current user: public

If you have questions about the server, please let us know.

Query: HGC00429 gi|162734516|dbj|BAAZ01029480.1|1.0 TMP00411;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# E-value Template Links and tools%idFirst MLKENQGYVIRRTILFDNQCGFALGENSRAPNPFVTWQFNGQDGHRDYFWGHYMNEPDMAERDLLNRARDYQRRYHVEEVEQAPDKETYLYYSTQRPIDIGTYPNSYFNRPVHMDLYFTRQQVTGEIFQAWGAITYAHPLTEREMQDYELRPSRNNLDIRRQMDAQAQVVGKWEDAHHVPDQKRLTWFYPDFGSYVVKEYVTPDQLAVRVRSIERQEAARAHKEAKRQPPIAEQLKAAQREAQGHRGPELPKRSPLast
1 5.000e-82UniRef50_G5F8B1 Uncharacterized protein n=25 Tax=Firmicutes TaxID=1239 RepID=G5F8B1_9CLOT  ali  59  1.MDKNQGYSILKTIMLENGRGFALGHSPTAPSPYVTWACYDDDGQRQYEWGHYGNDLGKLEKDLVNRVTEYQRLYKVKIAQTEAP-SLYKYYSTQRPVDIGTFPKPPHNAPDEIVNYEGRVWVENDTRLAWGHLTYTRPLTEQEAADYELRPSRENPDIKQQMEKQAQVVGKWEDAHRVPDQKRLTWFYPDFGSYVVKEYVSPERLAEAAKGMEHQEAARACKEAKRQPPIAEQLKSAQREAQEHRGPEAPKK.. 252
2 1.000e-77UniRef50_A0A096CL05 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=A0A096CL05_9FIRM  ali  45  1.MERNAGYEIKRLLLYDDNKGFALGENLRAPDPYVTWKVTEEQGRRSFDWGHYFTTERAAVKDFLKRAGDYEKENSVFLASEGPQPDSFKYYSTQRPIDIGTFPKGGGNDPIRFQNYDKRLPVEGGAFLAWGELEYGKQLTDDELFCYELRPSRDNPDVWRRMDALAQVVGPWEDMRQLPEGRRLTEWSAEADAYVPTAKATVEKLM---ECTENIRVRRALLTGDRQPSIRDQLKAAQREALEHQGPEAPKK.. 249
3 2.000e-72UniRef50_A0A1V4W5E8 Uncharacterized protein n=1 Tax=Pelotomaculum sp. PtaB.Bin104 TaxID=1811693 RepID=A0A1V4W5E8_9FIRM  ali  44  8..EKVHGYEIKRSILFDNDRGFALAENPNAPQPYVTWQFTEENSRRDFYWGHYTTDADTAAKDYAARVEDYKERYGVAEKAARPAPEVYKYYSTQRPVDIGTFPKT-ENGPTEIVNFDKRESVENGRFQAWGYLLYNAPLTGKQITDYELRAAPGNPDQLRLSPEQLQAVGKWEQAKRIPNVKRLTWWYSDFGSFVKKEFVTDAELSGRYEKVMGIKARAARKS-AEKKPISERLKEGAAQAEDNAARPTPFKN. 262
4 1.000e-58UniRef50_G2T378 Uncharacterized protein n=47 Tax=root TaxID=1 RepID=G2T378_ROSHA  ali  40  1.MDKNQGYAILKAVMLENGRGFALGEHPTAPSRYVTWACYDRDGQRQYEWGHYGNDRTAMEQDFTDRVQDYQRIYNVGIRQTEAP-GLYKYYSTQRPVDIGTFPKPPYNKPDEIFNYDQRIPVENGSFLAWGYLTYTRPLTEKQASDYELRPAPDNPDRPRPIAEQMKNAAKLAEADRGSEAPAPQRRQPDRG.............................................................. 192
5 2.000e-58UniRef50_A0A1C7FN50 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1C7FN50_9FIRM  ali  44  1.MESNQGYVIRQSVLFDNGRGFALGENFKAPNPFVTWQFTQEDGKRDYYWGHYFNEECEAIGDYNRRVFSYEKQYGVSRLATSGP-DFFKYYSTQRPVDIATYPRPKDNLPVAHLNYNARQPVEGESFRAWGELWYLHPLTEKQMADYELRPAHDNPVGREPVPERG-AAKKAPIARQMKEAGRKARKQRAPDAPEKKSPSRGDR.................................................. 202
6 7.000e-56UniRef50_A0A1Y3R679 Uncharacterized protein n=1 Tax=Flavonifractor sp. An91 TaxID=1965665 RepID=A0A1Y3R679_9FIRM  ali  43  1.MDKNQGYTILRAVMLENGRGFALGHHPTAPSPYVTWACYDETGQRQYEWGHYGSDFTAIEQDFTNRLVEYQRIYKVSVVQVEAP-GLYKYYSTQRPVDIGTFPKPPHNAPDEIVNYDQRVPVEGGAFLAWGHLTYTKPLTDKQVSDYELRPAFNVHELRRKRGER......................................................................................... 165
7 2.000e-55UniRef50_U2CEV3 Uncharacterized protein n=10 Tax=Clostridiales TaxID=186802 RepID=U2CEV3_9CLOT  ali  34  1.MEDLKGYQIQKEAVFENGRGFALAHNPEAQSPSVIWHFTMPEGERNYYGYTACRGILPPEKEFERFLSSYDYVYKVPQLPEGKRPMDYYRYYTHYPLDKNTFPKSKELGLLEIAPYDNRTMVEGNSIRTWGELIYTKPLPEKLVADYELKPSRLNPDIRKKMEEQTQALGKWEDSRHFGDKRRLTWFHPDFGTYILKQPLSPEQLSERIEAXXXXXXXXXXXXXX-----XXXXXXXAKQEKENREPSAKKGG. 251
8 2.000e-54UniRef50_A0A174BTQ6 Uncharacterized protein n=25 Tax=root TaxID=1 RepID=A0A174BTQ6_9FIRM  ali  42  1.METVQGYVILKAATFETGHGFALGHNPGAPSPFVTWQFTEGNGHRDYYWGRYGTSQAWAQRDFDRRVDDYQQLYHAAKHTELGPEGVYRYYSTQRPVDIGTYPKLPDNQPLSIVNYDDRRPVADGSLMAWGELTYAKPLTEKQMEDYELKPAPGNPDRVRPITARLKEGTRGQEPPKEPGQKRSHKNHEER............................................................... 196
9 4.000e-54UniRef50_C4ZEP3 Uncharacterized protein n=67 Tax=root TaxID=1 RepID=C4ZEP3_AGARV  ali  42  11LLETVQGYVILKAATFETGHGFALGHNPGAPSPFVTWQFTEGNGHRDYYWGRYGTSQAWAQRDFDRRVDDYQQLYHAAKHTELGPEGVYRYYSTQRPVDIGTYPKLPDNQPLSIVNYDDRRPVADGRLMAWGELTYAKPLTEKQMEDYELKPAPGNPDRVRPITARLKEGTRGQEPPKEPGQKRNHKNHEER............................................................... 207
10 1.000e-52UniRef50_R5EIQ9 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=R5EIQ9_9FIRM  ali  40  1.MDKNQGYEIIKAVMLENGRGFALGHNPAAPSPYVTWACYDKDGQRQYEWGHYGSDRAALEQDFAARVQEYQRLYNVGIKQAEAP-GLYKYYSTQRPVDIGTFPKPPRNAPDEIVNYDQRVPVENGSFLAWGHLTYTRPLTKRQASDYELRPAPDNPDRPRSIREQMKTAAKQAEADR--GQAAPKKNAPDRG.............................................................. 199
11 1.000e-51UniRef50_A0A0P9ADJ8 Uncharacterized protein n=1 Tax=Oxobacter pfennigii TaxID=36849 RepID=A0A0P9ADJ8_9CLOT  ali  42  8..EMVHGYEIKRSVLFDNDRGFALAENPNAPQPFVTWQFTEENGKRDYYWGHYTTNKAAAVRDYENRVLEYQYDYGVSE------KSAYKYYSTQRPVDIGTFPKT-ENGPLYLVNFDKRESVEQGRFLAWGYLVYDAPLTEKQMNDYELRAASGNPDRNATLREQGENKSIAALAEGAKQAARDNAAHPSPSKNTEKD........................................................ 198
12 8.000e-47UniRef50_D9R2T5 Uncharacterized protein n=7 Tax=Firmicutes TaxID=1239 RepID=D9R2T5_CLOSW  ali  39  1MSDNVKGYEIKRAIAFENDRGFTLGENPQAVQPFATWQFTDASGRRDYYWGHYTTDKAAATRDYENRVSEYQHDYRISE------KSAYRYYSTQRPVDIGTFPKT-ENGPLYFVNFDKRDSVEQGRFLAWGYLVYDAPLTEKQMADYELRAAPGNPDRKAPLGESKSIAARLAEGTKQAARDNATRPASER............................................................... 189
13 3.000e-45UniRef50_UPI0009B90252 hypothetical protein n=1 Tax=Flavonifractor plautii TaxID=292800 RepID=UPI0009B90252  ali  45  1..............................................................................MASEGPQPDSFKYYSTQRPIDIGTFPKGGGNDPIRFQNYDKRLPVEGGAFLAWGELEYGKQLTDDELFCYELRPSRDNPDVWRRMDALAQVVGPWEDMRQLPEGRRLTEWSAEADAYVPTAKATVEKLM---ECTENIRVRRALLTGDRQPSIRDQLKAAQREALEHQGPEAPKK.. 172
14 4.000e-44UniRef50_A0A1C7FRR1 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1C7FRR1_9FIRM  ali  46  2......................................................................................DGYKYYSTQRPVDIWTFPEPPDNKPMEIKNYDFRIPIPGEAFRAWGELIYAKPLTDKQMEDYELKPSRQNPDLKKRMEEQTQALGKWEDSRHFSERKRLTWFHPDFGSYVLKDFVTPEQLAERFEIMQELQAERR-----EKRSIAAQLRKGSKQAKDHQEPPVKKSGP 167
15 1.000e-43UniRef50_C0EFV8 Uncharacterized protein n=8 Tax=Firmicutes TaxID=1239 RepID=C0EFV8_9FIRM  ali  52  2...................................................................................EKAQEYKYYSTQRPVDIGTFPNGKENPPIRIENYEGRIWVEHDTRLAWGELAYAQPLTEKELYNYELKPSRDNPDMRRLMDAQAQVVGKWEDEGRVPDGKRLTWFYPDFGCYVVKEFVSPERLAECARGVELRAAAERRQARQEKAPIAAQLREAGKLAGERQAPAAPKRN. 173
