current user: public

If you have questions about the server, please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
11 2.000e-25UniRef50_A0A1I5E1Z1 Transposase DDE domain-containing protein (Fragment) n=2 Tax=Proteiniclasticum ruminis TaxID=398199 RepID=A0A1I5E1Z1_9CLOT  ali  45  87LTHLHSKKKESIAQEIFAKMTMYNFCSIITSYVVIQKKDRKHNYQVNFSRAISICKHYFKENNAFLDICKLIQKYILPIRRERAFPRQIKFRTFVSFNYRIA 188
15 1.000e-23UniRef50_A0A1T4V4F3 Transposase DDE domain-containing protein n=1 Tax=Eubacterium uniforme TaxID=39495 RepID=A0A1T4V4F3_9FIRM  ali  45  334LNKFHSKKVDHIHQEIFAKVIMYNFCSTITMHVAHKVQKKKHSYQINFSRAIKECKYFFSCKIDPPDVENIIQKYMLPIRLGRTNPRKVKIREKTTFLYR.. 435
32 2.000e-21UniRef50_UPI000A30709C hypothetical protein n=1 Tax=Hungatella hathewayi TaxID=154046 RepID=UPI000A30709C  ali  55  24LLHFHAKKVEYICQEIFARMIMYNFTEMIISHVIIENKSRKHAYQANFSTAAHICRQYFRGNVPPPTVETLIARLILPIRPGRSVPRNLSPKKANQFL.... 121
35 3.000e-21UniRef50_A0A1I7IM00 Transposase DDE domain-containing protein n=1 Tax=Butyrivibrio sp. INlla21 TaxID=1520811 RepID=A0A1I7IM00_9FIRM  ali  46  330..NFHAKKDEFILQEIYARLIMYNYCAAIVMSVSIPHVKSRYSYKINFTNAVYLIMMSFRNTDNRPTLETDIQSYIIPVRPGRKDERNLKPKSAIYFMYRVA 434
44 1.000e-20UniRef50_A0A1I5KK33 Transposase DDE domain-containing protein (Fragment) n=2 Tax=Acidaminococcus fermentans TaxID=905 RepID=A0A1I5KK33_ACIFE  ali  35  232..QFHSKQDEFVRQELYAHLVMYNIVSACGNCVELPEKSTKHEYALDFKMAVTIVRSFFRQNISFFRLCEEMSKYTQPVRQGRKDLRKLRPKSPIYFIYRVA 332
57 1.000e-19UniRef50_A0A1Q6L1W2 Uncharacterized protein n=1 Tax=Clostridiales bacterium 36_14 TaxID=1897042 RepID=A0A1Q6L1W2_9FIRM  ali  44  335LLFFHSRKKDLVIQEIYAKLILYNFYELITGAIVVEKKDRKYSYRINFSIAIAICTEFLRRSCASPDVIALIGRELIAVRPDRRNPRYLRARTATTFQYR.. 436
61 1.000e-19UniRef50_UPI000BA3A96D IS4 family transposase n=1 Tax=Endozoicomonas ascidiicola TaxID=1698521 RepID=UPI000BA3A96D  ali  17  182MDILRCKTPEMLRKEIYVHLLVYNLIRGLMAKATEAEGHK--PREMSFKTAQDTLRSYHHLLLLLETMVQLIGKHKVGNRPGRSEPRAVKRRSKPS...... 283
66 3.000e-19UniRef50_UPI00068862D7 IS4/IS5 family transposase n=1 Tax=Ruminococcaceae bacterium AB4001 TaxID=1410638 RepID=UPI00068862D7  ali  38  61..NFHSKKDEFIDMEIYAHIIMYNVVSACVNQVNVVHKKL---YAVDFKMACHIVRHFFHRQKPLECIYDEISKYIQPVRTGRTDQRKVKTKPPVWFVYRVA 159
79 1.000e-18UniRef50_A0A292RV79 Uncharacterized protein n=1 Tax=Candidatus Gastranaerophilales bacterium HUM_10 TaxID=1916229 RepID=A0A292RV79_9BACT  ali  39  329MMSFHSKKRNFIQQEIYAAILLHCLTNIITERIEVEQDKRKHHYKVNLSTAVTNMRLWLRKIICTKEMIKRIKKYLAPVRPDRKYQRNMKPKSAIPFN.... 427
94 6.000e-18UniRef50_S6GI55 Uncharacterized protein n=1 Tax=Osedax symbiont Rs1 TaxID=1330036 RepID=S6GI55_9GAMM  ali  15  339MNILSCKSPAMCKKEIWVYFLANNLIRLVMAQAA--QNKNLKPRELSFKHAVQIWNTYLLGKEINADMFALIAERKVGNRPGRLEPRAVKRRPKPY...... 433
96 7.000e-18UniRef50_A0A128F8D3 Transposase DDE domain protein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A128F8D3_9GAMM  ali  17  224..TLRSKTPALVKQELWGMLLAYNLLRFMMCQMAYSL-NTVMPYQIGFKQASIFLVSQLQMLPRYPEVLRYIESFVLPERRERTYPRAVKKRPSRY...... 325
97 7.000e-18UniRef50_A0A127MYH9 Transposase DDE domain protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A127MYH9_9PSED  ali  18  216..TLRSKTPEMIAQELWGVLLGYNLLRYQMVQMSRQCPG-VYPCEMSFTACSWAILGLLHLPGFLADLQASAAQYVLPHRPDRWFPRTVKQRPAKY...... 318
101 1.000e-17UniRef50_A0A2A4WFG0 Uncharacterized protein n=1 Tax=Piscirickettsiaceae bacterium TaxID=2030828 RepID=A0A2A4WFG0_9GAMM  ali  21  207MDILRCKTPDMIRKEILMHLIAYNCIRCLMRGVAAKHKVEQS--QISFKGTIQALRQWEPCLGLIQLLYDVIAEKVIRLRPGRREPRAIKRRPKNY...... 311
105 1.000e-17UniRef50_X0XW32 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0XW32_9ZZZZ  ali  18  128MDILRCKTPEMVHKEIWTHLLAYNLLRTVMAVAANEND--IEPRKVSFKGAKQALTAFAPRGPLIDAMLTTIAYHHVGDRPGRWEPRARKRRPKK....... 229
108 2.000e-17UniRef50_A0A225DT37 Mobile element protein n=1 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225DT37_9BACT  ali  16  304MDHLRCEEPDRVRNEFFVHLLAYNLIRQVMAVAAAKAGRE--PWAVSFTGTLQTRNRFLPLLVWCEALLDAIAAHEVGNRPDRNEPRVRKRRPKQYPL.... 406
111 2.000e-17UniRef50_UPI000704D5C2 IS4/IS5 family transposase n=1 Tax=Lactobacillus gigeriorum TaxID=1203069 RepID=UPI000704D5C2  ali  35  89..QFHSKKDQFVYMELYAHFAMYNAISLSMGLSQHTKGKGKHQYKLDFKMACCAFKQRFSSNDNSDEMLVNIAYYLTPIRLGRKDKRNMKAKMVIGFPYRLA 192
112 2.000e-17UniRef50_A0A257QJK1 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 21-51-4 TaxID=1970609 RepID=A0A257QJK1_9BACT  ali  19  334MDILRCQTPPMVENELWMHMIAYNLVRAVMSEAAMAHSVPGDR--ISFKGTLSTLRQWATRLALYSWMLAYIARDLLPYRPGRNEPRARKRRPKAY...... 438
118 3.000e-17UniRef50_A0A2A2QY58 Uncharacterized protein n=1 Tax=Verrucomicrobiae bacterium Tous-C4TDCM TaxID=1982332 RepID=A0A2A2QY58_9BACT  ali  23  301MDVLRCQTPDMVDKEVMMHSIAYNLVRAIMQQAA--NDHQVDLTRISFKGTADALRHWRRQKAMLDAMLELIAKDLVPLRPDREEPRARKRRPKNYHL.... 407
