLLTLNDYDVFPGYQDYLKDTALDHARQEFERYKKKKIIEDAGYTYDE.......... 110
304 1.000e-10UniRef50_R5HCJ4 Toxin-antitoxin system toxin component Fic family n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R5HCJ4_9MOLU  ali  33  28...............................................................................................LKENKNYLEEKEIKNLNNLVNLFLDIAESNAERNLPMSMKDWKNEVETSLKLFHYEVLEDKGKISAEKAKQKAESEYEKYKIIQDKKFVSDFDKLLIETEK.... 128
305 1.000e-10UniRef50_A0A2P5K5K6 Uncharacterized protein n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K5K6_9EURY  ali  41  1....................................................................................................................MYLDYAELQAVRNKPMYMKNWIEKLNAFLKFSEYEILTNAGQISHEVALALASKEYETFKKIQD----ENYISDFDKEVWRIK. 79
306 1.000e-10UniRef50_D6DLC7 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=D6DLC7_CLOSC  ali  22  7...................................................................................KNAPDGRILKSDVVVAKIYLEEKQIRQLERAVTGYFDYIEDLIERENTFTMEEFAANVNEFLAFRRYDILRDKGKISGKKAKEKAIAEYAEFNKTQKIT------SDFGRVVKKM.. 115
307 2.000e-10UniRef50_A0A098E7J0 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=A0A098E7J0_9ZZZZ  ali  39  1.............................................................................................................MLNRIMDAYLSFAEIQAKNEHAMTMKDWTNKLDEYLTLLGKGVLKNAGKVMAEEAEKKANLEYEIYKKEQ----NKKYISDFDREVNNLKK 87
308 2.000e-10UniRef50_A0A2G6GKE4 Cell filamentation protein Fic (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6GKE4_9CHLR  ali  44  2...............................................................................................................................RRIPMKMTDWVEKLDAFLRFNEYDVLTNTGKVSHEVAKKLAHERYKRFRVIQDQI----FVSDFEHEVKRLSK 70
309 2.000e-10UniRef50_A0A0B4E3Z3 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0B4E3Z3_9FUSO  ali  55  47...GGNYFKELLDRIRDIRSSEKVFYRQILDLFSTSIDYDSKSEEARNFFATVQNKMHYAYSK......................................................................................................................................... 106
310 2.000e-10UniRef50_R6PIG4 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium CAG:364 TaxID=1262983 RepID=R6PIG4_9FIRM  ali  36  1........................................................MHFAVHGHTATELIVARAEHTKEDMGLTTWPDGKIKKSDVTIAKNYLSQDKMKQLNRMVTAYLDFAENMTLRHIPLTMQDWEIRLNNFIKLFDYGI-------------------------IQDRLFMSDYDKYLLELEENTKK 122
311 2.000e-10UniRef50_A0A2X4PEX9 Virulence protein n=1 Tax=Porphyromonas crevioricanis TaxID=393921 RepID=A0A2X4PEX9_9PORP  ali  35  1...........................................................................................................MRQLKLIVEQFLAYAEMQAIAEKPMYMRDWVQKLRLILTMNEKNILEHAGKISHKLAVSKATKEYEAYKIRQREIEHFNDIKQLDQDIKQIQ. 92
312 3.000e-10UniRef50_A0A0W8E2B0 Putative dna-binding protein in cluster with type i restriction-modification system n=2 Tax=root TaxID=1 RepID=A0A0W8E2B0_9ZZZZ :  ali  67  17.KFGADYFDELLERIRDIRASEKRFYQKVKDIYALSIDYDPQVEMSREFFASVQNKLHY............................................................................................................................................. 74
313 4.000e-10UniRef50_A0A1W1HB95 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1W1HB95_9DELT  ali  53  15......YFEELLQRIRDIRSSERNLYQKVTDIYATSIDYNNDAAITREFFATVQNKMHYAVHGQTAAEMI.................................................................................................................................. 78
314 4.000e-10UniRef50_UPI000A011134 hypothetical protein n=1 Tax=Aminomonas paucivorans TaxID=81412 RepID=UPI000A011134  ali  28  1......................................................................................................MVHFSGSTINTLVSAYFDAAEFRAMNHEPTYMKDWLAHLEQLIAAMGGKALKGAGTVTHRQALEKAEVEYAKYQSQQVSEVETAYMETVKTIQKKI.. 99
315 4.000e-10UniRef50_A0A1C6GB97 Virulence protein n=1 Tax=uncultured Eubacterium sp. TaxID=165185 RepID=A0A1C6GB97_9FIRM  ali  17  7...................................................................................TDEYGEILIYQTDDGQTNIEVKIEDDTVWLTQQQLELYQCSKSNISEHIKHIFEEGQLDSVLSSGNRKLLTGAGSVSHKQALEKAKAEYRKYQEITLTPVEKAYLESIKEVSKEVKR 124
316 4.000e-10UniRef50_A0A0A0X045 Uncharacterized protein n=1 Tax=Treponema sp. OMZ 838 TaxID=1539298 RepID=A0A0A0X045_9SPIO  ali  26  65.................................................................................................................VCRNFRQTTQHGAIEEREMRMADFVRELDNILRTTGRNVLDNAGQISHEQAKKKAIAEYKKYKAKTLSNVEKDYLNSITMLEQTAKK 151
317 7.000e-10UniRef50_A0A1M7TIF3 Virulence protein RhuM family protein n=2 Tax=Desulfitobacterium chlororespirans TaxID=51616 RepID=A0A1M7TIF3_9FIRM  ali  25  40...........................................................................................ETTTANVNIHIKNILDDEELDSNSTIKEFLIVQTEGDEIPMSMADWFWETDNFLQNNRRKVLEGKGKISHEAAIKKAEEIYEQFRVRQDKDYVSQFDIEMSKYLK.... 144
318 8.000e-10UniRef50_W1WF72 Uncharacterized protein n=1 Tax=Veillonella sp. DORA_A_3_16_22 TaxID=1403932 RepID=W1WF72_9FIRM  ali  21  2................................................................................................................RFCQLQAKLXXXXAQREVPMTMADWIKHIDAILSATGEAILQDKGHISHQQMQAKVLSEYQKYQNQTISPVERDYLREI......... 80
319 8.000e-10UniRef50_C4ZAL6 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=C4ZAL6_AGARV  ali  44  67TAFGKDYFRELLERVRSIRASERRIWQQITDIFECSIDYDRDSDTAYHFYATIQNKFHYAITHKV....................................................................................................................................... 132
320 9.000e-10UniRef50_A0A1G1C6A9 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1C6A9_9BACT  ali  27  1.................................................................................................METTADDGKNYHTRDYNLDAYLDLAENRAERGILMQMDDWVGFLNSFLELSNYPILQHKGKVRALAAKLKAEGEFEAYRKRQDAKFA................ 87
321 1.000e-09UniRef50_A0A2T1BVG1 DNA-binding protein n=2 Tax=Corynebacterium diphtheriae TaxID=1717 RepID=A0A2T1BVG1_CORDP  ali  33  18..................RISERQFFRKICDVIAATSADYKSYKEVKNFFAGIQNRLHFATHGNTAAELICLRADHTKPNAGLTNWTGEQPHKGDMSIAKNFLNYAEDQAERKRLS.................................................................................... 118
322 1.000e-09UniRef50_D4C238 Uncharacterized protein n=1 Tax=Providencia rettgeri DSM 1131 TaxID=521000 RepID=D4C238_PRORE  ali  48  4..........................................................................KASQLDMGLTSYKFDEVRKTDVTIAKNYLRENELKELNRIVNMWLDFAEDQALRRKQVFLQDWDTKLDQFLSFNDREVLQCAGGISKK...................................... 91
323 1.000e-09UniRef50_A0A1I7ECK7 Virulence protein RhuM family protein n=2 Tax=Sedimentitalea nanhaiensis TaxID=999627 RepID=A0A1I7ECK7_9RHOB  ali  26  1................................................................................MGVQTFSGKMPTIAEAKTGKNYLQSEELYRLHLLSEQFLLYAEARALAGQKMTMKSLHQQLDRLLTLNDYPVFDGYRDFLKDDAEKHAKQELTLYKKRKKIEAMGIEYDE.......... 110
324 1.000e-09UniRef50_A8SF53 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A8SF53_9FIRM  ali  17  58........................................................TINEHIKKIYADHEQDEAATIRKFRIVQNEGGRQVTRSVNHYNLQMIIAVGFKVNNQRAVRFRVWANQIVEQYTPMTMEDWAKRLDIYLQADDLEVLKDAGKISAQLAKMHAETEFEKYRVVQDRLYQSDFDRYLEENL..... 221
325 1.000e-09UniRef50_A0A1C5QHU3 Virulence protein n=1 Tax=uncultured Eubacterium sp. TaxID=165185 RepID=A0A1C5QHU3_9FIRM  ali  22  1...................................................................................................................................MTMRDWAEHLDRILTMSGEQLLQGNGSISHKQAVDKATGEYKKYKARTLSTVEEDYLNAIKILEKK... 66
326 2.000e-09UniRef50_A0A011NNY3 Virulence protein n=1 Tax=Candidatus Accumulibacter sp. BA-92 TaxID=1454003 RepID=A0A011NNY3_9PROT  ali  28  1...................................................................................................................................MTVEDWAKRLDAFLEFTERDVPRDGGKVSAEMAKTHAESEFEKYRIVQDGLFESDFDKAIKQME..... 64
327 2.000e-09UniRef50_I3DFI1 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=I3DFI1_9PAST  ali  27  1...................................................................................................................................MNMAEWETFLNNFLMLSNYPILHDKGKISAEMARIKAESEYEKFRVIQDRTFKSDFNKFLEK-IAKLKK 68
328 2.000e-09UniRef50_A0A1G3ZLG2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3ZLG2_9BACT  ali  54  134...GGNYFNELLARIRDIRSSEKVFWCKVLDIYATSVDYDPKTESSKQFFRVVQNKMH.............................................................................................................................................. 188