16 1.000e-35UniRef50_K1UHU5 Uncharacterized protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1UHU5_9ZZZZ  ali  45  11LLETVQGYVILKAATFETGHGFALGHNPGAPSPFVTWQFTEGNGHRDYYWGRYGTSQAWAQRDFDRRVDDYQQLYHAAKHTELGPEGVYRYYSTQRPVDIGTYPKPPDNQPLSIVNYDDRRPVADGS................................................................................................................................ 141
17 3.000e-33UniRef50_A0A1C6EL77 Uncharacterized protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6EL77_9CLOT  ali  45  3......................................................................................DRYTYYSTQRPVDLGTYPRPPDNLPVEIINYDSRIPVEGEVFEAWGELTYAKPLTDRQQYDYELRPSRDNPDVRVKMRRQAQVVGPWEEYHSIPEEQRETEYDHARGLYRPRQSVSPERLKTRYISVKMSPVPNWHTPKRKDTP......................... 148
18 4.000e-33UniRef50_A0A1C7FLV9 Uncharacterized protein n=11 Tax=Clostridiales TaxID=186802 RepID=A0A1C7FLV9_9FIRM  ali  42  2...................................................................................EQQELYRYYSTPRPVDIGTYPKEPDNPLVGFLNYDDRISVEHGAFRAWGEVMYRAPLTQDELYQYELRPSRDNPDVRQTMKEQAQVVGRWEDRNSIRTDRRLTRCV-GIGAYICGDCVTPEELARRYRLAEDLPFISRRGPRPQKSP......................... 147
19 5.000e-29UniRef50_D4JDL6 Uncharacterized protein n=20 Tax=Firmicutes TaxID=1239 RepID=D4JDL6_9FIRM  ali  19  5..RENAGYIITDSCHVGD-SEFVLGVHLTAPQQFVTWKC---SNRTDYDWGHYFSDLXXXXXXXXXXXXXXXXXXQNTIAPEAPPYSPWGKVQECETLCPGVYSTPGHGGVMELAEKVFRKEAMGCGFIASGYLCFEED-NDAQVALRELMDAPGAYEAVINSSVQIHHPEYWQAREKISEQKRQAKK................................................................... 207
20 1.000e-27UniRef50_K1TY22 Uncharacterized protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1TY22_9ZZZZ  ali  39  1.MDKNQGYAILKAVMLENGRGFALGEHPTAPSRYVTWACYDKDGQRQYEWGHYGNDRTAMEQDFTDRVQDYQRIYNVGIRQTEAP----GFTSIIRPNGLWT......................................................................................................................................................... 98
21 2.000e-26UniRef50_UPI000B8A7785 hypothetical protein n=1 Tax=Massilimaliae timonensis TaxID=1987501 RepID=UPI000B8A7785  ali  20  3.IQMNEGYIIIDSIYIG-GSGFVLGVSSSIPNMYVTWEHINGK----YYNGRYTGSMLSAKRDLXXXXXXXXXXXXXXXXXXEPEFTPWGEISECCELSPGIFSTPSHGGIMSIAKKIFSKEAAACGFQENGYICFEEDC-AATVAIRELMDRGQAPVNEYYNAGEYSSMIDDSIRRYYPDYWRKREKQLSKGSNV........................................................... 201
22 5.000e-26UniRef50_G4KUJ5 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=G4KUJ5_OSCVS  ali  38  5............................................................KKGLATRVQEYQRQFSVKIVQTEAP-GLYKYYSTQQPVDIGTFPKPPHNAPDEIVNYDQRVPVEDGAFLAWGHLTYTKPLTEKQASDYELRPAKDNLDLRREQPAKRSIAEQMKAAERLAEESREKKTAPDRGE............................................................. 141
23 3.000e-23UniRef50_C0EI82 Uncharacterized protein n=1 Tax=[Clostridium] methylpentosum DSM 5476 TaxID=537013 RepID=C0EI82_9FIRM  ali  25  1........................................MADGKRNFYDFTSCRGILPPEKEFEKFLSAYDYVYKVRRLAEKTPDTNYYRYYTQYPLDDNTFPKGKESGLLEIAPYEKRLMVENDTIQTWGELIYTKPLTKEQIAYYDLTPAPNNPDMKPSIAAQLQEGAKQAKEHREPPAKKDGPAHQDR............................................................... 163
24 9.000e-23UniRef50_A0A1J7YDX5 Uncharacterized protein n=4 Tax=Enterobacteriaceae TaxID=543 RepID=A0A1J7YDX5_CITFR  ali  21  407......................................................................................AKYRYALTSRPASIGAVP------ADHTAILDAPEQSDKYGRLAHGFIEYDRKLTEQEASNFELIPTEADLDVLAKTAQQYVEMAESDPATFGSQVKLNTKKAAPNIAYPEGDDL--DYFMEKVKAELVSQTPPTPPQTNEETPVVSEADTAANDA............. 566
25 5.000e-22UniRef50_R9K228 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium M18-1 TaxID=1235792 RepID=R9K228_9FIRM  ali  30  1........................................................................................MRYYSTQRTITPGSYPKSPFMKVLNIVNFDSRTYCEEIGQEAWGYIEYKTPLHPEDVAEYELMPVSD-----KIMNLSFVGVDSWGHRVY-KDEVGRLWKYSDPGEMPEE......................................................... 104
26 7.000e-22UniRef50_A0A140L9C0 Uncharacterized protein n=25 Tax=Firmicutes TaxID=1239 RepID=A0A140L9C0_9CLOT  ali  33  4..EINAGYVITDRLTIGN-TEFVIGQNENAPAKFVTWKC--KKGEKNYYWGHYCNDRMTALEDLCNRALDEIHYLRSLRQEKDTNEKMAGQAEK................................................................................................................................................................. 92
27 2.000e-21UniRef50_A0A0W7TVS3 Uncharacterized protein n=10 Tax=Clostridiales TaxID=186802 RepID=A0A0W7TVS3_9FIRM  ali  45  1.MEKNAGYVIRESVLFDNKRGFAIAENPKAPAPFVTWQFAEENGRRDYYWGHYHADEASAQKDFKDRAADYKRMYKVQEVKPRTIAQQMKEAAKLAEADRG.......................................................................................................................................................... 102
28 2.000e-21UniRef50_R7PL46 Uncharacterized protein n=1 Tax=Clostridium clostridioforme CAG:511 TaxID=1263066 RepID=R7PL46_9CLOT  ali  51  1.MEVNADYIIRQSVLFDNGRGFALGESPRAPAPFVTWQFTEEQGRRDYYWGHYHGDRAAAEKDFAARIEDYKRRFGVHEVMRPI........................................................................................................................................................................... 83
29 5.000e-21UniRef50_UPI00036BAA84 hypothetical protein n=1 Tax=Lamprocystis purpurea TaxID=61598 RepID=UPI00036BAA84  ali  22  540...............................................................................PSDKAAPTEYRYALLNRPAGPGAIPR---DGLLRAEPRPN-QNEDHHAIARHGFAVYSRPLTDQEIKSYELAPVITGVDRDALVDQLAVAIEKYADGYAEADKRRVEKMNGGNGAAVSNADSLPDDVLARA----LSKKAPILTTLASQTPTP---KPASAPASAKPEPPTRYRSP 712
30 7.000e-21UniRef50_UPI000774CA8D hypothetical protein n=1 Tax=Syntrophomonas wolfei TaxID=863 RepID=UPI000774CA8D  ali  34  4..EINAGYVITDRLAVGN-AEFVIGQSDTAPAKFVTWKC--RKGEKDYFWGHYLGDRLTALEDLCNRALDEI------HHLKLLQQDQENEVKPERPVKKRCEPE...................................................................................................................................................... 97
31 9.000e-21UniRef50_R9K298 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=R9K298_9FIRM  ali  31  4.FRTNAGFVITTSIPVGN-AEFVLGVNMKNPNSFVTWEC---KGQTDYFWGHYTDSLLKATKDLCQRAMDEILYLEQREEKAAQRNQDSGYYGDNSAVI--QFPTPELADVL............................................................................................................................................... 115