119 4.000e-17UniRef50_UPI0008353403 IS4 family transposase n=1 Tax=Roseimaritima ulvae TaxID=980254 RepID=UPI0008353403  ali  20  342MEHLRCKSPQMVRKEIHCHMIGFNLVRAAMLASALKHGLC--PTTLSFKGAMQALEEFAACLRLWDNLLETISELSVGDRPGRKEERVIKRRPKNY...... 443
122 5.000e-17UniRef50_UPI000B4B9D81 IS4 family transposase n=1 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=UPI000B4B9D81  ali  16  476MDHLRCEEPDRVRNEFFVHLLAYNLIRQVMAVAAAKAGRE--PWAVSFTGTLQTRNRFLPLLVWCEALLDAIAAHEVGNRPDRNEPRVRKRRPKQYPL.... 578
124 6.000e-17UniRef50_A0A167C8V8 Uncharacterized protein (Fragment) n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A167C8V8_9GAMM  ali  18  150..TLRSKKPDMIAQELWGVLLSYNLLRYQMVKM-AQTKQGIYAKHLSFTTCAISIINLIQTMFIEEQLQAQVEHHILPIKRERAYPRCVKPKPSKYPN.... 253
125 6.000e-17UniRef50_A0A254VT28 Uncharacterized protein (Fragment) n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254VT28_9CYAN  ali  17  72MDHLRCKSPQRVRNEIWIHLLGYNLIRGVMAQAAAASQRE--PWEVSFTGALQTLGSFLPLLAWLQAFLQAISTHRVGNRPDRFEPRVKKRRPK........ 170
126 7.000e-17UniRef50_A0A0F9EBI8 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9EBI8_9ZZZZ  ali  18  352MDVLRCKTPEMVRKEIWACLLAYNSIRKTMLQAAMESG--LSPRQLSFANAMQTMAASWVVLPTLDHIVSQLASLTSPIRPNRIEPRAVKRRPKP....... 453
129 8.000e-17UniRef50_A0A2S8G8F2 Uncharacterized protein n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8G8F2_9PLAN  ali  19  3MDDLRCQTPAMVRQEIHCHLIGYNIVRAAMIASALKFQCC--PTKLSFTGALQAIDQFARYLEPWECVLQTISELTVGNRPNRKEPRQIKRRPKPY...... 104
134 1.000e-16UniRef50_E0S4G6 Transposase IS4 family n=2 Tax=Butyrivibrio proteoclasticus (strain ATCC 51982 / DSM 14932 / B316) TaxID=515622 RepID=E0S4G6_BUTPB :_  ali  31  349..NFHSKKDKFILQELYAHLIMFNATARVAAHIPVEYSEKGYTYAVDFKMVVYIFRKYFRSKDPPEDMYADMKQYRHMLKDGKHNIRLLKPKSAVYFTYRVA 450
138 2.000e-16UniRef50_A0A0K2L730 Transposase n=13 Tax=Piscirickettsia salmonis TaxID=1238 RepID=A0A0K2L730_PISSA  ali  20  159MDHLRSKTPDMLHKEIAVHFLAYNLIRTLIAEAC--RNTERLPIQVSFKGVIQLFNSFVSLLSFSADLLHAIIKNKVGNRPGRIEPRAVKKRPK........ 257
139 2.000e-16UniRef50_UPI0009463F10 IS4 family transposase n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI0009463F10  ali  18  342MEHLRCKKPHRVRNELRAHLLAYNLVRQTMAEAAI--GADVQPCQISFKSTLNALSETLPILQLCDTLLECCRQHQVGNRPDRYEPRVKKRRAKSYPQYRL. 454
142 2.000e-16UniRef50_UPI0009BE8543 hypothetical protein n=1 Tax=Lactobacillus delbrueckii TaxID=1584 RepID=UPI0009BE8543  ali  28  59...FHSKKPAFQEIELYSQLIMFNVVNRIISLCRVADAHRKWPHEIDFKEAANIVHRYYTTKDDPKQMIEEIEAYHHPVRKGRKYPRPLRFQGSVGLNYRIS 159
144 2.000e-16UniRef50_A0A2V2S344 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2S344_9BACT  ali  20  343MEVLHCKSPQMLHKELEMFFIAYNLIRGLMVQAGTINDVELDRMSFKFSLAIAQAHSKSQQQQLITELLEVIARDEVPERPNRREPRAVKRRPKPHPL.... 448
146 2.000e-16UniRef50_A0A1Q7VDF6 Uncharacterized protein (Fragment) n=1 Tax=Cyanobacteria bacterium 13_1_40CM_2_61_4 TaxID=1805101 RepID=A0A1Q7VDF6_9CYAN  ali  17  330MDIVRGKTPSMVRKELWMYVLVYNLIRGVMATAAVHAGLV--PRMLSFTGALQAVNVFSARPALLEALYGTISAHRVGQRPDRVEPRAVKRRPKPHPL.... 434
147 2.000e-16UniRef50_B9XCY0 Transposase IS4 family protein n=1 Tax=Pedosphaera parvula (strain Ellin514) TaxID=320771 RepID=B9XCY0_PEDPL  ali  15  348LEVLRCQSPAMVEKEVWMHLIAFNLLRRVMLQSAASGDSDV--RHLSFKGALATVRQYCPAMALIERLREVIAQDVLPLRPGRREPRAVKRRPKPY...... 451
152 3.000e-16UniRef50_A0A0K2L377 Uncharacterized protein n=12 Tax=Piscirickettsia salmonis TaxID=1238 RepID=A0A0K2L377_PISSA  ali  20  35MDHLRSKTPDMVHKEIAVHFLAYNLIRTLIAEAC--RNTERLPIQVSFKGVIQLFNSFVSLLSFSADLLHAIIKNKVGNRPGRIEPRAVKKRPK........ 133
153 3.000e-16UniRef50_P03835 Transposase InsG for insertion sequence element IS4 n=1364 Tax=root TaxID=1 RepID=INSG_ECOLI  ali  20  330..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMVMRMLMTLQRIPELMRDLASMKLPTRRERAFPRVVKERPWKYPT.... 433
154 3.000e-16UniRef50_A0A1C4G3G9 Uncharacterized protein (Fragment) n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1C4G3G9_9ENTR  ali  18  4..TLRSRKPELVEQELWGVVLAYNQLRFMMTQMACSLKG-VEPYQIGFKQASLYLTAQLSILKLIKEILDMAESFVLPPRRVRHYPRAVKKKPQRY...... 105
155 4.000e-16UniRef50_UPI000B5A698A IS4 family transposase n=4 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A698A  ali  14  332...LTCRTAEMIKKELSVHLLAYNLTRLLMNEAAT--LCGCEPRSISFRHTVQLWSAWSLSGCQLDQLLKAIASRRVGNRPGRKEPRAVKRRPKPRPL.... 429
158 5.000e-16UniRef50_A0A1Z4LT69 Putative transposase, IS4 family n=1 Tax=Calothrix parasitica NIES-267 TaxID=1973488 RepID=A0A1Z4LT69_9CYAN  ali  21  198MDVLRGKTPSLARKEIWAFLIAYNLLRTLIFSSANS-SFQVSPLKLSLQGTRHHFNNFIPKLIIYQTLLKILIHKEIPQRPGRCEPRVRKRRPKAYPL.... 303
159 5.000e-16UniRef50_X0VZ79 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0VZ79_9ZZZZ  ali  21  27LDHVRCKTPDMVRRELWVTLLAYNLVRKLIA--TAAAVHAKQPRQLGFTLACQTILASWMLLRDVPQLLKRIAKNEVANRPGRIEPRMLKRRRHRYPL.... 131