329 2.000e-09UniRef50_A0A1W9SCL5 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4572_119 TaxID=1971636 RepID=A0A1W9SCL5_9BACT  ali  33  1..............................................................................................................................MRRIPMTMQNWIEKLNGFLQLNERNILTHAGKISHELAAANAEDEYEKYNLKRIAERDKT-ESDFDKTVKELE. 72
330 2.000e-09UniRef50_A0A1W1HB32 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1W1HB32_9DELT  ali  35  1....................................................................................................................MYLDFAELQATNGRLMKMQDWIQKLDDFLRISEKELLTNAGKISHKKAVEKAKSEYDKYRKAEDKKYISDFDREMKKLLEDKKK 84
331 2.000e-09UniRef50_UPI00057203A8 hypothetical protein n=1 Tax=Veillonella sp. ACP1 TaxID=936588 RepID=UPI00057203A8  ali  30  1................................................................................MALTSWSGEIVRKNDIYIAKNYLLEAELSILNRLVTAFLEIAELRVSLKKTLTLDFWKNSIDKLLSDNELSILVNNGSISNEVMREKVSLIYAEFDKKRIEYNKAIADEED......... 111
332 2.000e-09UniRef50_K1S4P0 DNA-binding protein (Fragment) n=2 Tax=root TaxID=1 RepID=K1S4P0_9ZZZZ  ali  46  1....................................................................MIYNRVDNEKPFVGMTNFKGNYVTKDDVKIAKNYLTAIELQRLNLLVSGFLDFAEFQALEMNPM.................................................................... 64
333 3.000e-09UniRef50_K1S9F9 DNA-binding protein (Fragment) n=5 Tax=root TaxID=1 RepID=K1S9F9_9ZZZZ  ali  34  45...GNRYFRELLQRIRDIRSSERNFYQQVTDIYATATDYDPRDEMTKMFLPPYKTNCIMQFMRI........................................................................................................................................ 105
334 3.000e-09UniRef50_A0A212JBZ0 Uncharacterized protein n=1 Tax=uncultured Clostridiales bacterium TaxID=172733 RepID=A0A212JBZ0_9FIRM  ali  31  1..............................................................................................................MLNHIISAFDLAEWHAMNHGHMYKQDWLPQVDDFAKPYGKGVLQNAGTVSRQAAIEKATEKYRKYCKQVASTAEQDYLDNLKQTQKKLQ. 92
335 3.000e-09UniRef50_A0A1G5X267 Virulence protein RhuM family protein n=1 Tax=Methanobrevibacter millerae TaxID=230361 RepID=A0A1G5X267_9EURY  ali  31  9......................................................................................PHGKILQADVVISKNYLNEMELDSLNTLVDGFLTLAETRANSQKPRFMKDRKSLLNGYLELSQLPLLEGKGKVSSIEAKTHA................................ 90
336 3.000e-09UniRef50_I3IQJ5 Uncharacterized protein n=1 Tax=Candidatus Jettenia caeni TaxID=247490 RepID=I3IQJ5_9BACT  ali  44  1....................................................................................................................MYLDYAEDQARRHRQVFMRDWRKKLDAFLKFHERDILEHAGTVTKEVADALALEHYEVFNKNRLKSEAEAETLADDEALKMIEQ 84
337 3.000e-09UniRef50_A0A2M7PUD2 Cell filamentation protein Fic (Fragment) n=1 Tax=Bacteroidetes bacterium CG_4_10_14_3_um_filter_42_6 TaxID=1973920 RepID=A0A2M7P  ali  53  2..............................................................................................................LNRIVSMYLDYAENQANKGVVMYMKDWVQKLDAFLQFNVEAVLTHSGTVTHEIALALAEKEY............................ 63
338 3.000e-09UniRef50_UPI0009D6CC65 hypothetical protein n=1 Tax=Bacteroides cellulosilyticus TaxID=246787 RepID=UPI0009D6CC65  ali  47  17...SMNYFRELLDRIREIRLSERLFYQQIKDIYATSIDYDPSDEMPLALYKEVQNKLLWAVSGKTAAE.................................................................................................................................... 81
339 4.000e-09UniRef50_A0A255T098 Uncharacterized protein n=1 Tax=Prevotella sp. P5-92 TaxID=2024222 RepID=A0A255T098_9BACT  ali  37  1.....................................................................................................................................MSDWKELLCKFLSFNDRDILPDAGRVSHDQAEEKAKGEYEKYRLIQDRPTPAD.............. 53
340 5.000e-09UniRef50_UPI000C9C3BA7 hypothetical protein n=1 Tax=Akkermansia muciniphila TaxID=239935 RepID=UPI000C9C3BA7  ali  28  5...........................................................................................EESDTVVAKSYLSDKEVSALNLLSAIAFDLTELRTERQIITTVVNWKKQLDDFL--TSYDILNNAGTIFAKQAQEKAYAEYSRFRLIQDNEYLSDF............. 98
341 5.000e-09UniRef50_UPI0009DA1BAA hypothetical protein n=1 Tax=Pasteurella bettyae TaxID=752 RepID=UPI0009DA1BAA  ali  49  89.QFGLDYFEQLMEKIREILASERRFYEKITELYALSSDYDPKSPLTKQFFATMQNKLHWAIT.......................................................................................................................................... 149
342 6.000e-09UniRef50_UPI000D72AFF9 hypothetical protein n=1 Tax=Acidiferrobacter sp. SPIII_3 TaxID=1281578 RepID=UPI000D72AFF9  ali  34  15....EQYFDEPLRRIQGIGLSERKLDQKIPSIYATAIGYDVTAQAPKDFFVIVRNEIHRAIHGLTAAQGLYPRVGAGQGNRGADC................................................................................................................... 95
343 8.000e-09UniRef50_U2LSE5 Putative DNA-binding protein in cluster with Type I restriction-modification system n=2 Tax=Enterobacterales TaxID=91347 RepID=U2LSE5  ali  35  2......................................................................................................................VGFAEDQARRRQQMFLRDWQEKLDQFLQFNDRDVLQGAGTVSKKAADEKAQAEYFQFAEQQRRLKEAKGEKDIA........ 75
344 1.000e-08UniRef50_UPI0009DE668D hypothetical protein n=1 Tax=Arthrobacter sp. H5 TaxID=1267973 RepID=UPI0009DE668D  ali  41  46...GTDYFDELLERIRSIRASEKRLYQKVRDIFETSADYAITTIGLDDRFIGAPGSTTRSVWAYN....................................................................................................................................... 108
345 1.000e-08UniRef50_R7JZT7 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:277 TaxID=1262790 RepID=R7JZT7_9CLOT  ali  38  8....................................................................................DAPEGKIKNSGVMVAKNYLSQDEMKQLNRMVTAYLDFAESMTLRHIPLTMQDWEKRLNSFIEMFD................................................... 72
346 2.000e-08UniRef50_UPI0009C7DD40 hypothetical protein n=1 Tax=Paenibacillus TaxID=44249 RepID=UPI0009C7DD40  ali  17  20..............................DVKLENGTVWMSQKAVAELYQTTPQNITLHIKNIYQKSELASESTC-KEYLQVQTEGSREIKHKVKHYNLELIVAVGYRVRSHRGTQFRRWAEDQAEHQSPMYMKDWIEKLNLFPKFNEREILTDGGKISQEVA.................................... 156
347 2.000e-08UniRef50_UPI0009F80735 CPBP family intramembrane metalloprotease n=1 Tax=Blautia sp. Marseille-P3201T TaxID=1907659 RepID=UPI0009F80735  ali  37  2.................................................................AAEVIYERADAEKSFMGLTSFSGELPALKDISIAKNYLSADELKILNNLVSGYFDLAEINAIEHKPMYMNDYVGVSVVILSIIGVIHIDGRNQISM....................................... 97
348 2.000e-08UniRef50_A0A1D7Y0D8 Toxin Fic n=1 Tax=Formosa sp. Hel1_33_131 TaxID=1336794 RepID=A0A1D7Y0D8_9FLAO  ali  31  1...................................................................................................................................MYMHDWIVRLDDFLKMTGNKVLDNAGSVSHKKAIDKAHGEYEKFKQKAKSKVEEHFIKQIDATTKQLKK 72
349 2.000e-08UniRef50_A0A2S8SFV4 Virulence RhuM family protein n=1 Tax=Vibrionimonas magnilacihabitans TaxID=669455 RepID=A0A2S8SFV4_9BACT  ali  34  27...................................................................................................................................NDETFWVTRLDAFLQFNEYNILKGAGKVSHDVAMKLAEKEYSKF......................... 70
350 2.000e-08UniRef50_A0A0H3CDL7 Putative DNA-binding protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0H3CDL7_ENTCC  ali  60  144....PDYFDEMLERIRDIRASERRVYLRVREIFALAADYQPSLKETT......................................................................................................................................................... 186
351 2.000e-08UniRef50_A0A2X2DSP7 Virulence protein n=1 Tax=Providencia rettgeri TaxID=587 RepID=A0A2X2DSP7_PRORE  ali  56  5...........................................................................ASQLDMGLTSYKFDEVHKTDVTIAKNYLRENELKELNRIVNMWLDFAE............................................................................. 52
352 3.000e-08UniRef50_R7HDA7 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=R7HDA7_9FIRM  ali  25  57.................................................................................................................................EQIREIHLSKRLDLFLMADDREVLQNTGKITAEIAKTKAETEFEKYRVIQDRLFMSDFDKYMLELEKNSKK 127