32 1.000e-20UniRef50_UPI0006C7DE4F hypothetical protein n=1 Tax=Clostridia bacterium UC5.1-2H6 TaxID=1697788 RepID=UPI0006C7DE4F  ali  26  149..EKNGNYKIIASFDIGNSS-VVLGYNEKSPSPYVTWK-TTPDRKNGYYTGHYGVTKESAFNDYKKRCKECFNEHLNKESQKLGIKDK....................................................................................................................................................................... 232
33 1.000e-20UniRef50_UPI0005D1EC65 antirestriction protein ArdA n=1 Tax=Blautia schinkii TaxID=180164 RepID=UPI0005D1EC65  ali  29  224.VRVNQGYTILESVEA-DGVEFVLGENPKAVQPFVTWRRLDGGGPTDFTWGHYFTDYQAAKRDLMGRAKEHLNDRNEGKPPSLRAKLRMAQESRPASGPHRHTPEKE.................................................................................................................................................... 328
34 2.000e-20UniRef50_UPI000D6AF388 hypothetical protein n=1 Tax=Faecalicatena contorta TaxID=39482 RepID=UPI000D6AF388  ali  30  4..RVNAGYVITSSVQIG-ETEFVLGVHKTSPDQFVTWKCTNG---VDYYWGHYTDNLLSATKDLCQRGLEEVQFLEQRQEHSSQAK......................................................................................................................................................................... 83
35 2.000e-20UniRef50_U2BFX3 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=U2BFX3_9CLOT  ali  30  186..RVNQGYTILESVDAG-GVEFVLGENPKAVQPFVTWRRVDGGGPTDFTWGHYYNDYQSAKRDLMGRAQEQLNDQNEGKPPSLRAKLRMAQENKSLPGPHRPAPEKE.................................................................................................................................................... 289
36 3.000e-20UniRef50_A0A1M7G6T8 Uncharacterized protein n=1 Tax=Eubacterium callanderi TaxID=53442 RepID=A0A1M7G6T8_9FIRM  ali  34  4..EINQGYMITDRIQVDPDNAFVLGFNPKAPQPFVTWKCGQDDY---YYCGHYFNDQDKAISDLCTRVMEALDYKKESKMAEDESELPEKCYSTLLE.............................................................................................................................................................. 96
37 9.000e-20UniRef50_A0A1Y4A8E8 Uncharacterized protein n=1 Tax=Flavonifractor sp. An4 TaxID=1965634 RepID=A0A1Y4A8E8_9FIRM  ali  27  1........................................................................................MKYFSTQRPLTPGAFPNHLHH-PVNLVNFDQKVFREEIGREAWGYVEYAEPLDPDTVRNYELTPAP-----IKTKTLHFHGIDQWGRETYE-DEDGKLWKYSEPG.............................................................. 98
38 1.000e-19UniRef50_U2F4T6 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=U2F4T6_CLOS4  ali  34  3.MRTNAGYTITDSVHIG-KAEFVIGEMPNAPAPFVTWECKNGN---NYFWGHYFSTRQAAERDLLERAGQELEYQSRGQEQPEKKE......................................................................................................................................................................... 83
39 1.000e-19UniRef50_A0A0P7EBK5 Uncharacterized protein n=25 Tax=Vibrionaceae TaxID=641 RepID=A0A0P7EBK5_VIBAL  ali  16  473.....................................................YDRESKLLQDTDDSNEEPQPIENDEPNANDQDKDEFWYGLRLRPYGLGTTP-PQHQVAKYLDPESAKQFADAGNGIRHGAIAYDQKLPPELVSNFDLEPLFGMVDLEEAERIATEALDQWVEAKQLRQQPEMKNRKENPNAYASIDLVTPDMIQEIAEDLMLVQSDAELQRQAEHTQGRMRFQEAASQLKDMQSPSDRKR.. 710
40 2.000e-19UniRef50_A0A2N5Q022 Uncharacterized protein n=1 Tax=Ruminococcus gnavus TaxID=33038 RepID=A0A2N5Q022_RUMGN  ali  29  738......................................................NNPDLSVDEMKKGLREIRKEHRAYIKSLTPENGNYRYYSTQRPVMPGVYPKPIGNEPVEIVNYDSRQAVENGKLQAWGYLEYALPLSPRERDDYELKAVDKNPEKKKSVLADLHDKQEKIAGANEAKKSRSKKQTKE................................................................ 890
41 5.000e-19UniRef50_A0A1C5PBD5 Uncharacterized protein n=1 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C5PBD5_9FIRM  ali  24  1........................................................................................MKYYSTKRPVVPGNFPEPDDNKVVAIHNYDSKTYCEAIRQKVWGYVEYEKPISLEAAIDYDLIPP-----LREIKKIRFVGIDSWDRMV-FKDESGDIWKYTEPGEQP........................................................... 102
42 7.000e-19UniRef50_U2RCR3 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=U2RCR3_9FIRM  ali  30  182...VNQEYHITARVRVG-SAEFVMGECEKAPAPFVTWQRNDGDGPPNFFWGHYRSDRASCIEDFCERAGNEYKKQRDYITQQEHQHTALKKEQ.................................................................................................................................................................. 273
43 9.000e-19UniRef50_A0A2X2TU46 Uncharacterized protein n=1 Tax=Citrobacter freundii TaxID=546 RepID=A0A2X2TU46_CITFR  ali  19  2.....................................................................................................................DAPEQSDKYGRLAHGFIEYDRKLTEQEASNFELIPTEADLDVLAKTAQQYVEMAESDPATFGSQVKLNTKKAAPNIAYPEGDDL--DYFMEKVKAELVSQTPPTPPQTNEETPVVSEADTAANDA............. 136
44 1.000e-18UniRef50_A0A1Y4SIS1 Uncharacterized protein n=4 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A1Y4SIS1_9FIRM  ali  22  152..EANGPYKIIAETSIG-SRTIVLGHSSISPSPYVTWD-TTPNRKHGYYAGHYFSSYTDAFKDYKERCQVIMSKHLEFERNKTKPIKGTKKYER................................................................................................................................................................. 241
45 2.000e-18UniRef50_A0A0M2NH68 Uncharacterized protein n=1 Tax=Catabacter hongkongensis TaxID=270498 RepID=A0A0M2NH68_9FIRM  ali  47  1.MERNQGYTILEKRCIGN-TGFALGYNSKAPQPYVTWQFR-RSTPHEYFWGHYYTDKSAAHKDY............................................................................................................................................................................................... 61
46 2.000e-18UniRef50_UPI0002F896EE DUF4314 domain-containing protein n=1 Tax=Dehalobacter sp. E1 TaxID=304767 RepID=UPI0002F896EE  ali  32  282...VVHGYEITCSIWFDNQRGFAIGHNPNAPDPFVCWQFTAENGARDFYWGRYCGSEKAAAANYAARTLAHMKDELCGEIPNPLAAAEMSAEQN................................................................................................................................................................. 372
47 3.000e-18UniRef50_G4KY11 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=G4KY11_OSCVS  ali  29  4..EKVEGYTIIESTVIGNAK-FVVGKNPQNPIPYVTWQANMKNDPHSYFWGHYYGDKLTALADYGDRISQEAQYLKSFQEKKAKEKP........................................................................................................................................................................ 88