160 5.000e-16UniRef50_A0A1V6F0L1 Transposase DDE domain protein n=1 Tax=Candidatus Hydrogenedentes bacterium ADurb.Bin101 TaxID=1852847 RepID=A0A1V6F0L1_9BACT  ali  19  35MDVLRCKTPDMVDKELYMHLIAYNLVRALMLQAATKKQ--VSPLQLSFKGTVATVRQWAPLMVSFDAMLNAIVRDPVPERPDRAEPRARKRRPKNY...... 139
161 5.000e-16UniRef50_D8FN60 Uncharacterized protein n=1 Tax=Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4 TaxID=784613 RepID=D8FN60_LACDE  ali  28  161..QFHSKKDEFVKMELYAHLIAYNVIMSMVNQAYAPHPKSKSDYQINLSMAFFSAHYLLGLKKDYGELLYIISMYIGMTRPNRSYNRNIHSRSAVVFNYRL. 264
163 6.000e-16UniRef50_UPI0004071C2B hypothetical protein n=1 Tax=Pseudoalteromonas sp. TB64 TaxID=1938600 RepID=UPI0004071C2B  ali  20  11..TLRSKKPEMIAQELWGVMLSYNLLRYQMVKMAQKKSGIYAKHLSFTTCAISIINLIHRIPKSIEQLQAQVEHHILPIKRERAYPRCVKPKPSKYPN.... 114
166 1.000e-15UniRef50_A0A2T6DF78 IS4 family transposase n=1 Tax=Spartobacteria bacterium LR76 TaxID=2161866 RepID=A0A2T6DF78_9BACT  ali  20  358MDVLSCKSPDMVEKEILIRLISYNLIRAFMQRAAHLYHAPLER--LSFKGSLDTARHFRRQDALIAEMLAAMASDHVPIRPGRSEPRAKKRRPKNY...... 462
169 2.000e-15UniRef50_W4LA71 Uncharacterized protein n=1 Tax=Candidatus Entotheonella gemina TaxID=1429439 RepID=W4LA71_9BACT  ali  17  276MDILRCESPAMVRKEIDVHLLVYNMIRALMARAAIKIGAS--PRKVSFKAAHDSLQSFHILLLLLEHMAEIIGEHGVGNRPGRREPRANKRRPRP....... 377
178 3.000e-15UniRef50_A0A2V5NCY4 IS4 family transposase n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5NCY4_9BACT  ali  19  370MDVLRGRSPEMAHKELYIRLIAHNLIRCTVAQAATEHRVELER--ISFKGSLDALRHFSQAMALWAELLSTLAADLVPERPGRREPRAVKRKKNKYP..... 473
179 3.000e-15UniRef50_UPI000A04C86A IS4 family transposase n=2 Tax=Methylomicrobium buryatense TaxID=95641 RepID=UPI000A04C86A  ali  19  362MEPLRCKTPAMARKELTVCLLAYNLIRLLMLQAGIR--HHVWPCRISFTEALGSYKEFASSLAWINNVLEIVASKTIGEREARIEPRAVKRRPTNPFPY... 467
181 3.000e-15UniRef50_A0A0F9VT03 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9VT03_9ZZZZ  ali  18  52MDVLRCKTPDMVTKEILMYLIAYNAIRLLMNNAGKSAN--VARRQISFKASVQALRQWEPALRLMAALYEAIIGNLLIERPGRQEPRYVKRRPKPY...... 156
182 3.000e-15UniRef50_X0TTH4 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0TTH4_9ZZZZ  ali  19  191MEVLRGKSADVVRKEIAMHLLAYNLIRGLMWQAADRHGRPLHR--MSFAGTMERLRAMQPYLQLYELLLRWIAADAVPSRPNRTEPRAVKRRPK........ 292
185 3.000e-15UniRef50_A0A2I0NVW1 IS4 family transposase (Fragment) n=1 Tax=Methanomicrobiales archaeon HGW-Methanomicrobiales-5 TaxID=2013821 RepID=A0A2I0NVW1_9EU  ali  20  351MDILRCKTPDMVCKEIAAHWLGYNLIRAVMGEAAKPEGLPLRRSFAAARRASAQFQENLRQLASEARLLQSIAHWRVPDRPGRIEPRAIKRRPKP....... 453
186 3.000e-15UniRef50_C4Z764 Uncharacterized protein n=11 Tax=Firmicutes TaxID=1239 RepID=C4Z764_EUBE2  ali  39  142LINWHSSKYDGILQEINAHMILYNFCELVTSHAMVKKKNAKHVYKINFAIAANICRAYLKHSGNETETMLLIQKYLTPVRYNRKYP................ 228
187 3.000e-15UniRef50_UPI0009B955F1 hypothetical protein n=1 Tax=Lactobacillus delbrueckii TaxID=1584 RepID=UPI0009B955F1  ali  29  155...FHSKKPAFQEIELYSQLIMFNVVNRIISLCRIADAHRKWPHEIDFKEAANIVHRYYRTPMISKQMIEEIEAYHHPVRKGRKYPRPLRFQGSVSLNYRI. 254
188 4.000e-15UniRef50_UPI000B35257D hypothetical protein n=1 Tax=Lactobacillus salivarius TaxID=1624 RepID=UPI000B35257D  ali  32  124..QFHSKKDDFVYMEIYAGLTLFNMVSSISEQASIDKEKRKHKHRINFKMACCIVRKFCPRTYDYDQLLFEIKQYIVPIRINRNKKRERVNKNSRSFNARL. 225
189 4.000e-15UniRef50_A0A285J1C4 Uncharacterized protein (Fragment) n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A285J1C4_9GAMM  ali  19  2..TLRSKKPELVRQELWGVVLAYNLLRFMMAQMAYSLKG-VEPYQMSFKQSALYLRSHLSLLRIMEEIMAMAPGLVLPERRVRHYPRAVKKKPQRYPL.... 105
193 6.000e-15UniRef50_A0A2V8GL24 IS4 family transposase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8GL24_9BACT  ali  18  210MEVLRCRSPQMVHKELEMFFIAYNFIRCLMAQAPALHDVPLERLSFKFSIAIAQAPSKKKQKQLMAQLLEVIACDQVPERLGRREPRAVKRRPKPY...... 313
194 6.000e-15UniRef50_A0A1I5Z099 Transposase DDE domain-containing protein n=2 Tax=Butyrivibrio proteoclasticus TaxID=43305 RepID=A0A1I5Z099_9FIRM  ali  43  341MTNFHSRKVEFVKQEIFAKLTLFNFSAFITNHASVSKKSKKHDYKINFSMAAKICHKFLKKSLPIPDVIAWIERNLRVDKTDRHFIRNLRGIGACSFLYRVA 448
199 7.000e-15UniRef50_A0A2J0YSM6 IS4 family transposase (Fragment) n=1 Tax=Rhizobium meliloti TaxID=382 RepID=A0A2J0YSM6_RHIML  ali  20  25MDVLRCKTPEMVRKEISVHLLVYNLIRSLMARAATELKNR--PRKISFKAAQETMQEFHVLLIQAGTVLKIASEHVVGNRPGRHEPRAVKRRP......... 124
208 2.000e-14UniRef50_A0A1D3JU85 Transposase InsG for insertion sequence element IS4 n=110 Tax=Bacteria TaxID=2 RepID=A0A1D3JU85_9PSED  ali  16  330..TLRSKTPEMIEQELWGVLLGYNLLRYQMVEMS-RHCPGIYPCEMSFTACTWAILGFINIPKYLAELHASAPHYVLPHRRERVYPRAIRLKSPKYPI.... 434
209 2.000e-14UniRef50_UPI00047EA056 IS4 family transposase n=1 Tax=Butyrivibrio sp. MC2021 TaxID=1408306 RepID=UPI00047EA056  ali  30  239MVHIHSIKPDFLIQEIYGKLTLYNFSSCITKAVTKRDSNTIHRYNFNHTQMQKFVRLYLIGK--IEKLELLVNRFLVPVRPGRKFKRIMRRQSAEPLAYR.. 337