353 3.000e-08UniRef50_A0A263HDI9 Uncharacterized protein n=1 Tax=Actinobacillus seminis TaxID=722 RepID=A0A263HDI9_9PAST  ali  21  152......................................................................................................................IRLSKRRARWQIPMAMEDWAKRLAIFLNADDLPILDSKGKISFDEAKLYVETEFEKYRVIQDRNFESDFERLLKSQSEN... 230
354 4.000e-08UniRef50_R7JWF6 Toxin-antitoxin system toxin component Fic family n=1 Tax=Clostridium sp. CAG:277 TaxID=1262790 RepID=R7JWF6_9CLOT  ali  40  84......................KHYNLQMIIAVEFKVNNDRTAKTTKQFFAKVQNKMHYAVHGHTAAELIYERADADKPHMGLTTWPEGKIVKSDVSIAKNYLSEKEMRSLERIVS.................................................................................... 180
355 4.000e-08UniRef50_A0A1N7JWR9 Virulence protein RhuM family protein n=1 Tax=Oleibacter marinus TaxID=484498 RepID=A0A1N7JWR9_9GAMM  ali  54  1..................................MAADYEPSNKETTLFFQTIQNKLHYACTNMTAAELIASRVDASKPDMGLTSYKGDEVRKTDVTIAKNYLREGEI............................................................................................ 74
356 4.000e-08UniRef50_UPI00034C0C9E hypothetical protein n=1 Tax=Methylomicrobium buryatense TaxID=95641 RepID=UPI00034C0C9E  ali  68  104..........................................................FAISGKTAAELIADRADASQPNMGLTAWKGAKVRKGDV........................................................................................................ 141
357 5.000e-08UniRef50_UPI0009AC8D2E hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009AC8D2E  ali  32  1....................................................................................................................MWLDFAEDQARRR-QVFLRDWQDKLDQFLQFNDRDVLQGPGKISQKMADDKAQAEYSQFAEQQRRLKEAEGEKDIVELLQ.... 79
358 5.000e-08UniRef50_A0A1I5UUT2 Virulence protein RhuM family protein n=2 Tax=Lachnospiraceae bacterium XBB1006 TaxID=1520827 RepID=A0A1I5UUT2_9FIRM  ali  46  56............................FEQFYATLISYDSTAKETKRFFAAVQNKLHYAVHGQTVAEVIYNRADAEKEHMGLTTWPNSKIHKYDVTVAKNYLTEEELAILSRMVTAYLDYSK............................................................................. 153
359 6.000e-08UniRef50_B3ENZ5 DNA-binding protein n=1 Tax=Chlorobium phaeobacteroides (strain BS1) TaxID=331678 RepID=B3ENZ5_CHLPB  ali  32  61.........................................................................................................QEGELLENSVVKENLTTAADGKSYRQVFMRDWRMKLDAFLQFNEREILGNSGKISKHVADALAMEQYEQFYSHRLQREAEEENLADDRELRAME. 154
360 7.000e-08UniRef50_D4JRJ6 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=D4JRJ6_9FIRM  ali  29  1.....................................................................................................................................MEDWSKRPDLFLMADDREVLQDAGKITAEIAKSKAETEFEKYRVIQDRLFMADYDRYLLELEEKAKK 67
361 7.000e-08UniRef50_UPI0003A6C743 hypothetical protein n=1 Tax=Hungatella hathewayi TaxID=154046 RepID=UPI0003A6C743  ali  23  1.....................................................................................................................................MKDYVDQLDAILLSGNRKLLAGYGKVSHDQAMKKAKAEYRKYKKNTLSQVERADMETIK........ 59
362 7.000e-08UniRef50_D0BLS8 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=D0BLS8_9LACT  ali  50  45...EDNYFKGLLERIYDIRFSEKVFYRQLLDLFAMSVDYNKDSGEAKRFFTTVRNKLHFPIHQ......................................................................................................................................... 104
363 8.000e-08UniRef50_A0A1M6WR41 Virulence protein RhuM family protein n=1 Tax=Fibrobacter sp. UWB12 TaxID=1896203 RepID=A0A1M6WR41_9BACT  ali  22  1...................................................................................................................MLFLDSAELRVKERRDLTLDFWRNNVDALLNFQNKNVLRDAGHISNKQMESHVSEIYDEFALRRKNQEAIDADKADMEELRQIEQ 85
364 8.000e-08UniRef50_H5XG39 ORF6N domain-containing protein n=1 Tax=Saccharomonospora cyanea NA-134 TaxID=882082 RepID=H5XG39_9PSEU  ali  25  149..................RLREKAEYRGLRDLIAESTDYSPSDKATRMAFARAQNLLYRSTIGMDAAQLI-------RSGRPLQNWSGKNPTKTDRGIAKNYLTADELNKMTSRVTLLLAHVNVRFENDTQPSMQQWLELIEEVL....................................................... 270
365 9.000e-08UniRef50_A0A2U3LWW0 Uncharacterized protein n=1 Tax=Desulfosporosinus sp. SbF1 TaxID=2043169 RepID=A0A2U3LWW0_9FIRM  ali  17  24............................................................IWATQKTIAELFDVDRTSISRHLKNIFKTDELDEKVVSAEIAHTTQHGAMEGKTQTKPVKYYNLDAIISIHRVNSHFATSMDEFLKFNRYEILEGHGPISQSAATKKTIGEYKEFNKHQKI------ISDFDREVKKLQ. 157
366 9.000e-08UniRef50_G7LR72 Uncharacterized protein n=2 Tax=Brenneria TaxID=71655 RepID=G7LR72_9GAMM  ali  28  97..LGEDYFERLLAEIREIRLSERRFYQKITDIYATSLDYNKDAPTTKAFFAKAQTNTFQYKHKTHSYGIFLEPELPIK.......................................................................................................................... 172
367 1.000e-07UniRef50_UPI00048B6CE5 hypothetical protein n=1 Tax=Saccharospirillum impatiens TaxID=169438 RepID=UPI00048B6CE5  ali  26  2..........................................................................................................................TRYTKRRKQIFLQDWQAKLDEFLRFNDRNVLSGTGSVSKQAADSKASQEYDTFSETRRNALEQKGAEETIRTLEAITK 79
368 1.000e-07UniRef50_UPI0009F258F6 hypothetical protein n=1 Tax=Robinsoniella peoriensis TaxID=180332 RepID=UPI0009F258F6  ali  23  5.........................................................................................................FQRDRSVISKHIKNVFAERQAEREQAMTMQDWAKHLDNILTMSGEKLLNGNGSISHSQAMKKVEGEYIKYKAHTLT................... 80
369 1.000e-07UniRef50_A0A2M8B4X9 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_63_12 TaxID=1973967 RepID=A0A2M8B4X9_9DELT :_  ali  28  1...................................................................................................................................MYMGDWVKKLDAFLTFDERDILTHAGRISHDMAQAKAEVEYDRFKALTAAEPRP-VDADFEAAVQELQ. 67
370 2.000e-07UniRef50_A0A0J1J6R0 Uncharacterized protein n=1 Tax=Robinsoniella sp. RHS TaxID=1504536 RepID=A0A0J1J6R0_9FIRM  ali  23  40.........................................................................................................FQRDRSVISKHIKNVFAERQAEREQAMTMQDWAKHLDNILTMSGEKLLNGNGSISHSQAMKKVEGEYIKYKAHTLT................... 115
371 2.000e-07UniRef50_K2E6T5 Uncharacterized protein (Fragment) n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2E6T5_9ZZZZ  ali  21  1.....................................................QDKIHYTVTTKIAAELVCERINPATNFGMVAFDKNRKIKEHDLQTGKNYLVEKELLQYENIGEQLLLRIELRILRGGRITMEEWFFEINRLLQENGYPILFDYSKPKHKEANQKAKVIYTKNKQLLKKEEPKKLLDNPAEESEE... 148
372 2.000e-07UniRef50_A0A1Q6LUU7 Uncharacterized protein n=1 Tax=Clostridium sp. 44_14 TaxID=1896984 RepID=A0A1Q6LUU7_9CLOT  ali  40  1............................MIIAVEFKVNNERAAKTTKQFFAKVQNKMHYAVHGHTAAELIYERADADKPHMGLTTWPEGKIVKSDVSIAKNYLSEKEMRSLERIVS.................................................................................... 91
373 3.000e-07UniRef50_UPI0009408EFA hypothetical protein n=1 Tax=Bradyrhizobium erythrophlei TaxID=1437360 RepID=UPI0009408EFA  ali  29  1................................................................................MGLQTFDGNLPTVQEAKVGKNYLEENELFVLHILAEQFLLYVQSKAVRNKPMTMSELGAKLDDLIAVNDYEVWKGYAGDQRRRADQHATEQYARFLVRLRK................... 102
374 3.000e-07UniRef50_A0A149MVS5 Uncharacterized protein n=8 Tax=Bacteroides TaxID=816 RepID=A0A149MVS5_BACFG  ali  39  1........................................................MHWAISRQTAVEIIVSRVDADKPNMALTTWPNGMIRNPDVSIAKNYLNEMEMDDLNRIVSMYLDYAERQAKKRTSDVHERLGEKVGRIFAVQR................................................... 96
375 3.000e-07UniRef50_H2BXT8 Uncharacterized protein n=7 Tax=cellular organisms TaxID=131567 RepID=H2BXT8_9FLAO  ali  25  75..........................................................................................................................................NNVNKFLEFNEYKVLKGLGKKSKMQADKKAFSEYDKFNKTQKIE------SDFDKMIKNLK. 129
376 3.000e-07UniRef50_A0A1Q8DNY6 Uncharacterized protein n=1 Tax=Psychrobacter sp. Rd 27.2 TaxID=1926479 RepID=A0A1Q8DNY6_9GAMM  ali  20  1..............................................................................................................MYLLSEQFLLFAESSALMGKNLTMKDLHEQLNKLLDLNGYPVFNGYTDYIKDHAMRHVETEYNRFRDIKKLHMLGIDVDLVEYEL..... 85
377 3.000e-07UniRef50_A0A0W8E299 Uncharacterized protein n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8E299_9ZZZZ  ali  38  1...................................................................................................................................MYMKDWVDALDSFLKFTGRDILINAGKISKELADKKAVAEYEIYSQHRIKRKDQEALDEIIEL...... 63