48 3.000e-18UniRef50_A0A2T3FVT0 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A2T3FVT0_9FIRM  ali  20  144..EKNGSYEIIKEIHINDDS-IVIGYSPTSPSKFVTWE-TNGNRKYGFYTGHYFNDYEEAYKDMEKRSKYLLEQNLCRKRNFLRKNKTNRE.................................................................................................................................................................... 230
49 3.000e-18UniRef50_N9YVH3 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=N9YVH3_9FIRM  ali  35  1......................................................................................MSHRYYSPLRPLSLGTFPKPQGNEILHIENFEERQNVPEIARQAWGYIEYKEALTEIEAAAYELIPSNCISEMENIEARR......................................................................................... 80
50 8.000e-18UniRef50_UPI0009329903 hypothetical protein n=1 Tax=Holdemania sp. Marseille-P2844 TaxID=1852366 RepID=UPI0009329903  ali  34  4..RKNASYTIVQSLMIGD-AEFVIGHNPAAPAPYVTWECKDGN---NYFWGHYMNERRQADRDLLERAKTELDLQDRRFGRTQKNKDKERE.................................................................................................................................................................... 88
51 9.000e-18UniRef50_A0A0X1U960 Uncharacterized protein n=2 Tax=Anaerotignum TaxID=2039240 RepID=A0A0X1U960_CLOPR  ali  25  259..RTIGGYAVTESHIVSN-YEFAFGENEKAPSPYGSWQRNIKNDEENWFWGHYFSDKDKAVSDFKERIKGALEEVATKSHSVTTKLKAFKELENQSEGAIH.......................................................................................................................................................... 361
52 1.000e-17UniRef50_A0A1Y4M9A6 Uncharacterized protein n=32 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4M9A6_9FIRM  ali  29  5..RINGGYEIIESCTIGNN-ELVIGHNSKAPNPYVCWYCKDGS---DYFWGYYCNQLSEAREKLNERYQRECRMPYNQPDKKQKSRDDRER.................................................................................................................................................................... 89
53 2.000e-17UniRef50_E7G798 Uncharacterized protein n=1 Tax=Coprobacillus cateniformis TaxID=100884 RepID=E7G798_9FIRM  ali  22  160..ELNNNYRIICESECGDQA-IVLAYNKKAPQPYATWQ-TIKSRKHGYDMGHYFSDYLSAYKDFTSRSHQMLDRHLAVNKMRFKGNKEHER.................................................................................................................................................................... 246
54 2.000e-17UniRef50_UPI0009C127C0 DUF3849 domain-containing protein n=1 Tax=Eisenbergiella tayi TaxID=1432052 RepID=UPI0009C127C0  ali  40  16.....QGYQALSSVLFDNETGFVSGENQAAKSPFSTWQLRIDHGHPEYYTPHYHTDRESAEQDLNGRVAEYKRYHTIREKN.............................................................................................................................................................................. 91
55 3.000e-17UniRef50_A0A1Y3QVH0 Uncharacterized protein n=5 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y3QVH0_9FIRM  ali  37  4..RSNAGYIIISAIRVGD-AEYVLGENPNAPARFVTWMCRNRS---DYFWGRYTDDPLTALRNLLDRAGSALEVLERRQREEAGQHED....................................................................................................................................................................... 85
56 3.000e-17UniRef50_A0A1C7GTN3 Uncharacterized protein n=4 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C7GTN3_9FIRM  ali  37  1.MRTNAGYTITDSVHVGD-VEFVLGEQENGKQ-FVTWECKAGN---DYCWGHYFDSLAAAKRDLLIRAHEAL....................................................................................................................................................................................... 66
57 3.000e-17UniRef50_A0A1Y3SJV2 Uncharacterized protein n=1 Tax=Flavonifractor sp. An82 TaxID=1965660 RepID=A0A1Y3SJV2_9FIRM  ali  19  5..RMCQSYEIIDSCRVGD-TEVVLGYSPTEVSPYVTWKCYAHDNFQGYNFGRYFGDEQAARKNMKQRVADLRKDLPPGHPDWRPRRHKK...................................................................................................................................................................... 90
58 4.000e-17UniRef50_A6NWM9 Uncharacterized protein n=3 Tax=unclassified Clostridiales TaxID=186813 RepID=A6NWM9_9FIRM  ali  31  1........................................................................................MRYYSTQRPIGPGTFPKPQGNAVKEVFNFDSKTYCEEVGREAWGYIEYEQPIDPQAAADYFLVADG..................................................................................................... 66
59 7.000e-17UniRef50_UPI0009FDEEEF hypothetical protein n=1 Tax=[Clostridium] methylpentosum TaxID=84026 RepID=UPI0009FDEEEF  ali  29  5.................................................................................QKTPDTNYYRYYTQYPLDDNTFPKGKESGLLEIAPYEKRLMVENDTIQTWGELIYTKPLTKEQIAYYDLTPAPNNPDMKPSIAAQLQEGAKQAKEHREPPAKKDGPAHQDR............................................................... 124
60 8.000e-17UniRef50_N2B5X8 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=N2B5X8_9CLOT  ali  35  1......................................................................................MKYKYYSLERPVMPGTYPKPKDNPAMLIHNFNSREYVPEIGRMAWGYIEYDKPLENKDIDGYELMPA...................................................................................................... 67
61 8.000e-17UniRef50_A0A1Y4LF74 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4LF74_9FIRM  ali  20  1...MCQSYEIIDSRRVGD-TKVVLGYSPTAASPYVTWKCYTHDNFQGYNFGRYFGDEQAARKNMKQRVDELREELPPGHLDWRPRHHRK...................................................................................................................................................................... 85
62 1.000e-16UniRef50_T4NNI0 Uncharacterized protein n=1 Tax=Clostridioides difficile P28 TaxID=1151410 RepID=T4NNI0_CLODI  ali  24  149..EKNAGYTIIAEMKCG-EKAIVLGKRKNNPERFVTWQ-TYVDRRRGFDVGHYFSDFTHAYQDFEKRSHSMMDNELNTMKHKCHPKKIEQE.................................................................................................................................................................... 235
63 2.000e-16UniRef50_A0A1Y4LVA9 Uncharacterized protein n=2 Tax=Faecalitalea cylindroides TaxID=39483 RepID=A0A1Y4LVA9_9FIRM  ali  23  152..ERNENYKIIGETKVGDQS-IVIAHNPKSPSPFVTWK-TTPTRTRGFDIGHYYSRFKDAYEDYKKRCNEMMEDHLNIQYRKIKPK......................................................................................................................................................................... 233