210 2.000e-14UniRef50_A0A1V5QG11 Transposase DDE domain protein n=1 Tax=Betaproteobacteria bacterium ADurb.Bin341 TaxID=1852821 RepID=A0A1V5QG11_9PROT  ali  19  360MDVLRCQTPAMVRKEIIMHAIAYNLIRALMQQAAILYFLPIER--LSFKGTVDTIRQWREQMRLFNQLLHILAEDRVPYRPDRAEPRVRKRRPKAY...... 464
212 2.000e-14UniRef50_X0UTM5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0UTM5_9ZZZZ  ali  25  34..VFRSKTPDRVVQELWGMLIAYNAVRKTMDEAAQR--KELDPRRVSFTSATERVRETARLSARYEKMLAAIARVVVPKRPGRRFPRAVKIK.......... 130
213 2.000e-14UniRef50_A0A2S6HF09 DDE family transposase n=2 Tax=Methylobacter tundripaludum TaxID=173365 RepID=A0A2S6HF09_9GAMM  ali  16  289MEVLRTRTPEMAKKEVLVYLLAYNLIRSLIW--GAKQIYHVDIQRVSFKGSVQHLSSLAPYLALYGKLIGMVAKEKVPDRPDRVEPRAIKRRPKPFPL.... 393
214 2.000e-14UniRef50_R6QXL2 Uncharacterized protein n=1 Tax=Butyrivibrio sp. CAG:318 TaxID=1262761 RepID=R6QXL2_9FIRM  ali  39  333LNYFHGKKEELVLQEIYSRVIMYNFSQVIAGCIITEKKNKKWKYKVDFKRAASVCRKILTGKIKLKEIVKLLERNMIPSRPDRSYERNRTR........... 423
215 3.000e-14UniRef50_A0A258AQI5 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AQI5_9BACT  ali  19  149MEALRTKTPEMIEKELHMHALAYNCIRALILEGASKHQQQLGR--ISFKGAVDLLRQWLPRAAHLHELLEAIASLQNPLRPGRREPRAIKRRPKSY...... 253
216 3.000e-14UniRef50_A0A2G0Z3J9 Uncharacterized protein n=1 Tax=Pseudomonas sp. ICMP 8385 TaxID=1718920 RepID=A0A2G0Z3J9_9PSED  ali  16  53.EQLRSKQPDLVRQELWGTLLAYNLIRQEMRLMAGEMK--VAPQRLSFLWLAQAVTNALRIPKRLAELRTQAQHFMLPARRQRSYPRVVKPRPVKYP..... 155
217 3.000e-14UniRef50_UPI000B5AB295 IS4 family transposase n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5AB295  ali  14  192...LSCLSAEMIRKELWVHLLAYNLTRLLMSEAAT--LTHREPRSISFRHTVQLWSAWSQCGQQLDILLHAVAGPRVANRPGRREPRAIKRRPK........ 285
222 4.000e-14UniRef50_A0A1H8V9Y8 Transposase DDE domain-containing protein n=7 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1H8V9Y8_9SPHI  ali  21  324LEAFSGQKVETILQDFHATVFLSNLQEIISKPAQEKIHHRKYDYQINKNTAIGIMKNRVIGLLLFKDLQNLFAQYIEPVRPNRKLPRVKKRRSGKY...... 432
223 4.000e-14UniRef50_G7EDC2 Transposase insG for insertion sequence element IS4 n=23 Tax=Gammaproteobacteria TaxID=1236 RepID=G7EDC2_9GAMM  ali  18  204..HLRSKRQDMVRQELWGVLLAYNLIRRIMTMPATVTGIWPNP--LSFSSSSMAVIQYFSIPIHWQHLLNTLVLFKLPARRDRRYPRWVKPKPSKYPQ.... 307
225 6.000e-14UniRef50_UPI0005586CB1 IS4 family transposase n=1 Tax=Erysipelotrichaceae bacterium NK3D112 TaxID=877415 RepID=UPI0005586CB1  ali  25  327LENFTGQKPIIIEQDIYATGYLYNLISDIINDVEKKYKQRKYPMAVNRNLAIGILKEELIRLILEKDIMDEISENVEPVRDDRTYPRTKGQLASNYCNNRK. 443
226 7.000e-14UniRef50_A0A221IEH5 Uncharacterized protein n=1 Tax=Pseudoalteromonas espejiana DSM 9414 TaxID=1314869 RepID=A0A221IEH5_9GAMM  ali  18  35..TLISKRPDMVEQELWGVLLAYNLIRVAMTEAATR--KGIWPNQLSFSGCSSAVVAFLKLPVLYENLINQLSYYELPIRRDRSYPRWVK--PSKYPT.... 136
228 8.000e-14UniRef50_A0A1I5VFF9 Transposase DDE domain-containing protein (Fragment) n=1 Tax=Enterovibrio norvegicus DSM 15893 TaxID=1121869 RepID=A0A1I5VFF9_9GA  ali  17  24..TLRSKTPALVKQELWGMLLAYNLLRFMMCQMAYSL-NTVMPYQIGFKQASIFLVSQLQMLPRYPEVLRYIESFVLPERMERTYPRAVKKRPSRY...... 125
229 9.000e-14UniRef50_A0A225DXH1 Mobile element protein n=4 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225DXH1_9BACT  ali  16  328MDVLRCQSPDLVRKEIGMHVLVYNLIRGVMAAAARAGRHAPR--TISFAGAWSAIRGLADIVCAAPALLRVVRATRVGHRPDRVEPRVKKRRPKPH...... 426
233 1.000e-13UniRef50_A0A1H6HJ07 Transposase DDE domain-containing protein n=2 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1H6HJ07_SELRU  ali  32  59.EHFHSRKRELVIQEVWSRMILYNFCMEITNHIKEQKKKWRYVYRLNISEALKTCHDFLKRVQHHTDIIGWIMKAYCPVRAGRNYERKKSPHGAKSFNCR.. 167
234 1.000e-13UniRef50_A0A2M7MVT9 Uncharacterized protein n=1 Tax=Hydrogenophilales bacterium CG_4_10_14_3_um_filter_63_21 TaxID=1974028 RepID=A0A2M7MVT9_9PROT  ali  19  353METLKCKTPEMVEKELMMHMIALNLVRALAIDAA--RLRDVDPARISFSAALVQTGEWMRRKQLRPMFMKALADAVVRQRPGRSEPRAVKKRPKNYP..... 458
235 2.000e-13UniRef50_A0A1U7NE46 Uncharacterized protein n=4 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A1U7NE46_9FIRM  ali  25  148.EQVHSRSQNLIEQEIDAAVMVFNLISAIAKCASPRQPGGKYKYQTNRKALAFIVLQFLERKATQKEVIQTIQNEILPIRKNRHFKRVK............. 235
236 2.000e-13UniRef50_A0A2E0QNC3 Uncharacterized protein n=1 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E0QNC3_9BACT  ali  17  329MEVLRGKTPEMIRKELMIFAIAFNLLRYLQSRAANEAEVC--PTRISFKGVLDVIHRLNSRSKLLDWVLDRIGERVVPLRPDRHEPRAKKRRPKPHQN.... 431
240 2.000e-13UniRef50_A0A1V6JT70 Transposase DDE domain protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin006 TaxID=1852924 RepID=A0A1V6JT70_9BACT  ali  20  145MERLHCLTPRMLHKELEMYFIAYNLLRALMVEAAALYDVPVEQITLEYSQALLQARSQKAQRELVADLLAVIAQDTVPERPGRCEPRALKRRPKPYPL.... 250