378 3.000e-07UniRef50_A0A0W8F108 Dna-binding protein n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8F108_9ZZZZ  ali  48  1.....................................................................................................................................MKDWVQKLDAFLQFNEREILAGSGRVSMEVAKNLALEEYAKFSQRRI.................... 47
379 3.000e-07UniRef50_A0A1C6A7N5 Virulence protein n=1 Tax=uncultured Flavonifractor sp. TaxID=1193534 RepID=A0A1C6A7N5_9FIRM  ali  49  2....................SERRFYQKITDIYATALDYDKSAKTTRLFFAEVQNKLHWAIHRHTATELIMERSNAEKPPMGLTS................................................................................................................... 66
380 3.000e-07UniRef50_J0RLZ6 Uncharacterized protein n=1 Tax=Bartonella elizabethae F9251 = ATCC 49927 TaxID=1094555 RepID=J0RLZ6_BAREL  ali  28  1...................................................................................................................................MTMEDWAQQLDKLLELDKRIILQNAGTITAKIAKEHAKTEFEKYRIIQDKLFESDFDKEVKALKKPRRK 69
381 3.000e-07UniRef50_A0A0F3GLA2 Toxin Fic n=1 Tax=Candidatus Magnetobacterium bavaricum TaxID=29290 RepID=A0A0F3GLA2_9BACT  ali  51  137.RFGKDYFDELIERIREIRASERRFYQKLTDIYKEC.................................................................................................................................................................... 171
382 4.000e-07UniRef50_A0A1J4YMD6 Uncharacterized protein n=2 Tax=unclassified Zetaproteobacteria TaxID=1131280 RepID=A0A1J4YMD6_9PROT  ali  27  5......................................................................................................................FDYIEGIIERRNSFTMEGFAESVNKFLEFNEYKVLDGFGNISRKQAEQKAWSEYEKFNKTQK--MESDFDKQTKAFLKAQKK 84
383 4.000e-07UniRef50_A0A1V8ZYG4 Uncharacterized protein n=1 Tax=Saccharomonospora sp. LRS4.154 TaxID=1962155 RepID=A0A1V8ZYG4_9PSEU  ali  23  151..................RLREKAEYSTLRALIATATDYSPNDDATRMAFARAQNLLYRSTIGMDAAQLIASG------RPLTTHSGKNGPTKADRKIAKNYLTSDELNKMTSRVTLLLAHVNVRFENGTQPSMKQWLALIEEVL....................................................... 272
384 6.000e-07UniRef50_W1G1X9 Putative DNA-binding protein in cluster with Type I restriction-modification system n=1 Tax=Escherichia coli ISC11 TaxID=1432557 RepI  ali  34  1.....................................................................................................................................MRDWQDKLDQFLQFNDREVLQGPGKVSKKMADEKAQAEYSQFAEQQRRLKEAEGEKDIVELLQ.... 63
385 6.000e-07UniRef50_A0A0F9F9U6 Uncharacterized protein (Fragment) n=3 Tax=root TaxID=1 RepID=A0A0F9F9U6_9ZZZZ  ali  56  146....PDYFDEMLERIRDIRASERRVYLRVKEILTMAADYEPSNQETNR........................................................................................................................................................ 189
386 7.000e-07UniRef50_A0A1F9N413 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFOXYB12_FULL_58_9 TaxID=1797899 RepID=A0A1F9N413_9DELT  ali  36  57..FTNEYFDNLLAEIREIRASERKFYQKITDIYATAMDEEIRRTNAAIEKH..................................................................................................................................................... 105
387 7.000e-07UniRef50_K2AUI9 Uncharacterized protein (Fragment) n=4 Tax=root TaxID=1 RepID=K2AUI9_9ZZZZ  ali  34  5...................................................................................................................................MKMQDWIKKLDEFLTISEKKLLHSAGRVSAKQAEKKALKEYDKYRQ----EEDKNYISDFDREVKKL.. 67
388 8.000e-07UniRef50_A0A2U2AIP1 Uncharacterized protein n=1 Tax=Ignatzschineria indica TaxID=472583 RepID=A0A2U2AIP1_9GAMM  ali  41  1....................................................................................................................MWFDFAENQAKHRKQVFLKDWTEKPDQFLEFNKRAVLDGAGTITKK...................................... 46
389 9.000e-07UniRef50_A0A0D2GGN0 Uncharacterized protein n=1 Tax=Dethiosulfatarculus sandiegensis TaxID=1429043 RepID=A0A0D2GGN0_9DELT  ali  40  1..............................................MQFNAHVQDKFHFAITGQTASELIHQRADADKPLMGMQTYKNGRVLLSDTKIGKNYLAEDEIKQLERTVSSFFD................................................................................ 77
390 1.000e-06UniRef50_A0A2H0FRG8 Uncharacterized protein n=1 Tax=Ignavibacteriales bacterium CG18_big_fil_WC_8_21_14_2_50_31_20 TaxID=1974047 RepID=A0A2H0FRG8_9BA  ali  36  1....................................................................................................................MYLDFAELQAMEEIPMKMKDWIERLDEFLKTSRKKILNNFGNTSLEKAINKAKFEYKKYREAEDMKYISDFDREMKKLL..... 79
391 1.000e-06UniRef50_A0A1I6DIJ5 Virulence protein RhuM family protein n=1 Tax=Desulfotomaculum geothermicum TaxID=39060 RepID=A0A1I6DIJ5_9FIRM  ali  31  1......................................................................................................................MTAAEKPARRRKQVFMKDWERKLDEFLAFNERRVLPDAGSVSKKAADNHARQEYDRFTERRREHKEALGEAESIKALEETAR 82
392 1.000e-06UniRef50_A0A1G2NZS8 Uncharacterized protein n=1 Tax=Candidatus Taylorbacteria bacterium RIFCSPLOWO2_12_FULL_43_20 TaxID=1802332 RepID=A0A1G2NZS8_9BAC  ali  35  1.......................MIYQKITDIYATAIDYSPKSYECKKFFSAVQNKLHFAITGKTAAEIITDRASSKKEKMGLISWRRSPLGKIMPSIRRSARNW............................................................................................... 82
393 1.000e-06UniRef50_D6E467 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=D6E467_9FIRM  ali  20  1...................................................................................................................................MYIKDWLETIDDYLKMTRRDILTSSGRISHKQAIEKAHAEYDKYK-NRLDDILSPVEKDFIESIGMLEQ 68
394 1.000e-06UniRef50_UPI00083AFE68 hypothetical protein n=1 Tax=Xanthomonas campestris pv. translucens TaxID=343 RepID=UPI00083AFE68  ali  32  16...............REIRASEAWVDHCIREIFAIAVDYRKGEHATQRVFAIMRINMHYAAICLDTA--------------------------------KNSLDAREIENFNCITVIFFEQAEFRAMRRQGIRLS-WEGSLDKLLGDAGLLLLDNAGGVSSGDATGWAEFQY--FRDQRK.................... 145
395 2.000e-06UniRef50_X0TS69 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0TS69_9ZZZZ  ali  30  1................................................................................................................................RIPMTMQNWLDKLDAFLSLNDREILSHAGKVSHELAKQIAEQTYDQFNQLRIQQSDQE-PGDFEKIIEKV.. 69
396 2.000e-06UniRef50_UPI000D055AE6 hypothetical protein n=1 Tax=Corynebacterium diphtheriae TaxID=1717 RepID=UPI000D055AE6  ali  35  2........................................KSYKEVKNFFAGIQNRLHFATHGNTAAELICLRADHTKPNAGLTNWTGEQPHKGDMSIAKNFLNYAEDQAERKRLS.................................................................................... 77
397 3.000e-06UniRef50_A0A1G3ZMT0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3ZMT0_9BACT  ali  37  138...GIDYFDELLDRIRAIRSSEKRFYQKIKDIYTLSADLNLTMKMLGQFLLKWPRNLLFLNIQNSKSIAEMKR............................................................................................................................... 211
398 3.000e-06UniRef50_A0A0N0D7C1 2-hydroxyacid dehydrogenase (Fragment) n=1 Tax=Candidatus Magnetomorum sp. HK-1 TaxID=1509431 RepID=A0A0N0D7C1_9DELT  ali  27  1..................................................................................................................VVIFLETAELRIKNRIDISIKFWRENVDRILEFNEKPLLKNKGRVSNAAMQEKIREIYQLFDEKRKIYEAKQADNSDLEELKLLE. 85
399 3.000e-06UniRef50_UPI000D541ECC hypothetical protein n=1 Tax=Stenotrophomonas sp. ESTM1D_MKCIP4_1 TaxID=2072414 RepID=UPI000D541ECC  ali  41  137.....DYFKELLHRIRDIRSSEKRFYQTLRDLFKASSSDYAKPSLILPISTPRQNA................................................................................................................................................ 187
400 3.000e-06UniRef50_A0A1H7U828 Virulence protein RhuM family protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1H7U828_9FIRM  ali  52  8....................................................................................NAPDGKILKADVTIAKNYLSEEEMNYLERIVTLYLDYAELQAQRHIPMSMEDWAKWL........................................................... 64
401 3.000e-06UniRef50_A0A1G6AH26 Virulence protein RhuM family protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1G6AH26_9FIRM  ali  43  1................................................................................MGLTSFAGELPALKDIGIAKNYLKADELKTLNNLVSGYFDLAEINSIEHKPMYIS................................................................. 55