64 4.000e-16UniRef50_C0DAL7 Uncharacterized protein n=1 Tax=[Clostridium] asparagiforme DSM 15981 TaxID=518636 RepID=C0DAL7_9FIRM  ali  36  4......................................................................................EDMRYYSTQRPITPGSFPKPEGNTIEQIVNFPAKTYVDEIWKQAWGYIDYEKPLSEKDASDYELTQGGAYH.................................................................................................. 74
65 4.000e-16UniRef50_UPI0004880A9C hypothetical protein n=1 Tax=Candidatus Stoquefichus massiliensis TaxID=1470350 RepID=UPI0004880A9C  ali  23  153..EENCGYQIIAETTC-NEQTIVLGYKKGASSEYVTWS-TNSNRKGEYLSGHYFTKYKPAMNDFKERCFDIMNKEVIKIKKKCEPQRNNN..................................................................................................................................................................... 238
66 4.000e-16UniRef50_A0A096B2D8 Uncharacterized protein n=3 Tax=Flavonifractor plautii TaxID=292800 RepID=A0A096B2D8_9FIRM  ali  33  1........................................................................................MRYYSTQRPIMPGSYPKPAGNPVVEIRNFDARVFCGEIGREAWGYIEYEQALFPGQAQSYELILAPGQEKR................................................................................................ 71
67 5.000e-16UniRef50_H1B7W8 Uncharacterized protein n=1 Tax=Erysipelotrichaceae bacterium 6_1_45 TaxID=469614 RepID=H1B7W8_9FIRM  ali  26  171..EVNQNYKIIAEESCGHKA-VVLAYNKRAPQRYVTWN-TTRNRERGYDQGHYYNDYGRAFKDFKIRSHEMLEKHHLQKERSKPKEKQHGE.................................................................................................................................................................... 258
68 9.000e-16UniRef50_A0A1Y4I8T3 Uncharacterized protein n=3 Tax=Lachnoclostridium TaxID=1506553 RepID=A0A1Y4I8T3_9FIRM  ali  37  1......................................................................................MKYRYYSTQRPVTPGAYPKPKNNPVMLIHNFSSREYVPEIGRQAWGYVEYDRPLENEDIDGYELAPA...................................................................................................... 67
69 1.000e-15UniRef50_R9N2Z8 Uncharacterized protein n=2 Tax=unclassified Lachnospiraceae TaxID=186928 RepID=R9N2Z8_9FIRM  ali  29  45..RVNQNYVILESEVVGH-KEFVLAQNPNAPQPYVTWERNMRRGEENFYWGKYYCDPEAAEKNFHDR-ADAEREYLREYRPSLLQSLRKNQEEIARPVAP........................................................................................................................................................... 144
70 1.000e-15UniRef50_A5ZQ31 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=A5ZQ31_9FIRM  ali  22  1..................................................................................................MPGGYPKPQNNEVLEIENFDNKKFVEEVGCQAWGYIEYEKPLGHFDVVGYELVAVK-----IKTLHLKYIGRDDWGRYVYE-DENGKLWKNTD................................................................ 87
71 1.000e-15UniRef50_R6H858 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:137 TaxID=1263004 RepID=R6H858_9FIRM  ali  29  4..RANEGYIITDSIHVGD-VEFVIGENETYGTMFVTWSCSNG---TDYYWGHYFNDRFAAQKDLVARAQEEVKYMELKSQPPEQRKPPKKKE................................................................................................................................................................... 90
72 2.000e-15UniRef50_A0A2T0BNU3 Uncharacterized protein n=2 Tax=Clostridium luticellarii TaxID=1691940 RepID=A0A2T0BNU3_9CLOT  ali  40  1.......................................................................................MYRYYSTERPISLGTFPKTKDNVPVDIENFETKKYVDEIKREAYGYLEYEHKLTDKQIFDYELYPT...................................................................................................... 66
73 2.000e-15UniRef50_A0A1C7GV85 Uncharacterized protein n=18 Tax=Firmicutes TaxID=1239 RepID=A0A1C7GV85_9FIRM  ali  28  8..RSNGGYEIIEGCTVTGDTELVIGHNPKAPNPYVCWYCKGGD---NYFWGYYCNELSAAREKLNERYQTESRMPYNNPPAPKQRNDDNR..................................................................................................................................................................... 98
74 2.000e-15UniRef50_A0A2K4ZR33 Uncharacterized protein n=1 Tax=Acetatifactor muris TaxID=879566 RepID=A0A2K4ZR33_9FIRM  ali  20  16...................................................................SPEPEPSWKIPAELPEQDPSMFRYYITQESLNVGTYPLMDGKTITELA---APVKVEQDSITAFGCIDYPQPLTAEQEREYALLPASQNLRALDSIGHAAEAAQLPDAPEQALDE------YPMPDPALCEDDL...................................................... 140
75 3.000e-15UniRef50_R9IGK2 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=R9IGK2_9FIRM  ali  20  122...................................................................SPEPEPSWKIPAELPEQDPSMFRYYITQESLDVGTYPLMDGKTITELA---APVKVEQDSITAFGCIDYPQPLTAEQEREYALLPASQNPRALDSIGHAAEAAPLPDAPEQALDE------YPMPDPLLREDDL...................................................... 246
76 3.000e-15UniRef50_C4VMX4 Uncharacterized protein n=2 Tax=Lactobacillus jensenii TaxID=109790 RepID=C4VMX4_9LACO  ali  29  148.........................YNSKIDIKYSTFTPDIKKKISSYF--------DKQFPTIKQKIRQL--SQENEKVVENEKPKIYRYYSLFRPINPGTYPMKNF-KPLKVENFDERKDV-GGNVKAWGYVEYLNKLSLEEQQNYDLI........................................................................................................ 261
77 4.000e-15UniRef50_A0A174VU39 Uncharacterized protein n=1 Tax=Blautia obeum TaxID=40520 RepID=A0A174VU39_9FIRM  ali  26  1.......................................................................................MYKYYSVIRPISIGTIP---DCTIREVVNFNQRQYVEEIMRQAWGYFLTPDEIPEEKLQAYSLVSADAAVSKWQPVAEKISEFSKKAGDDMEPED......................................................................... 92
78 4.000e-15UniRef50_R9M700 Uncharacterized protein n=1 Tax=Oscillibacter sp. 1-3 TaxID=1235797 RepID=R9M700_9FIRM  ali  25  6...IVGGYTIIERKQAG-EVMVVVGHNPKASSPYVTWKAYDFTNFTSFNHGHYFLTRQEAMVDYFQRLAE-----------------VWEHYTPAR----HTPPKHRENDP................................................................................................................................................ 91