241 2.000e-13UniRef50_C7GEK1 Uncharacterized protein (Fragment) n=1 Tax=Roseburia intestinalis L1-82 TaxID=536231 RepID=C7GEK1_9FIRM  ali  41  1....................TLYNFCEIIATNVVIEKKGCKHTYQLNYTRAIRICCYFLSIKKAPPDVEYLIGHELLPIRPGRIDPRKVKTQSAISFLYRAA 85
243 2.000e-13UniRef50_W6RF99 Transposase is4 family protein n=78 Tax=Proteobacteria TaxID=1224 RepID=W6RF99_9RHIZ  ali  17  336..TLRSGTPETVYQEVWGALLAYNLVRLEMAEVATEAQ--VEPTRLSFITALHYLRHEWGWMAHLTRLRNRLADLLLTEKRGRSCPRVVKKLPARYPI.... 438
245 3.000e-13UniRef50_A0A0U5NQU8 Transposase DDE domain protein n=1 Tax=Clostridium sp. C105KSO15 TaxID=1776047 RepID=A0A0U5NQU8_9CLOT  ali  42  88....HSKKYDLILQEIFSKLIMYNFSALIAYQITPNKR-------INFSNAVNFCRQYYNGKITEKILLALIPKYLSSIRPDRIYKRFQNLKNAIGFVYRIS 178
246 3.000e-13UniRef50_UPI000305F16C hypothetical protein n=1 Tax=Nodosilinea nodulosa TaxID=416001 RepID=UPI000305F16C  ali  13  1MEMIAAKTPAMVTKSIWVHLLTYNLLRTLMWEATADSEVDALRQQFNHFRPEFLHLAPSQQHRGYQALLSAVQELIVPFRPNRSEPRVVKRRPKPFP..... 104
247 3.000e-13UniRef50_M5R7W6 Transposase IS4 family protein n=2 Tax=Rhodopirellula TaxID=265488 RepID=M5R7W6_9PLAN  ali  16  368MDHLRCKKPHRVRNEVRAHMLAYNLIRQLMVEAALEAE--VEPWQLSFKATLSSFVEILPMLDLCAILYACCRSHTVGNRPDRYEPRRKKRRPKNY...... 468
250 3.000e-13UniRef50_A0A225DH76 Mobile element protein n=4 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225DH76_9BACT  ali  17  239..HFRSQTPVGVEQEVYALSLAHFVIRALMLEAAQTVDVDVDR--LSFTGCLRILQARLPECRWYDCLLWEMAHERIEPRRNRINPRVVKRKMSKFAKKR.. 343
251 3.000e-13UniRef50_W6RAT6 Transposase IS4 family protein n=1 Tax=Rhizobium favelukesii TaxID=348824 RepID=W6RAT6_9RHIZ  ali  17  149..TLRSGTPETVYQEVWGALLAYNLVRLEMAEVATEAQ--VEPTRLSFITALHYLRHEWGWMAHLTRLRNRLADLLLTEKRGRSCPRVVKKLPARYPI.... 251
254 4.000e-13UniRef50_A0A1M6HKA1 Transposase DDE domain-containing protein (Fragment) n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1M6HKA1_9FIRM  ali  26  216LQNFTGDTKIAVEQDFYASMYLSNMVALAKNEANEKIAHNKYEYKVNTSILIGKLKDSLVLMLLEDNIMEQIPKNMVPIRPGRSKPRNMGRKAPKH...... 327
256 4.000e-13UniRef50_A0A2G1ZRD1 Uncharacterized protein n=1 Tax=Phycisphaera sp. TaxID=2030824 RepID=A0A2G1ZRD1_9BACT  ali  13  319MEILRCKTAEMLEKEAWVSILTYNAIRVLMARAAARAG--VQPRELSYKGAMQTITAYGPRMKLMNHMLDAIACHKVRNRPGRAEPRLTKRRRK........ 419
257 5.000e-13UniRef50_UPI0009FB9354 hypothetical protein n=1 Tax=Cellulosilyticum ruminicola TaxID=425254 RepID=UPI0009FB9354  ali  36  90LTSFHAKKVDYIKQEIFARLTLYNYCELITTHVIEQSDVSNKTKQVNFTIAIYTCREYLRRQISPPDVIKLIEKYTLPVRLGR................... 174
258 5.000e-13UniRef50_A0A1W9UBQ3 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UBQ3_9CHLR  ali  26  348..TFRSKRPDLVKQELYAMLIMYNLVRLLIRQAAEK--HNKDPRLISFLDALQHIIEAAPLMTLFWYLLQVIADCIDRPRRHRINPRVVKVKMSK....... 450
259 5.000e-13UniRef50_A0A258AW74 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AW74_9BACT  ali  16  109MDTLRCQSPDMLARELLMHMIAHNLVRMLMVQADKRREKGTLDRINQWHGTLWGCTSARQATGRYEQLLQLIAEDVVPTRLKRNEPRVVKRRRDSY...... 213
260 5.000e-13UniRef50_A0A2A4UIP8 IS4 family transposase n=1 Tax=Moraxellaceae bacterium TaxID=1889775 RepID=A0A2A4UIP8_9GAMM  ali  16  337MDELTCKTPEMIEKEFAIYLLAYNLIRLIMLSAAAS--EELHPRTLSFKNSLQLWVQFAIGPMKLALLMECICSTRVAQRSGRIKPRKVKRRPKP....... 439
263 7.000e-13UniRef50_A0A1Z3HV42 Transposase InsG for insertion sequence element IS4 n=4 Tax=Halomicronema hongdechloris C2206 TaxID=1641165 RepID=A0A1Z3HV42_9CYA  ali  15  338MEMIAAKTPAMVTKSIWLHLVSYNLLRTLMWDATAHSEVQGTRQQFNHFRAEFLHLAPSKRGQGYQALLSAVRELIIPPRPNRSEPRVVKRRPKPFP..... 441
264 7.000e-13UniRef50_A0A1J4Z8N0 Uncharacterized protein n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1J4Z8N0_9PROT  ali  20  337MDMLRCKSQPMADKEIAVYFPAYNLVRWAMAKAAL--LADVLPRMLSFAGAKRLLCAFADQLRLIETVTACIATLRLPHRPDRIEPRAKKRRPK........ 437
265 8.000e-13UniRef50_UPI0005641431 hypothetical protein n=2 Tax=Rhodopirellula baltica TaxID=265606 RepID=UPI0005641431  ali  15  3LNHLRCKSPEMVRKEFWVTMLAYNAIR--TTALGSAWVCGTRPREVSFVSCCQFVLAAWDLIDTLTRTLEQIGKCVVGKRPGRFEPRVRKKRGSNY...... 105
269 9.000e-13UniRef50_A0A0A3W3F4 Uncharacterized protein n=1 Tax=Acinetobacter sp. HR7 TaxID=1509403 RepID=A0A0A3W3F4_9GAMM  ali  16  189..HLRSKQPTLIYQELWGVFIAYNILRRQMKYMAQRAK--VSPLRMSFHITSIAILNLLKLPKHLESLMEKSKRYVLPKKRSRNYPRVVKGKPQKYP..... 290
270 9.000e-13UniRef50_A0A2N0ZWV6 IS4 family transposase (Fragment) n=1 Tax=Psychromonas sp. Urea-02u-13 TaxID=2058326 RepID=A0A2N0ZWV6_9GAMM  ali  16  229MSELSCKSPDMCQKEIWIYLLANNLIRILMAQTAKKFNLNI--RSISFKNALQIWNKFINFAENIKKFFFIIAGHQVGKRAGRIEPRARKRRASAY...... 326
271 9.000e-13UniRef50_A0A0R2XKV8 Uncharacterized protein n=1 Tax=Opitutaceae bacterium BACL24 MAG-120322-bin51 TaxID=1655636 RepID=A0A0R2XKV8_9BACT  ali  17  3MEELRCKTPEMVRKELQMFIIAYNLIRALMQEAAARHPCDLGR--LSFKATVDTLRDFRVALRIMDEMFLVIASESVPLRMNRSEPRALKKRPKP....... 106