402 4.000e-06UniRef50_C0WJY3 Uncharacterized protein n=1 Tax=Corynebacterium accolens ATCC 49725 TaxID=525260 RepID=C0WJY3_9CORY  ali  38  1...............................................................................................MGIAKNFLNESEAKNMRRLTTMFLDYAEDQAEMGKAMLLKDWVEKTDAWLVFNEREVLKGYGK.......................................... 63
403 5.000e-06UniRef50_UPI000B811E97 hypothetical protein n=1 Tax=Rugamonas rubra TaxID=758825 RepID=UPI000B811E97  ali  41  1.....................................................................................................................................MADWRQYVDNFMLFNESPLLKGAGQVSHEAMLRIAHDRYEQFDSRRRAAEA................ 51
404 5.000e-06UniRef50_A0A1G7S970 Virulence protein RhuM family protein n=1 Tax=Bacteroidales bacterium KHT7 TaxID=1855373 RepID=A0A1G7S970_9BACT  ali  25  142..LGEDYFEHLLAEIREIRLSERRFYQKLTDIYTPVRDKITVQTVQVVLSFPHAQATHQACCRRSNTQ.................................................................................................................................... 207
405 5.000e-06UniRef50_A0A1D7TMP8 Uncharacterized protein n=1 Tax=Sulfurospirillum halorespirans DSM 13726 TaxID=1193502 RepID=A0A1D7TMP8_9PROT  ali  27  53...........................................................................................................................................NLDAFLEFDDRAILHDAGKITKKIADEKALSEFEKYRVVQDRLFRSDFDKLLLE....... 106
406 5.000e-06UniRef50_A0A1G3P3H6 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3P3H6_9SPIR  ali  39  1....................................................................................................................MYLDYAQRQARQRKTVTMSQWAEKLDAFLEFNEQELLIHPGKVKAEVAKQIAEERYEEFDEKRRKSEALAADEDDIRQLEQFEK 84
407 5.000e-06UniRef50_A0A0F2Q4K0 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2Q4K0_9CLOT  ali  23  9..............................................................................................................................EKKNSNDYRRLGEQSIVFLQFIEYEILNNAGKVTTEIAKAFAESEFEKYCVIQDRLFESDFDK........... 71
408 6.000e-06UniRef50_K1LQD3 Uncharacterized protein n=16 Tax=Bacteria TaxID=2 RepID=K1LQD3_9LACT  ali  55  137...GGNYWKELLDRIRDIRSSEKVMYRQVLDLYATSVDYDLKNQESIAFFKM.................................................................................................................................................... 185
409 7.000e-06UniRef50_UPI0005D7E9CE hypothetical protein n=2 Tax=Pseudomonadaceae TaxID=135621 RepID=UPI0005D7E9CE  ali  21  56..............................................................................................................................LSREAIPVSFWRQNVDQIIGSNGFPLLTHAGKVSYAQMERATIALYLDYDQRRKQKEARQADAQDEAEPKALE. 128
410 7.000e-06UniRef50_A0A1B6BDT1 Putative DNA-binding protein in cluster with type I restriction-modification system n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1  ali  39  98TVFGKDYFKELLERVRSIRASERRMWQQITDIFAECSTDQKND............................................................................................................................................................. 140
411 7.000e-06UniRef50_A0A1T4KTI9 Virulence protein RhuM family protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1T4KTI9_9SPIO  ali  25  1...................................................................................................................................MHMSDYVEQLDRTIKSVGEEVLEGAGKISHKNAMEKAEGEYRKYQVKTLSSAEKAYIETL-KELKQIE. 67
412 7.000e-06UniRef50_UPI00095189CD hypothetical protein n=1 Tax=Eubacterium sp. 68-3-10 TaxID=1261640 RepID=UPI00095189CD  ali  38  1..................................................................................MITRKGDFPARADISIAKNYLDEDELKILNNLVSGYFDFAEIQAMRHNLMHMSDYVQQLDKVLSSTGEQV................................................ 70
413 1.000e-05UniRef50_D6DI12 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=D6DI12_CLOSC  ali  31  148..FTDEYFERQLQQIREIRLSERKFYQKVTDLYATAFDYDKNAKPPVCFFRRFRTRCTLLFT.......................................................................................................................................... 207
414 1.000e-05UniRef50_A0A1V4YPS8 Uncharacterized protein n=1 Tax=Methanobacterium sp. PtaU1.Bin242 TaxID=1811676 RepID=A0A1V4YPS8_9EURY  ali  36  3......................................NDKDAEITRTFYATVQNKLHWAITGHTAAEIITERSDATKKNMGLITWPSGKILKSDTMVAKLFITKRNFRTKSYREHVFRL................................................................................ 87
415 1.000e-05UniRef50_G4CL24 Fic family toxin-antitoxin system n=5 Tax=Bacteria TaxID=2 RepID=G4CL24_9NEIS  ali  74  139....PDHFDELLERIRDIRASEKRVYLRVREILKL..................................................................................................................................................................... 169
416 1.000e-05UniRef50_U2BRS6 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=U2BRS6_CLOSY  ali  60  2........KELLERIRDIRASEKVFYRQVLEIYATSIDYDPKAEISIQLFKKVQNKIHYAIHR......................................................................................................................................... 56
417 1.000e-05UniRef50_A0A1G3UI07 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3UI07_9HELI  ali  36  5..............................................................................................................................................AFLQFNEKEVLEHKGKISHEVAVALALDEYEKYRVVQDREYLSDFDKQLLELQRK... 59
418 1.000e-05UniRef50_A0A1V4YNS6 Uncharacterized protein n=1 Tax=Methanobacterium sp. PtaU1.Bin242 TaxID=1811676 RepID=A0A1V4YNS6_9EURY  ali  62  48.......LDELLERIREIRASERRFYQKITDIYAQC.................................................................................................................................................................... 76
419 1.000e-05UniRef50_A0A015RVJ9 Virulence RhuM family protein n=6 Tax=Bacteroides fragilis TaxID=817 RepID=A0A015RVJ9_BACFG  ali  53  1................................................................................MALITWKNAPIRNPDVSIAKNYLNEMEMDDLNRIVSMYLDYAERQAK......................................................................... 50
420 2.000e-05UniRef50_A0A1M3KBC3 Uncharacterized protein n=1 Tax=Chloroflexi bacterium 44-23 TaxID=1895927 RepID=A0A1M3KBC3_9CHLR  ali  41  27....................................................................................................................................................DYEPIRNAGQVSAEVAKALALSEYEKYHTARLEREASQSDGDLEQVVRKLK. 77
421 2.000e-05UniRef50_R6WWK0 Uncharacterized protein n=1 Tax=Dorea sp. CAG:317 TaxID=1262873 RepID=R6WWK0_9FIRM  ali  30  48..............................................................................................................MIKFVTMFIDYAELMAEDEVLMSMQDWLEQTNQFLRNNRREVLEGKGNISHDMAMKKLKRSTKYFESNIIRSTFQSLI............ 125
422 2.000e-05UniRef50_A0A127SZY2 Virulence protein RhuM family n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A127SZY2_9BACT  ali  26  3...........................................................................................................................................KLDEFLKLSGSELLTHAGSVSAEVAKLKADTEYNRFKERQLSPVEIHFIEAFESEQKKLR. 65
423 2.000e-05UniRef50_A8U4C7 Putative DNA-binding protein n=1 Tax=alpha proteobacterium BAL199 TaxID=331869 RepID=A8U4C7_9PROT  ali  38  1.....................................................................................................................................MAEWSDKHDAFLSFNERDVLTHAGRRRMNVAQKLPVERFEVFDANRRAAKALAALEEMEKVAKGRKK 74
424 2.000e-05UniRef50_G2FNL2 Uncharacterized protein n=1 Tax=Desulfosporosinus sp. OT TaxID=913865 RepID=G2FNL2_9FIRM  ali  59  8.........................................................................................KIIKSDVSVAKNYLTEKEIKSLDRFVTMYLDYAESQA.......................................................................... 44
425 3.000e-05UniRef50_W2D282 Uncharacterized protein (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=W2D282_9BACT  ali  21  1.........................................................................................................EERRRLERAITVFFDYIEDLIEQENSFTMADFSESVDAFLNFRRYKILQGKEAISSEQAKEKAYAEYQLFNPTQRI------DSDFDKELRKRK. 88