79 7.000e-15UniRef50_UPI000D73B63D hypothetical protein n=1 Tax=Blautia sp. BCRC 81119 TaxID=2212480 RepID=UPI000D73B63D  ali  34  1........................................................................................MRYYSTQRPLVPGGCPR---AGVQKVHNYDEKEFCEEIGREAWGYVDYDRELTNEEVEDYELLPAG..................................................................................................... 63
80 9.000e-15UniRef50_A0A2P8EL11 Uncharacterized protein n=1 Tax=Fusobacterium naviforme TaxID=77917 RepID=A0A2P8EL11_9FUSO  ali  27  1.......................................................................................MTRYYSIMRPVGPGTFPK---DGVVMIQNYDSRQYVEEIGREAWGCIDYTRELDKKEAESYELVKAKTAQEKLNDLFEELVPASGAAE................................................................................ 85
81 9.000e-15UniRef50_H1CBZ7 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium 7_1_58FAA TaxID=658087 RepID=H1CBZ7_9FIRM  ali  36  1........................................................................................MRYFSTQRPVAPGAFPKPADNKVLAVDNFDTRKLCPAIGLEAYGYIDYEKPLTAEQSADYELIPQK..................................................................................................... 69
82 9.000e-15UniRef50_D1YIX5 Uncharacterized protein n=2 Tax=Lactobacillus gasseri TaxID=1596 RepID=D1YIX5_LACGS  ali  26  531.........................YNSKIDIKYSTFTPDIKKKISSYF--------DKQFPTMKQKIRQL--SQGNEKVVENEKTKIYRYYSPFRPINPGTYPMKNF-KPLKVENFDERKDV-GGNVKAWGYVEYLNKLSLEEQQNYDLIDEKPIKVAQAIQE........................................................................................... 657
83 1.000e-14UniRef50_A0A1Y4H9H9 Uncharacterized protein n=1 Tax=Anaerofilum sp. An201 TaxID=1965588 RepID=A0A1Y4H9H9_9FIRM  ali  32  1...................................................................................................MGATPDTKDNPLVEVVNYDRRRPVAGGKIHAWGEAIYKKPLTGKQVRDYELTPAPDNPDRKRSITARLKGAAKGQEPPKEPGQKRNHKTHEDR............................................................... 96
84 5.000e-14UniRef50_A0A0U3E7T2 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A0U3E7T2_EUBLI  ali  29  5...ENKGYQITDSIQVGN-TAFVIGHSESLPYPYVVWKKTEGQG---YDYGHYKNHRQEAVEDLCRRALKELKIQRNKEMRKPRKEQAENE.................................................................................................................................................................... 88
85 5.000e-14UniRef50_R9LCB4 Uncharacterized protein (Fragment) n=3 Tax=Clostridiales TaxID=186802 RepID=R9LCB4_9FIRM  ali  23  1......................................................................................SMFRYYITQESLDVGTYPLMDGKTITELAAWVK---VEQDSITAFGCIDYPQPLTAEQEREYALLPASQNPQALDSIGHAAEAAQLPDAPEQTLDE------YPMPDPAMREDDL...................................................... 106
86 2.000e-13UniRef50_A0A1V5KAU2 Uncharacterized protein n=1 Tax=Firmicutes bacterium ADurb.Bin506 TaxID=1852895 RepID=A0A1V5KAU2_9FIRM  ali  24  1.......................................................................................MYRYYSTQRPVAPGTFP----GKPAELGNYGTNGVDFDRLGHVWGWLDYTEELAPEQASAYELTPAGATPRYYPRLAKHMNSFSDYVAGHATAEYRRQL----DEAAYI........................................................... 107
87 3.000e-13UniRef50_A0A2K4ZGQ9 Uncharacterized protein n=1 Tax=Acetatifactor muris TaxID=879566 RepID=A0A2K4ZGQ9_9FIRM  ali  35  3.........................................................................................KYYSTQRPVSPGTFSREGAGR---IVNFDNKQFCEEIGRDAWGYIEHEEPLSAAQMEAYELT........................................................................................................ 61
88 3.000e-13UniRef50_R7PE48 Uncharacterized protein n=1 Tax=Clostridium clostridioforme CAG:511 TaxID=1263066 RepID=R7PE48_9CLOT  ali  45  1..................................................................................................................................................................MDALAQTVGPWEDMRQFPEGRRLTEWSSEAGAYVPKAKATVEKL---VECTESIRVQRVLLAGDKQPSIRDQLKTAQREAQEHRAPDGPKK.. 88
89 4.000e-13UniRef50_H1AKQ9 Uncharacterized protein n=1 Tax=Coprobacillus sp. 8_2_54BFAA TaxID=469597 RepID=H1AKQ9_9FIRM  ali  18  157..EKNIGFEVIDEFTCGNETVVLAMKDKPYHREFVTW-RTTPDRKRGYDIGNYFTSPRNAFSDFRKRSQSIFERHFDRKRSKFKIRFRKEEMER................................................................................................................................................................. 247
90 4.000e-13UniRef50_R6NPF7 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:41 TaxID=1263021 RepID=R6NPF7_9FIRM  ali  29  200..EIVKGYYITDSVTLNDDT-FVMGYNPNAPEPYVTW---LKSGDNSYSMGHYFDNELKAKCNLLERAEKNLDYVKDGFEGQAIEPKDYEFYKTL................................................................................................................................................................ 297
91 8.000e-13UniRef50_UPI0009BE55BF hypothetical protein n=1 Tax=Lactobacillus crispatus TaxID=47770 RepID=UPI0009BE55BF  ali  34  71.............................................................................KRLGYELPKTVYRYYSTQRPVNIHTYPSR--MNVLNIKNYDNRLSVE--GLKAWGYIEFDAPLTDDEKLDYDLYVNGEDEERV............................................................................................... 149
92 1.000e-12UniRef50_A0A1Q6TB23 Uncharacterized protein n=1 Tax=Ruminococcus sp. 37_24 TaxID=1897019 RepID=A0A1Q6TB23_9FIRM  ali  38  4..KINKGYIITDSVHVGD-TEFVLGVSMHEPNQFVTWECKDGK---EYNWGHYTDN....................................................................................................................................................................................................... 53
93 2.000e-12UniRef50_A0A1C2D7Z5 Uncharacterized protein n=1 Tax=Lactobacillus crispatus TaxID=47770 RepID=A0A1C2D7Z5_9LACO  ali  34  6.............................................................................KRLGYELPKTVYRYYSTQRPVNIHTYPSR--MNVLNIKNYDNRLSVE--GLKAWGYIEFDAPLTDDEKLDYDLYVNGEDEERV............................................................................................... 84
94 3.000e-12UniRef50_G8TV70 Uncharacterized protein n=1 Tax=Sulfobacillus acidophilus (strain ATCC 700253 / DSM 10332 / NAL) TaxID=679936 RepID=G8TV70_SULAD  ali  35  15.............TVLGMAVELVLAERPGTPQPFVTWIRNPHTG--DYVWGHYFRTLEEARKDFAERLASY........................................................................................................................................................................................ 70