272 1.000e-12UniRef50_A0A0F2S8Q8 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c23 TaxID=1629714 RepID=A0A0F2S8Q8_9FIRM  ali  30  303LENFDGVKEIAVLQDFYATIFLANMTALAIIQEKHEEKELKYTYKTNVNIMVSELKDELVRKRRYNKLLQEIARNVIPIRPDRHNERNFKTTRDRYPMN... 417
273 1.000e-12UniRef50_UPI0003637F1E hypothetical protein n=1 Tax=Nodosilinea nodulosa TaxID=416001 RepID=UPI0003637F1E  ali  13  40MEMIAAKTPAMVTKSIWVHLLTYNLLRTLMWEATADSEVDALRQQFNHFRPEFLHLAPSQQQRGYQALLSAVQELIVPFRPNRSEPRVVKRRPKPFP..... 143
276 1.000e-12UniRef50_UPI000BBB371E hypothetical protein n=1 Tax=Mucilaginibacter gotjawali TaxID=1550579 RepID=UPI000BBB371E  ali  19  162LEAFSGLTVESVEQDFYATVFTANLHSVLIKDAQQSIDENKYPMKVNRNKSIGKLKINLISLFTDNDVGRILIRDILPVRPNRSYERVRKNKQSKS...... 268
277 1.000e-12UniRef50_A0A259U7H5 Transposase DDE domain protein n=1 Tax=Sporomusa silvacetica DSM 10669 TaxID=1123289 RepID=A0A259U7H5_9FIRM  ali  24  304LENFSGVNPIAIMQDFYATIYLSNIMTMAKAEANETAKGLKYEYKVNMNILISKMTKTLIECFYEDDTMSNITKNLVPVRPDRSFPRREPSRKNKYPIN... 416
282 1.000e-12UniRef50_A0A2A6ATU9 Uncharacterized protein n=1 Tax=Alteromonas pelagimontana TaxID=1858656 RepID=A0A2A6ATU9_9ALTE  ali  18  63..TLRSKKPDMVRQELWGLLLAYNLIRIAMIDATKDYDE-LSPTRLSFNLCMRQVIAFFKLPAHYEELLNTLRLFTLPDKPDRHYPRVI............. 158
283 2.000e-12UniRef50_A0A0X8X4R8 Transposase DDE domain protein n=2 Tax=Mucilaginibacter gotjawali TaxID=1550579 RepID=A0A0X8X4R8_9SPHI  ali  19  326LEAFSGLTVESVEQDFYATVFTANLHSVLIKDAQQSIDENKYPMKVNRNKSIGKLKINLISLFTDNDVGRILIRDILPVRPNRSYERVRKNKQSKS...... 432
284 2.000e-12UniRef50_W6R6Y6 Transposase insG for insertion sequence element IS4 n=1 Tax=Rhizobium favelukesii TaxID=348824 RepID=W6R6Y6_9RHIZ  ali  17  6..TLRSGTPETVYQEVWGALVAYNVVRLEMAEVATEAQ--VEPTRLSFITALHYLRHEWGWMAHLTRLRNRLADLLLTEKRGRSCPRVVKKLRARYPI.... 108
285 2.000e-12UniRef50_UPI000A072247 IS4 family transposase n=1 Tax=Desulfosarcina sp. BuS5 TaxID=933262 RepID=UPI000A072247  ali  28  343.ENFSGKSVLSIYQDFHAKVFSKNLASALASAIDINTYKNRHKYKMNFAQMLSKIKDVIPLLSLISDLHKIITETIEPVRPGRKYPRNFKNRTGR-FNY... 452
288 2.000e-12UniRef50_A0A1I1UHU0 Uncharacterized protein (Fragment) n=24 Tax=Proteobacteria TaxID=1224 RepID=A0A1I1UHU0_9BURK  ali  20  1..TLRSKTMDGVYQEIWGTLIAYNLIRLEIAKAALAVKCE--PTEVSFIRAFHLIQFELHWPASMKHLRERLVSLLKDERPGRKCDRVVKATPKRY...... 102
289 2.000e-12UniRef50_A0A078L997 Transposase DDE domain protein n=1 Tax=Candidatus Rubidus massiliensis TaxID=1444712 RepID=A0A078L997_9CHLA  ali  25  324MENFSGESTQAIEQDFHATIFTANVRALLTNEAQEEMEEIKHDYKINQNIAIGILKDEIVKVLLTPELKQDMKKNIVSIRPGRKYIRIKKTNRKYPMNMRRA 440
290 3.000e-12UniRef50_A0A1F4FNX0 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 TaxID=1797501 RepID=A0A1F4FNX0_9PROT  ali  17  341...LRCRNPQRVSQELWGLTLAYNLVRLTMADVARRAG--VLPNQISYRHTLHFVRAFWILPKRLQSLYNELPLLVLPPRRNRAYPRAVKIKMSNYPRKR.. 444
292 3.000e-12UniRef50_A0A2E9ILW7 Uncharacterized protein n=1 Tax=Puniceicoccaceae bacterium TaxID=2026784 RepID=A0A2E9ILW7_9BACT  ali  16  95MEMLRCKTPKMVRKELRMFIIAHNLIRSLMQEAASLYLCDLTR--LSFKGTVDTLRQFRTRARIFDEMLLVIASEKVPLRENRSEPRALKKRPKP....... 198
293 4.000e-12UniRef50_A0A0F8YTU1 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8YTU1_9ZZZZ  ali  22  245MDVLRSHTVDGVLKELHVFCLIYNLVRLVMLQASRRQG--VPPDRISFVDALRWLATALPG-TSLPNLV------VNPYRPNRLEPRVRKRRPKQYPL.... 333
298 4.000e-12UniRef50_A0A1G3CHU8 Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium RIFOXYD12_FULL_42_12 TaxID=1801987 RepID=A0A1G3CHU8_9BACT  ali  26  307VEQFSGKSPHAVRQEFHAAIFLSNLQSVIAREKDVKAKGRKYEYQENRTSALFFVKEGLIALFTLTYLKEKIIKNILSIRPGRHYERRFTRYKLPKFT.... 417
300 5.000e-12UniRef50_T2IYJ4 COG3385: FOG: Transposase and inactivated derivatives n=1 Tax=Crocosphaera watsonii WH 0005 TaxID=423472 RepID=T2IYJ4_CROWT  ali  17  280MDILSCQTPEMIRKEIYVYLLAYNLLRSIMYDKPIRLSLQATRQHLNNFSTKWVYKTKKRVNEIYRTMLNKVADSYEKRRVGRVEPRVRKRRPKSYPL.... 384
301 5.000e-12UniRef50_UPI000994A8EA IS4 family transposase n=2 Tax=Bacillus alkalinitrilicus TaxID=427920 RepID=UPI000994A8EA  ali  24  304LQKFTGDTPLSVEQDFYATMFLANMASLVMIAKEQEGKDLKYEYTANANVLTGKLKANLRRKKLYKQMLDEIKRNRTPIRPGRSFKRTKGLRANR....... 414
303 6.000e-12UniRef50_A0A1V6JZQ7 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin006 TaxID=1852924 RepID=A0A1V6JZQ7_9BACT  ali  20  31MDHLSCKTPGNLEREIRLHLLMHNLVRRLMLEAARRHRAPLNRLSFAGAQALLQARSQRQRQALLDQLFHSVASDLLPNRPGRREPRALKPRPKPYPL.... 136
304 6.000e-12UniRef50_N2IJU5 Uncharacterized protein n=5 Tax=Pseudomonas TaxID=286 RepID=N2IJU5_9PSED  ali  18  59..TLRSKTPEMIAQELWGVLLGYNLLRYQMVLMSRQCSG-VYPCEMSFTACSWAILGLLHLPGFLRDLQASAARYVLPHRPDRWFPRAV............. 154
306 7.000e-12UniRef50_A0A1G0AZ25 Uncharacterized protein n=1 Tax=Flavobacteria bacterium RIFCSPLOWO2_12_FULL_35_11 TaxID=1798016 RepID=A0A1G0AZ25_9BACT  ali  22  325LEQFSGHTVCSIKQDFYALIFVANLQSLIERQCENKNKKRVHNYKINKNISIGSMKNKIVKLFLTEHLQYLFEQHIEPIRPNRSHSRKMIKKSPRS...... 431