426 3.000e-05UniRef50_A0A1H3VMW6 Virulence protein RhuM family protein n=1 Tax=Arachidicoccus rhizosphaerae TaxID=551991 RepID=A0A1H3VMW6_9BACT  ali  53  11...GGGYWKELPERIRDIRFREKVCYRPVLDIYATSIDYDPKAEVS.......................................................................................................................................................... 53
427 4.000e-05UniRef50_A0A1T4JHK5 Uncharacterized protein n=2 Tax=Treponema porcinum TaxID=261392 RepID=A0A1T4JHK5_9SPIO  ali  20  82.................................................................................................................................................QMFEYGLLQDAGKVTAEIAKLHAETEFEKYRIVQDRLYKSDFDRFIEDE...... 130
428 4.000e-05UniRef50_UPI000A05AD26 hypothetical protein n=1 Tax=Desulfonatronovibrio magnus TaxID=698827 RepID=UPI000A05AD26  ali  22  105.................................................................................................................................................KATQFRILEGYGSVSRKQAEAKAFAEYDKFNKTQRIE------SDFDKAIKQVE. 152
429 4.000e-05UniRef50_J1KGB0 Uncharacterized protein n=1 Tax=Bartonella elizabethae F9251 = ATCC 49927 TaxID=1094555 RepID=J1KGB0_BAREL  ali  51  2.............................................................HGNTAPELIAKRADSNKKHMGLATWPHGKIVKTDVTIAKNYLTQDELKQLGLIVSAYLDLAESRAERKNQ..................................................................... 74
430 5.000e-05UniRef50_G5HEL8 Uncharacterized protein n=8 Tax=root TaxID=1 RepID=G5HEL8_9FIRM  ali  42  102..FTDEYFECQLENIREIRLFERKFYQKVTNLYATAFDYDKDATTTRQFFKMVQNK................................................................................................................................................ 155
431 5.000e-05UniRef50_A0A1F6QCG8 Uncharacterized protein n=1 Tax=Candidatus Margulisbacteria bacterium GWF2_35_9 TaxID=1817873 RepID=A0A1F6QCG8_9BACT  ali  54  1........................................................MLWATTGKTAAELIESRSNPDVPNMGLTSWCGSIVRKQDVGIAKNYLNADEIKDLNEIVTMYLDYAERQV.......................................................................... 70
432 5.000e-05UniRef50_A0A285BC04 Uncharacterized protein n=1 Tax=Klebsiella grimontii TaxID=2058152 RepID=A0A285BC04_9ENTR  ali  37  1..........MLERIRDIRASERRVYLRVREVFTCCARLSAGRRLARPTLSLGLCNTHRAALH......................................................................................................................................... 53
433 5.000e-05UniRef50_UPI0009B5A338 hypothetical protein n=1 Tax=Histophilus somni TaxID=731 RepID=UPI0009B5A338  ali  39  19.........................................................................................PDYQKDVKVAKNYLNEQEIKELNCIVTMWLDFAEDQAVRKKQFYEIGWKSETGNIMNVQCCKVLQNRGKIK........................................ 95
434 5.000e-05UniRef50_R7MFZ6 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:628 TaxID=1262829 RepID=R7MFZ6_9CLOT  ali  44  137.KSDQEYFKRLLERIKLIRTSERMFYQKITDIFTFFL................................................................................................................................................................... 172
435 6.000e-05UniRef50_F0CCN9 Uncharacterized protein n=2 Tax=Xanthomonas TaxID=338 RepID=F0CCN9_9XANT  ali  27  26..........................SAIRTTALPGLQRRGSALQARIGASVVKQAVTTAADGQTAAQPAVEPADPSKPNMALTGGKASRVRKNDLIFGRNALDPDGVAQLSRIAAMFLDYA-DRASQRRDLRMDDWRQ............................................................. 138
436 6.000e-05UniRef50_A0A1V6ERK9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin090 TaxID=1852803 RepID=A0A1V6ERK9_9BACT  ali  15  81....................................................................................................................................................DEKLLSDAGSVSHQQAIEKAKDEFRKYRLKTLSPVEKAYLESIKAVQKKIEK 132
437 7.000e-05UniRef50_A0A149MVY2 Uncharacterized protein n=16 Tax=Bacteroides TaxID=816 RepID=A0A149MVY2_BACFG  ali  46  143..FGKDYFEEQLARIRDIRGNEQRFYQKITDIYS...................................................................................................................................................................... 174
438 7.000e-05UniRef50_N2BG10 Uncharacterized protein n=2 Tax=Helicobacter bilis TaxID=37372 RepID=N2BG10_9HELI  ali  26  1.....................................................................................................................................MKDHIEHLDSILRGAGREVLENAGVISTQRAREKAEIEYRNFQAKTPSPVEKEYLESIKALEITAKK 67
439 8.000e-05UniRef50_A0A1Q8QFE8 Putative DNA-binding protein in cluster with Type I restriction-modification system n=1 Tax=Desulfosporosinus sp. OL TaxID=188889  ali  42  9...........................................................FIIEQTAPKIIWVWQPGNAPY--------GKIVKSDVFVAKNYLKETEIKSLDRFVTMYLDYAESQAERNIPLTMEDW............................................................... 78
440 9.000e-05UniRef50_UPI00046A4AA1 hypothetical protein n=1 Tax=Porphyromonas bennonis TaxID=501496 RepID=UPI00046A4AA1  ali  19  1......................................................................................................................MLSAALTTTKGNTFTMEQFTVSVDKFLSFNDYKILLDRGRISATEAEAKSEAAYDIFNKTQHI------DSDFDKVVRRMLR 76
441 1.000e-04UniRef50_G9YF03 Uncharacterized protein n=1 Tax=Anaeroglobus geminatus F0357 TaxID=861450 RepID=G9YF03_9FIRM  ali  51  17...GDNYWKELLDRIRDIRSSEKVMYRQVFNLYATSADYALKSSES.......................................................................................................................................................... 59
442 1.000e-04UniRef50_A0A2T5I1Q2 Virulence RhuM family protein n=1 Tax=Nitrosomonas oligotropha TaxID=42354 RepID=A0A2T5I1Q2_9PROT  ali  26  1........................................................................................................................................MVKSVDKFLSFNEFEVLTHKGRVSKIQADQKALSEYAEFNRTQKIE------SDFDRVLKAAK. 57
443 1.000e-04UniRef50_A0A1Q8QFF6 Putative DNA-binding protein in cluster with Type I restriction-modification system n=1 Tax=Desulfosporosinus sp. OL TaxID=188889  ali  43  23TFLKEEYFEHLIEEIREIWASERRFYQKITDIYATAVDYNLHSKLTKDFFKTV................................................................................................................................................... 75
444 1.000e-04UniRef50_A0A1V5U774 Uncharacterized protein n=1 Tax=Candidatus Dependentiae bacterium ADurb.Bin246 TaxID=1852839 RepID=A0A1V5U774_9BACT  ali  29  1..............................................................................................................................................MLLYLYGRELLTHAGKISHEMAIAKSGLEYKKFKDEQKKIEKIQSLKELEEDIKRLK. 57
445 1.000e-04UniRef50_A0A2H0SWC6 Uncharacterized protein n=1 Tax=Candidatus Pacebacteria bacterium CG10_big_fil_rev_8_21_14_0_10_42_12 TaxID=1974768 RepID=A0A2H0S  ali  23  29..............................................................................................................................................AFLQINDKDILTDAGKISHALALEIAERNFDEYKKI-EAKEFGDGFDEFAEEATKI.. 83
446 1.000e-04UniRef50_A0A1E3X231 Uncharacterized protein n=1 Tax=Candidatus Scalindua rubra TaxID=1872076 RepID=A0A1E3X231_9BACT  ali  24  1............................................................................................................................................MNEFLKTSGKKLLTDPGKTSHQEAIEKANLEYDKF----RAAEDKKYISDFDREMKRI.. 54
447 1.000e-04UniRef50_K1RX59 Uncharacterized protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1RX59_9ZZZZ  ali  65  1....................................................................................................................MYLDYATRQARRHIPMTMEDWKTKLDAFLRFNDTEVLQ.............................................. 38
448 1.000e-04UniRef50_UPI000A02823A hypothetical protein n=1 Tax=Corynebacterium mastitidis TaxID=161890 RepID=UPI000A02823A  ali  53  1...............................................................................................MATAKNYLTHEELEELNRLVSQFLDFAESQAKRRIVTHM.................................................................. 39
449 2.000e-04UniRef50_A0A1C6CAM9 Uncharacterized protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6CAM9_9CLOT  ali  22  1................................................................................................................................................MTSTGENLLTGNGTVSHLQAMEKAQTEYKKYKAKTLSSVEKDYLE........... 45