95 3.000e-12UniRef50_UPI0005D265F9 hypothetical protein n=1 Tax=Lachnospiraceae bacterium MC2017 TaxID=1408324 RepID=UPI0005D265F9  ali  23  1........................................................................................MKKYYLRRPVDIGTCPKGF----ISFKNYDDLTYVSEVGRNCWGEVTYDRELRKEEIDRYELYPAPTYPLVDEAEQEMVRSMTGKELEQYLEYAKQLQK.................................................................... 96
96 4.000e-12UniRef50_G1VUJ7 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=G1VUJ7_9FIRM  ali  30  96...MNGKYTIINKVVTGTGFNVVLGINENHPYRYVTWTQND----RGYDVGHYFGNLKEAQADMLERASNELNI..................................................................................................................................................................................... 165
97 4.000e-12UniRef50_R9JW08 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=R9JW08_9FIRM  ali  30  4...........................................................................NNYIRQSAQKYHWNKYYSVMRPVSIGTHPK---NGLMDFINYDTRTEVS--GRMVWAELFYNRELTQKELEDFEMI........................................................................................................ 74
98 1.000e-11UniRef50_F8I433 Uncharacterized protein n=1 Tax=Sulfobacillus acidophilus (strain TPY) TaxID=1051632 RepID=F8I433_SULAT  ali  36  1..............MLGMAVELVLAERPGTPQPFVTWIRNPHTG--DYVWGHYFRTLEEARKDFAERLASY........................................................................................................................................................................................ 55
99 1.000e-11UniRef50_K1U6X1 Uncharacterized protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1U6X1_9ZZZZ  ali  35  2...........................................................................................................................ENGSFLAWGYLTYTRPLTEKQASDYELRPAPDNPDRPRPIAEQMKNAAKLAEADRGSEAPAPQRRQPDRG.............................................................. 71
100 1.000e-11UniRef50_N2AH87 Uncharacterized protein n=1 Tax=Eubacterium plexicaudatum ASF492 TaxID=1235802 RepID=N2AH87_9FIRM  ali  22  437......................................................DDLIAAMPEAEVIRPEPEKQPKPEHPAPEPIETPYRYYITQDALNTGTYPLMED---VHIQEEPRITDYENGAVQAYGFIEYPQPLTRGQIAASGLLPADSAFMQEEKL............................................................................................ 542
101 1.000e-11UniRef50_G4KUJ6 Uncharacterized protein n=1 Tax=Oscillibacter valericigenes (strain DSM 18026 / NBRC 101213 / Sjm18-20) TaxID=693746 RepID=G4KUJ6_OSC  ali  46  1.MDKNQGYAILKAIMLENGRGFALGEHLTAPSPYVTWACYDEKGQRQY............................................................................................................................................................................................................... 48
102 4.000e-11UniRef50_K1LYI5 Uncharacterized protein n=2 Tax=Lactobacillus TaxID=1578 RepID=K1LYI5_9LACO  ali  38  1..............................................................................MEEQNTNAMSYRYYSTERPINPGTFPTNR-QRPVKIVNFGTRQNI--GGIKAWGYLEYLKPLSDDDQFTYDLV........................................................................................................ 70
103 6.000e-11UniRef50_A0A162IQH9 Uncharacterized protein n=2 Tax=Fusobacterium necrophorum TaxID=859 RepID=A0A162IQH9_9FUSO  ali  34  41.......................................................................................MYKYYSYLRPIAPLTYPKE---NLISFQNYEKKEYVKAINRAAWGELIYSEKLSEETLKEYELL........................................................................................................ 101
104 1.000e-10UniRef50_A0A1F8V4T2 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWF2_38_85 TaxID=1797683 RepID=A0A1F8V4T2_9FIRM  ali  26  205.....GNYEIIERIEVGQKV-YGLGFREGAVQPYGTWQ-GWKNSNRGFDAGHYFSDVETAKADLHDRAAKEQERIDRPKRREEGAR......................................................................................................................................................................... 283
105 2.000e-10UniRef50_UPI0007882B04 hypothetical protein n=3 Tax=Fusobacterium necrophorum TaxID=859 RepID=UPI0007882B04  ali  32  2.......................................................................................MYKYYSYLRPIAPLTYPKE---NLISFKNYDKKTFIESINRAAWGELIYSEKLSEKALKEYELL........................................................................................................ 62
106 3.000e-10UniRef50_A0A2Y9B3M4 Uncharacterized protein n=1 Tax=Clostridium innocuum TaxID=1522 RepID=A0A2Y9B3M4_CLOIN  ali  31  1........................................................................................MKYYSRLRPLTPGTYPEG---NIKEIKDYGERIYITDIGYEAWGYIDYDGEISDNEARRYDLISEE..................................................................................................... 63
107 6.000e-10UniRef50_I0GQL8 Uncharacterized protein n=4 Tax=Selenomonas TaxID=970 RepID=I0GQL8_SELRL  ali  25  294...................................SWIAVLKDNPDELY--------KAAEQ--AEKAVDYIKEHMLEKKKVAEERSEYKYYLDQRPVSIGAVPNG------------FIRFDEEDKGGRYGAIYYGGKLTDKQVADYELRPAKQEKSVVRKLNPKEKLAAEIREDKAAA........................................................................... 419
108 2.000e-09UniRef50_A0A0F9C016 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9C016_9ZZZZ  ali  25  20........ILLESATKDRETLIVLYELPGGGPSYVTWAAR-RDSPEDTYWGHYFATLQEAQDDFEKR............................................................................................................................................................................................ 77
109 3.000e-09UniRef50_A0A1Q6JG63 Uncharacterized protein n=1 Tax=Clostridiales bacterium 41_21_two_genomes TaxID=1897044 RepID=A0A1Q6JG63_9FIRM  ali  22  1........................................................................................MKYFSLSRPIVPGGYPK--VAKVIEVINFDTPIIQPEIGHTVWGTIEFDTEIPAEDAKAYELIADKKQE.................................................................................................. 67
110 9.000e-09UniRef50_A0A1C7GS10 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C7GS10_9FIRM  ali  20  6.................................................................................................................ITELAAPVKVEQDSITAFGCIDYPQPLTAEQEREYALLPASQNLRALDSIGHAAEAAQLPDAPEQALDE------YPMPDPLLREDDL...................................................... 87