308 8.000e-12UniRef50_Q6D546 Transposase for insertion sequence element IS4 (Partial) (Fragment) n=8 Tax=Enterobacterales TaxID=91347 RepID=Q6D546_PECAS  ali  18  32..TLRSKKSDMVRQELWGVLLAYNIVRYMI--KMAAMLKGMWPNQLSFRESTAWVMKLLRIPELVKDVASIAQMVKLPPRRERAFPRIVKERPQKYATAR.. 136
310 9.000e-12UniRef50_R9KSC0 Uncharacterized protein n=4 Tax=Lachnospiraceae bacterium COE1 TaxID=1235793 RepID=R9KSC0_9FIRM  ali  25  301LENFSGKNPQAIRQELYAVLFISNLSALIKNEIREELNRGRHRYQLNRSYIIGAVSRYIRCLINLQQLIQRAKNVRSIIRPDRHFKRKV............. 400
311 9.000e-12UniRef50_A0A0W0U703 Uncharacterized protein n=1 Tax=Legionella geestiana TaxID=45065 RepID=A0A0W0U703_9GAMM  ali  20  70MGILRGKTPEMVKKEIWAHVLAYNLVRKMMLQAAMRYNQS--PRSMSFKLALQMISAFRQAGSLSESLKALVSKKTVQNRP--SQPRVVKRRPKAFP..... 171
312 1.000e-11UniRef50_A0A1E8EZ71 Transposase DDE domain protein n=3 Tax=Clostridium TaxID=1485 RepID=A0A1E8EZ71_9CLOT  ali  29  89.ENFTGETPIAIEQDFYATMYLANMVALQIIEEEYKEKGLKYEYKVNTNVLIGKLKDTLITMISLKHIEKEIERNVIPIRPDRNFKRK.............. 191
313 1.000e-11UniRef50_A0A1G9G5H5 Uncharacterized protein (Fragment) n=1 Tax=Sarcina sp. DSM 11001 TaxID=1798184 RepID=A0A1G9G5H5_9CLOT  ali  34  1....HSLKRDFLFQEIYAKLTLYNFSSFVASVGDIKKKTKKYTYVLNHSQTQKSCIRFLNGRV--EDIADVICRYLVPIRPGRKFKRTLRRQSADTLNYR.. 95
316 1.000e-11UniRef50_UPI000B5A8BE6 hypothetical protein n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A8BE6  ali  13  108...LSCLSAEMIRKELWVHLLAYNLTRLLMSEAAT--LIHREPRSISFRHTVQLWSAWSQCGQQLDALLHEVAGPRVANRPGQREPRAIKRRPK........ 201
319 1.000e-11UniRef50_A0A257W671 DDE transposase n=1 Tax=Burkholderiales bacterium 12-64-5 TaxID=1970494 RepID=A0A257W671_9BURK  ali  16  235..VLRSKQPALVRQELWGVLIAYTLLRRWMREMAAHVQ--VEPQRISFHTASYAIVNLLAVPTLPKQLAALLAHFVLPPRRGRRFPRVVKKRASKFPT.... 338
320 1.000e-11UniRef50_A0A259E6Z3 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A259E6Z3_9PROT  ali  22  364MDILRCKTPEMVRKEISVHLLAYNLVRWSMA--SAAYLGEVLPRMLSFAGAKRLLVAFATQLRRCPTVLGAIASLTLPLRPGRAR-RATRQKT......... 462
321 2.000e-11UniRef50_A0A1K2C4I7 Transposase DDE domain-containing protein n=1 Tax=Streptomyces atratus TaxID=1893 RepID=A0A1K2C4I7_STRAR  ali  19  97..VLRSKAPDLVQQEIWGHLCCHYAIRTLMADTAAHTGQ--DPDRVSFVKALRIARRSVAQSAFPPHAIRWLTQHLNPPRRKRSHPRVVKRKVLKW...... 199
322 2.000e-11UniRef50_UPI000377732E hypothetical protein n=1 Tax=Janthinobacterium sp. CG3 TaxID=1075768 RepID=UPI000377732E  ali  24  110..TLRSRTKQGINQEIWGLLIAYNLLRTEMAKAALEANCE--PTDISFIRASHGFQYEPRWLAIMPALLQRLRQRLVPPRPDRKFARTVKSKPQRCP..... 212
323 2.000e-11UniRef50_A0A2V3JII9 IS4 family transposase (Fragment) n=2 Tax=ANME-2 cluster archaeon TaxID=2056317 RepID=A0A2V3JII9_9EURY  ali  15  1................YVHLLAYNLIRTVMAQTAHRYG--ISPRTLSFKGALQHLNAFESLPSLYEQILEAISCHRVGDRPGRREPRAVKRRRKPYPL.... 89
324 2.000e-11UniRef50_A0A0Q9U3X0 Uncharacterized protein n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A0Q9U3X0_9BACL  ali  46  1...................MIMYNFAEMITSHVVISQMDKQHQYQVNFTVAVHVCRHFLRSRGDPPDVEALIRKNILPIRPGQQNPRKIRYKSAVSFV.... 84
325 2.000e-11UniRef50_UPI000C3329FB hypothetical protein n=2 Tax=Ruminococcus bromii TaxID=40518 RepID=UPI000C3329FB  ali  36  1...................MILYNFCELVTSHAVVKSKNTKHIYKINFAITVNICRAYLKHGGNETETMLLIQKYLTPVRYNRNYPIHLRPKKNRDFMYRVS 84
328 2.000e-11UniRef50_UPI000BE41F6C IS4 family transposase n=1 Tax=Anaerocolumna aminovalerica TaxID=1527 RepID=UPI000BE41F6C  ali  25  324.ENFTGDKPVCVEQDFYANMLISNICSVIKSETDEVEKNSKANYQTNRRLLIYRVIRKIITLIIYNDLIYEIQKCRSQIRRNRKYERQMTRNRRKYH..... 433
335 3.000e-11UniRef50_X0X6X1 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0X6X1_9ZZZZ  ali  18  159MDFLRCKTPELVRKEIWTHILAYNLIRTIMAQAAT--GHGIQPRTISFKGAVQTLEAFAIRLKLYQELLDAVATHLVADRP..................... 249
336 3.000e-11UniRef50_V6L7Z6 Uncharacterized protein n=55 Tax=Actinobacteria TaxID=201174 RepID=V6L7Z6_9ACTN  ali  24  282..VLRARTPEGIDQEIYALLIVYQLLRTAMTDATSTLCGTGHDR-ASFSIAWQTARDQVIQAATVIDLVGTIGRHLLPQRRLRVSPRIVKRAISKY...... 383
337 4.000e-11UniRef50_F7NLV3 Transposase IS4 family protein (Fragment) n=5 Tax=Firmicutes TaxID=1239 RepID=F7NLV3_9FIRM  ali  51  115LSSFHAKKVESIQQEIFARLLLYNFCEIITTHVVIQQKDTKHSYQVNYTLAIHICRHFLRFHTD...................................... 178
338 4.000e-11UniRef50_A0A1Q8BN45 Uncharacterized protein (Fragment) n=2 Tax=unclassified Cyanobacteria (miscellaneous) TaxID=1983111 RepID=A0A1Q8BN45_9CYAN  ali  19  255...LRSQKPGGVIQELYGLLLAHYAVRALMAEAAAQ--EGLAPTRLSFVHAVALLRVAIQHPLLYQRLLRAIARCCLPERARRTNPRVIKRKMS........ 352
339 4.000e-11UniRef50_A0A1U7CW80 Uncharacterized protein n=2 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CW80_9BACT  ali  15  330..VLRSQTPRGVVQELYGLLLGHYVDRVLMQETAKRQQ--VDPRRLSFTATLKILRCRLPECRWYQAVLAEIGEEVLPERRNRINPRVIKRKMSNWKKKR.. 433