450 2.000e-04UniRef50_A0A1W7A808 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1W7A808_9STAP  ali  65  132.NLGSDYFDELLERIRDIRASEKRFYLKITDIYATS.................................................................................................................................................................... 166
451 2.000e-04UniRef50_A0A2H0NLS1 Cell filamentation protein Fic (Fragment) n=1 Tax=Gallionellaceae bacterium CG11_big_fil_rev_8_21_14_0_20_60_62 TaxID=1974012 Rep  ali  26  1.....................................................................................................................................................RDILQDAGRVTAEIAKAHAESEFEKYRIVQDRLFE----SDFDRLVKQVE. 46
452 2.000e-04UniRef50_A0A1F7UT35 Uncharacterized protein n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPLOWO2_01_FULL_47_24 TaxID=1802401 RepID=A0A1F7UT35_9BACT :  ali  55  33.KVAKTYFQEWEERIRKIRTSEANFYQKVRDVFATSVDYNPKADYAQKFF...................................................................................................................................................... 81
453 3.000e-04UniRef50_F2BY09 Uncharacterized protein n=1 Tax=Dialister micraerophilus DSM 19965 TaxID=888062 RepID=F2BY09_9FIRM  ali  45  1........................................................................................................................MAELQAERHIPMTMEDWEKRLNGFLQLWDKEILNDSGKISAALAKKHA................................ 48
454 3.000e-04UniRef50_A0A1D8GLQ8 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1D8GLQ8_9CLOT  ali  30  1..............................................................................................................MNSVVSAYLEFAEMQARRRIPMYMSDWIETLDGFLKLSKHEILTHVGKISAKTVELKAKEEYKALKIEEISKVEKDYIKALEDMEMKL.. 91
455 3.000e-04UniRef50_A0A0W0ZPL1 Uncharacterized protein n=2 Tax=Legionella steigerwaltii TaxID=460 RepID=A0A0W0ZPL1_9GAMM  ali  32  10...........................................................................................................................................KLDDFLKISDRELLTHSGKISHETALKKTHEEYEKFRQNMLNQPTQADL............ 58
456 3.000e-04UniRef50_S3BL67 Uncharacterized protein n=1 Tax=Sutterella wadsworthensis HGA0223 TaxID=1203554 RepID=S3BL67_9BURK  ali  17  5.........................................................................................................................................AEAVIRFLEFNDYPILDGNGKVSKKQAVRKASDEYAIFNLTQK------YITDFDRQIQDTSK 61
457 3.000e-04UniRef50_UPI000C06FED6 hypothetical protein n=1 Tax=Kuenenia stuttgartiensis TaxID=174633 RepID=UPI000C06FED6  ali  43  95.RFSARYFDELYEEIKDIRSSERMLYQKITDFL....................................................................................................................................................................... 126
458 3.000e-04UniRef50_UPI0009FDF77C hypothetical protein n=1 Tax=Paenibacillus fonticola TaxID=379896 RepID=UPI0009FDF77C  ali  42  1...............................MFSTFIDYEPSACLLKEIFVMVQNKLHFYYYGYTTTGLIAERLRADKDNMGL..................................................................................................................... 52
459 3.000e-04UniRef50_UPI000B274B57 hypothetical protein n=1 Tax=Alloscardovia omnicolens TaxID=419015 RepID=UPI000B274B57  ali  37  9..................................IGIDYDANSPITRGFYQAVHNRCHYAATGHTVPKFVFKRAYSFLKNFAFPA................................................................................................................... 63
460 4.000e-04UniRef50_J6HQU0 Uncharacterized protein n=1 Tax=Capnocytophaga sp. CM59 TaxID=936370 RepID=J6HQU0_9FLAO  ali  20  23...........................................................................................................................................................AGRVSHQEAIEKATTEFKKYQVKTLSTVEEDYLRILKSLEKKL.. 65
461 4.000e-04UniRef50_UPI0009E36FF6 hypothetical protein n=1 Tax=Paenibacillus sp. IHBB 10380 TaxID=1566358 RepID=UPI0009E36FF6  ali  40  1............................MTAIHVIAVDYDSKAEITKDFFATVQNKLHNAIHGQIASELIVNRASANQQGDSICCFG................................................................................................................. 59
462 4.000e-04UniRef50_R5T203 Toxin-antitoxin system toxin component Fic family n=1 Tax=Clostridium sp. CAG:762 TaxID=1262837 RepID=R5T203_9CLOT  ali  36  8..........................................................................................................EIKNLNNLVNLFLNIAENNTERSITMYMEDWKNEVENVLKVFRYEVLEGKGKISHKQA.................................... 65
463 5.000e-04UniRef50_A0A1T4L8Z5 Virulence protein RhuM family protein n=2 Tax=Fibrobacter intestinalis TaxID=28122 RepID=A0A1T4L8Z5_9BACT  ali  25  1.....................................................................................................................................MKDWLETIDDYLKMTRREILTAAGRISHEKAIEKAHSEYEKYKAIQLSAVETHFLSNISELEHR... 67
464 5.000e-04UniRef50_W6PMW2 Putative DNA-binding protein in cluster with Type I restriction-modification system n=5 Tax=cellular organisms TaxID=131567 RepID=W6P  ali  48  137..FGKDYFRELLERVRSIRASERRIWQQITD......................................................................................................................................................................... 165
465 6.000e-04UniRef50_A0A2M7TIQ5 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7TIQ5_9BACT  ali  61  139...GVSYFDELLQRVRAIRASEKNLYQKVRDIFATSTPF................................................................................................................................................................. 174
466 6.000e-04UniRef50_A0A1F7H1F7 Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium RIFCSPHIGHO2_02_FULL_38_11 TaxID=1802039 RepID=A0A1F7H1F7_9B  ali  23  4..................................................................................................................................................LNGYPVLEGLGKISKDQADEKALNEYSRFRVIQDRSYKNDFEKMIK........ 49
467 6.000e-04UniRef50_A0A1Q3QGD1 Uncharacterized protein n=1 Tax=Bacteroidia bacterium 43-41 TaxID=1895720 RepID=A0A1Q3QGD1_9BACT  ali  22  1.....................................................................................................................................MKFWHENVDRMLEFQDKNILRNAGSISNQQMEEKVREICAAFDARRKGYEAMEADNNDLQELKELE. 66
468 6.000e-04UniRef50_A0A1G7W558 Uncharacterized protein n=1 Tax=Roseospirillum parvum TaxID=83401 RepID=A0A1G7W558_9RHIZ  ali  32  37.................................................................................................................................................KLADRAVLSHAGSVSHQQMLKIIDDRYATFDAARRTAEADEHAQEVEAELKRL.. 93
469 7.000e-04UniRef50_A0A1F3VE58 Uncharacterized protein n=1 Tax=Bdellovibrionales bacterium RIFOXYC1_FULL_37_79 TaxID=1797395 RepID=A0A1F3VE58_9PROT  ali  50  51..IGKSYFQKLIERIRDIRTSERQFYQKITDIYATS.................................................................................................................................................................... 84
470 8.000e-04UniRef50_E8LJ96 Uncharacterized protein n=1 Tax=Succinatimonas hippei (strain DSM 22608 / JCM 16073 / KCTC 15190 / YIT 12066) TaxID=762983 RepID=E8LJ  ali  48  2....................................................IQNRFHYAITGQTAAQIIYTKADHSKENMGLTTWKNAPDER........................................................................................................... 42
471 1.000e-03UniRef50_A0A1I0HQA2 Virulence protein RhuM family protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1I0HQA2_9FIRM  ali  68  17...GGGYFKELLERIRDIRASEKVFYRQILEI........................................................................................................................................................................ 45
472 1.000e-03UniRef50_UPI000AFAF019 hypothetical protein n=1 Tax=Streptomyces TaxID=1883 RepID=UPI000AFAF019  ali  20  39..................RAREMIDYRTFRDMMAESPDHEPSSKTTRIFFATMQNKLYLHVVGTTAEEIKQAR--------NMVTWPASRRVSPSPARRTRPARWRRTISSNRSCGSWIGLSVGCASAPRTSRMT................................................................. 148
473 1.000e-03UniRef50_A0A2H0ST50 Uncharacterized protein n=1 Tax=Candidatus Pacebacteria bacterium CG10_big_fil_rev_8_21_14_0_10_45_6 TaxID=1974771 RepID=A0A2H0ST  ali  41  3.........................................TPRASLSEKQQVQNKLHFAISGRTAAEIISSRASSAKPNVGLTNWKNGAIRKSDVIVAKNYLDKEELAGLINFI..................................................................................... 79