111 2.000e-08UniRef50_A0A0S8KYB8 Uncharacterized protein n=1 Tax=Acidithiobacillales bacterium SM1_46 TaxID=1703384 RepID=A0A0S8KYB8_9PROT  ali  28  8...KNGSTEI---ARVERGSSIYVAAHTGGVQPYATWAM-DKDGHT--YWGHYFDTEQQAISDLKERAS.......................................................................................................................................................................................... 67
112 3.000e-08UniRef50_UPI000C786805 hypothetical protein n=1 Tax=Clostridium sp. SN20 TaxID=1776383 RepID=UPI000C786805  ali  43  5........................................................................................................................................................VHDAPALRQRIEKQTELVGKWEDARRVPDQKRLTWFYPDFGCYVLNYYVTAERLDAAAKEVERQKALAAERRRSRKQHERQE..................... 86
113 5.000e-08UniRef50_A0A1C6K721 Uncharacterized protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6K721_9CLOT  ali  35  3............................................................................................................................DGRLMAWGELTYAKPLTEKQMEDYELKPAPGNPDRVRPITARLKDETRGQEPPKEPGQKRNHKNHEER............................................................... 71
114 4.000e-07UniRef50_A0A1M6HJL8 Uncharacterized protein n=1 Tax=Propionispora hippei DSM 15287 TaxID=1123003 RepID=A0A1M6HJL8_9FIRM  ali  30  1......................................................................................MLHRYYLTQRPVSIGTQPKGFFSDPGELPN----------GITYYGHVDYDRDLTDQEVKEYELYDGGKNFNALD.............................................................................................. 68
115 4.000e-07UniRef50_UPI000496F4B6 DUF1738 domain-containing protein n=1 Tax=Selenomonas ruminantium TaxID=971 RepID=UPI000496F4B6  ali  30  120.................................................................................ETVYQKEYKYYMDMRPVSPGAVPKG------------FIRFDEDDFGGRYGAIYYRGKLTDKQVADYELIPA...................................................................................................... 179
116 7.000e-07UniRef50_R6GXX6 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:137 TaxID=1263004 RepID=R6GXX6_9FIRM  ali  49  22....................................................................................................................................................................EQADQIGRWEKQHRVPERKRLTWFYPDFGVYVPNDWVTPEEVAKKFEEITGKK...................................... 74
117 1.000e-06UniRef50_UPI00031BBEE7 hypothetical protein n=1 Tax=Peptoniphilus grossensis TaxID=1465756 RepID=UPI00031BBEE7  ali  27  2......................................................................................KQFIYGMRLRPFSVGTFPKKGFIELVEIEDYIDKDKLE---RDYWDFLIYGEELTEEAKSDYDL......................................................................................................... 63
118 1.000e-06UniRef50_D4CPM4 Uncharacterized protein n=3 Tax=Oribacterium TaxID=265975 RepID=D4CPM4_9FIRM  ali  26  4........................................................................................YKYYTLRRPPAPGAIPME---GIFHVRDFNGCKLCKRIMNTAWGLALYTRRLEPEEIRQYELAYGGKVEEAR............................................................................................... 72
119 3.000e-06UniRef50_A0A2B5Q4F1 Uncharacterized protein n=2 Tax=Bacillus cereus group TaxID=86661 RepID=A0A2B5Q4F1_BACMY  ali  25  65............................................................IDEIKVKLTSLDNILSIKESIESGKKKLYWYTYRLRGFSLGAQPK------------DFIVNDERIGR--FGAIIYERELTKKEMSDYEL......................................................................................................... 140
120 3.000e-06UniRef50_A0A1H6GBY6 Antirestriction protein ArdC n=1 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1H6GBY6_SELRU  ali  21  295....................................WVSVLKDNPDELY--KAAEQAEKAVTYIKEHMLEKYKESKAQVQAVAEETEEYKYYMDMRPVSPGAVPKG------------FIRFDEDDFGGRYGAIYYRGKLTDKQVADYELIPA...................................................................................................... 402
121 3.000e-06UniRef50_A0A136Q3K7 Uncharacterized protein n=1 Tax=Christensenella minuta TaxID=626937 RepID=A0A136Q3K7_9FIRM  ali  51  2..........................NSKAPQPYVTWQFR-RSTPREYFWGHYYTDKSAAHKDY............................................................................................................................................................................................... 38
122 1.000e-05UniRef50_E0M484 Uncharacterized protein n=6 Tax=Pantoea TaxID=53335 RepID=E0M484_9GAMM  ali  22  404...................................................................................TPAAVWRYALVNRPVGIGAVPPEYASQPAEGQPYS--------GVARNGIISYDRPLTDKEIADFELIPTHTDLDELAVNAAQYLEMSSEDPDTYAKQVRMVARKNLTGVAYPEGEDLT..................................................... 527
123 3.000e-05UniRef50_UPI000C83998E ImmA/IrrE family metallo-endopeptidase n=2 Tax=Erysipelotrichaceae TaxID=128827 RepID=UPI000C83998E  ali  25  503..........................................................................QQLSVAENTEKPKEYRYQCNHRPPGPGAVPREGL------------EYCDDEGSGRYGDVVYNRPLTEKELKSFELDPVKSMKREVR.............................................................................................. 577
124 3.000e-05UniRef50_I0GRX1 Uncharacterized protein n=1 Tax=Selenomonas ruminantium subsp. lactilytica (strain NBRC 103574 / TAM6421) TaxID=927704 RepID=I0GRX1_S  ali  31  2......................................................................................KAYKYYLRERPLSPGALPK-------DFVGYVGSDTVGG----RYGAVYYERKLTAKEIKDYELGVSFEVEDTIESVKARVSAGEK................................................................................... 77
125 9.000e-05UniRef50_UPI000C228533 hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI000C228533  ali  30  4........................................................................................YWYELTLRGVSPGAYPRGAFTTEINHVNYKGKD---------YGAVAYIEPLSAEQIDNYELYPPRELYDYERKI............................................................................................ 72

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.