474 1.000e-03UniRef50_UPI000B881442 hypothetical protein n=1 Tax=[Clostridium] populeti TaxID=37658 RepID=UPI000B881442  ali  35  3...............................................EIFTIVQNKLHFAIHGHTAAEVIVNRVDATKEHRGLTTWNNAPDGKIVKRDVNKSY................................................................................................. 58
475 1.000e-03UniRef50_UPI000BB94915 hypothetical protein n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=UPI000BB94915  ali  34  6...........................................................................................................................................KLEALLQFNKREVLTHAGNIGAQVAERLAQAQYAEFDARRQQMPSTQAQEQIQRQLER... 65
476 1.000e-03UniRef50_A0A1J5EMG3 Uncharacterized protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5EMG3_9DELT  ali  47  82..................................................RSVQRSIDYAFTGQTAAEIIHAKADHNAPYMGLLTWKNARVLASDVTVAKNYFGEPEIT........................................................................................... 147
477 0.002UniRef50_A0A1X1QQV2 Uncharacterized protein n=1 Tax=Cycloclasticus sp. symbiont of Poecilosclerida sp. N TaxID=1840472 RepID=A0A1X1QQV2_9GAMM  ali  29  1..........MLARIRDIRSSEKVFWRKELDVYATSSGYDAITEQLIQINSATRSTFLREFYNHDNAEVVS................................................................................................................................. 61
478 0.002UniRef50_A0A2M8C7G2 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A2M8C7G2_9BACT  ali  57  112..FGKDYFEEQLARIRDIRSSERRFYQK............................................................................................................................................................................ 137
479 0.002UniRef50_A0A1E3C2K0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1E3C2K0_9CLOT  ali  35  17TAFGKDYFRELLERARSIRASERLIWQQIEEKLKPEETR................................................................................................................................................................. 55
480 0.002UniRef50_R5VHH5 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R5VHH5_9FIRM  ali  45  47..FGYDYFEETLERIRNICSSERRFYQKIIDIYSS..................................................................................................................................................................... 79
481 0.002UniRef50_A0A2S9T4L8 Cell filamentation protein Fic n=1 Tax=Arcobacter cryaerophilus TaxID=28198 RepID=A0A2S9T4L8_9PROT  ali  50  127..NSMGYFDELQKRLRDIRISEKFFYQKIKDIYMKSIDYDPKDEKT.......................................................................................................................................................... 170
482 0.002UniRef50_A0A0M8KDV4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0M8KDV4_9BACT  ali  24  1.....................................................................................................................................MKFWRENVDKILQLNDKVVLMSNGKVSNQQMEEYVDVVYNDFHLQRKLFEAQQ.............. 53
483 0.002UniRef50_H3NR34 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=H3NR34_9FIRM  ali  28  1.....................................................................................................................................MEEFVSSVNEFLEFRKYDVLPDKGKISSKTAKDKASKEYDIFNKTQKI---DSDFDEFT---KRLDK 63
484 0.002UniRef50_A0A225X6D3 Virulence RhuM family protein n=1 Tax=Wolbachia endosymbiont of Wuchereria bancrofti TaxID=96496 RepID=A0A225X6D3_9RICK  ali  48  80.KFDESYFDKLLEKIREIQTSERRFYQRLR.......................................................................................................................................................................... 108
485 0.002UniRef50_UPI0009F71B39 hypothetical protein n=1 Tax=Butyrivibrio proteoclasticus TaxID=43305 RepID=UPI0009F71B39  ali  62  43.....NYCKELLDRIRDIRSSEKVLYRQVLTI........................................................................................................................................................................ 69
486 0.002UniRef50_G9YF02 Uncharacterized protein n=1 Tax=Anaeroglobus geminatus F0357 TaxID=861450 RepID=G9YF02_9FIRM  ali  31  2..........................................................................................................................................KYLDNVLKTTGEKVLQSPGTINHKQAIEKATEEYK........................... 36
487 0.002UniRef50_UPI0009EC7062 hypothetical protein n=1 Tax=Morganella TaxID=108061 RepID=UPI0009EC7062  ali  64  10............ERIRDIRASERRVYLRVKDIFAMAVNRELRS............................................................................................................................................................. 40
488 0.003UniRef50_G5HQE9 Uncharacterized protein n=1 Tax=[Clostridium] citroniae WAL-17108 TaxID=742733 RepID=G5HQE9_9FIRM  ali  38  1.................................................................................................MAKNYLDEKELDALNKIVMAYLDIAEVHALNQEPMYMKDWLETIDDYLRMTRRDILTTKQEYILSPVECHFLE.............................. 73
489 0.003UniRef50_A0A256W5C5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_112 TaxID=1971630 RepID=A0A256W5C5_9BACT  ali  19  10...................................................................................................................................................NRYDVLSDAGKISHNRALKRSAEEYDKFRKIQDNKYLSDFDNAIKN....... 55
490 0.003UniRef50_A0A011PJJ9 Virulence protein n=1 Tax=Candidatus Accumulibacter sp. BA-92 TaxID=1454003 RepID=A0A011PJJ9_9PROT  ali  36  93..LGEDYFERLLAEIREIRLSERRFYQKITDIYSTAVELIARR............................................................................................................................................................. 133
491 0.003UniRef50_A0A1G9E9K0 Virulence protein RhuM family protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1G9E9K0_9PROT  ali  38  142TILGKQYFEQQLARIREIRLSERKFYQKITDIYATA.................................................................................................................................................................... 177
492 0.004UniRef50_Q1JJT9 RhuM n=7 Tax=Streptococcus pyogenes TaxID=1314 RepID=Q1JJT9_STRPC  ali  14  1............................................................................................................................MIERRHSFIKEHFVASIDNFLNFREYRMLEGKGSISMKFAKEKASREYVEFNKLQKINPDK............... 61
493 0.004UniRef50_UPI00053D7332 hypothetical protein n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=UPI00053D7332  ali  24  1.....................................................................................................................................MTFWKENVGQIIASNGFPLLNDAGAISQAKMEHVTTALYTEFDERRRLQEAQDADRADEGELIALE. 66
494 0.004UniRef50_UPI000D72707C hypothetical protein n=1 Tax=Acidiferrobacter sp. SPIII_3 TaxID=1281578 RepID=UPI000D72707C  ali  25  6...............................................................................................AIVAKSSLSEAKMAQLWRSAPAYRDRVEDRVRPRIPMTMQSRKARLHRFTEARDREVLQDAGEAMAETTKARAERAFATHRTVRDRLFEG-DFDLMAKRIKARRK 109
495 0.004UniRef50_A0A1X0T563 DNA-binding protein n=1 Tax=Aurantimonas sp. 22II-16-19i TaxID=1317114 RepID=A0A1X0T563_9RHIZ  ali  35  97.RENADRVAELREIIRDLRSDEANLYRELRAICALCQD-DGTTKTATEFFQRTQAT................................................................................................................................................ 150
496 0.004UniRef50_Q72BC9 Uncharacterized protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=Q72BC9_DESVH  ali  27  20...................................................................................................................................................SEYRILKGYGFISRKQAEAKAYAEYEKFN---RTQHIESDFDRQVKALKR... 66
497 0.004UniRef50_UPI00030479D1 hypothetical protein n=1 Tax=Photorhabdus laumondii TaxID=2218628 RepID=UPI00030479D1  ali  45  1..................................MAADYEPSNKETTRFFKTIQNKLHFACTGMTAAELIANHFSA............................................................................................................................ 42
498 0.005UniRef50_UPI0009812B76 DUF45 domain-containing protein n=1 Tax=Herbaspirillum sp. VT-16-41 TaxID=1953765 RepID=UPI0009812B76  ali  80  84.....DYFGELLERIRDIRLSEKRFY.............................................................................................................................................................................. 104

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.