341 4.000e-11UniRef50_A0A1P8WE37 Transposase DDE domain protein n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8WE37_9PLAN  ali  18  377...LRSRTAESIRFEVAGHVVLYLLVRWLMVEAAQRAAPDGDPLGLSFKHALQELKTAWPLLRILPKLLKAIASHEVQWRPGRSFPRAKKRKKQAPPNTRK. 489
343 4.000e-11UniRef50_A0A1E7GNH4 Uncharacterized protein n=1 Tax=Desulfuromonadales bacterium C00003096 TaxID=1869311 RepID=A0A1E7GNH4_9DELT  ali  17  1MDVLRCRTPEMIRKEILMHFIAYNCVRRLMYEAAEEAAIEV--RIVSFKGSLQALRSWAPHLRLISDLYDAMTDTPIMQRPGRSEPRCVKRRPKNY...... 105
344 5.000e-11UniRef50_UPI000366A81E IS4 family transposase n=1 Tax=Bacillus massiliosenegalensis TaxID=1287657 RepID=UPI000366A81E  ali  20  304LQKFTGDTPLSVEQDFYATMFLANMASFVMIAIEQEGKDLTYEYKTNTNVLIGKLKTNLIRLILYKQILDEITRSRTPIRPGRSFIRNKRLRANR....... 414
347 5.000e-11UniRef50_A0A0S2W5T5 Uncharacterized protein n=1 Tax=Intestinimonas butyriciproducens TaxID=1297617 RepID=A0A0S2W5T5_9FIRM  ali  33  336...LHGRSDDCALQELYAKLTFFNFTSLICRAVAIKSSGTQNEVKISFKDATDLCRDFYRTPASGEKLLQDISKYTYSNKKGRKAERTIKPKTFVAFTYRTS 437
351 5.000e-11UniRef50_UPI000A0317A2 hypothetical protein n=1 Tax=Simplicispira psychrophila TaxID=80882 RepID=UPI000A0317A2  ali  22  72LDVLRCKCREMIEKEIAVSMLAYNLVRWAISASAAPAQ--VLARALSFAGARRLLASFSLRAALTEVLLKSIAKLKLPTRTGRIEPRAKKRRPK........ 172
352 5.000e-11UniRef50_UPI000BA8F15D IS4 family transposase n=1 Tax=Paraferrimonas sedimenticola TaxID=375674 RepID=UPI000BA8F15D  ali  15  330..TLRSKKADGVYQEVWGILTSYNIVRLEMAEIAKQHQ--VEPLRISFIGALFLIMDEMIWPKHLKTLRENGKRLILPKKRKRAYPRAVLNKHKKYP..... 433
356 8.000e-11UniRef50_C9YXP9 Putative transposase n=1 Tax=Streptomyces scabiei (strain 87.22) TaxID=680198 RepID=C9YXP9_STRSW  ali  18  2...LRSQDATGIQQELWAHLTVYQALRRAMVEAVETLPGT-DPDRTSFTIALETAKDQLIAAADPGHIASALLHDLLPPRRARVNPRRVKVRSP........ 97
364 1.000e-10UniRef50_A0A257TJC5 Transposase n=1 Tax=Planctomycetia bacterium 21-64-5 TaxID=1970542 RepID=A0A257TJC5_9BACT  ali  17  342.ENIRAKSVEMFKKELYASVVAYNLVAQFRRQAAK--LAQVQPRRLTFKGVWTTLKNHLLWLTRYDEALRRAAKRKLPNRRPRNYPRKAHPRRQKS...... 444
365 1.000e-10UniRef50_UPI000B7E685A hypothetical protein n=1 Tax=Candidatus Entotheonella palauensis TaxID=93172 RepID=UPI000B7E685A  ali  14  51LDVLKCQTVHGILKELMVFALIYNLVRLVMGQAARRQQVGIDR------ISFIDAPRWLACARVHEELPKLV---VNPHRPGRYEPRVRKRRPKPY...... 137
366 1.000e-10UniRef50_UPI00047EC1E3 hypothetical protein n=1 Tax=[Clostridium] saccharogumia TaxID=341225 RepID=UPI00047EC1E3  ali  35  12LVYFYAKNRKLIQQEINATLLMYNVSEAVIN-----------------------IRLYLRNKLKEKELVSRIKKFLVPQRPERSFKRAIKPKSCKSLNYRTS 90
367 1.000e-10UniRef50_V4JRX3 Uncharacterized protein n=1 Tax=uncultured Thiohalocapsa sp. PB-PSB1 TaxID=1385625 RepID=V4JRX3_9GAMM  ali  19  63MEMLSCLSPEMIKKEIAIYFMAYNLIRSIISQSAI--IHEKIPRQISFKGAVQLIVAGATTLIGMATILLAISTNAVGIRNQTPQPRAIKRRPKPYPL.... 167
368 1.000e-10UniRef50_A0A2W6BI19 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6BI19_9CHLR  ali  18  5...LRSKTPEGIIQEVYGLLLAHYLIRASMHEVALQADIDLDRXXXXXXXXXXXXXXXXXXXXDEPQIMQRVVRFLLPPREDRSNPRVVKRRLSK....... 103
369 1.000e-10UniRef50_A0A1G1J952 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RIFCSPHIGHO2_02_FULL_49_9 TaxID=1801822 RepID=A0A1G1J952_9BACT  ali  23  328.DVLRSKTVEGIYKELYARIIGLNLIHWLILKAGRKHNKPIER--ISTSAALRLTAAYWQLAELYRTLLERIAYSTIPDRPNRIEPRMIRRDTKHYPM.... 431
370 1.000e-10UniRef50_E1YIX8 Uncharacterized protein n=2 Tax=uncultured Desulfobacterium sp. TaxID=201089 RepID=E1YIX8_9DELT  ali  27  110VENFSGKTVRSVYQDFHAKVFSKNLTMMIANSVEKNTASRKYKYQVNFTQALSAIKNVIVLLILIEDLQALILKCVDAIRPGRSY................. 207
371 1.000e-10UniRef50_A0A226GE47 Uncharacterized protein n=5 Tax=Flavobacterium branchiophilum TaxID=55197 RepID=A0A226GE47_9FLAO  ali  21  346LEKFSGKTAKAVRQDFHAKVFLMTLCSALREEYNQEKRKTKHAQKPNKTHALATLSDMLIPIFIKRKLNEFLAKTREIIRKNRSVERKKKTKKQYYMNY... 459
372 1.000e-10UniRef50_UPI000A056A3F IS4 family transposase n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI000A056A3F  ali  16  172MDVLRGLTPGMVRLEIQAHLLAYNLVRQVMADAA--DRHGVLPDRISFKTTLMALLAFTPYLACYSQMLDAIARHRVGNRPNRVE................. 263
373 1.000e-10UniRef50_I0IGN9 Putative transposase n=1 Tax=Phycisphaera mikurensis (strain NBRC 102666 / KCTC 22515 / FYK2301M01) TaxID=1142394 RepID=I0IGN9_PHYMF  ali  13  427LERLRAKTPRMVLTELWCGILANNLIRQRMAEAIAARRPGRSPRTASFMLGMQLAAAGWVALAIRPATSATRQAVRVGHRPDREEPRANKLRPKIVALLRIS 535
374 1.000e-10UniRef50_UPI000481BD08 IS4 family transposase n=1 Tax=Saccharicrinis fermentans TaxID=982 RepID=UPI000481BD08  ali  27  273LEQFTGKTTIAIKQDFYAKVFMLNLSSMIRTQAIKSTKNRKYKQQANKTQSLAKLKDFFTPKVFITKLIEILSKRLEIIRPGRSFKRPDTSIRRRH...... 379
375 2.000e-10UniRef50_UPI000A12161E IS4 family transposase n=1 Tax=Thermoactinospora rubra TaxID=1088767 RepID=UPI000A12161E  ali  20  386........PGLVRQEIYGYLIVYQAIRYLIIGAALT--HGLDPDRISFTHALHTIRDTVTRSGPHAKGLADILRTLVPHRPGRVYPRAVWRVATHYP..... 475
378 2.000e-10UniRef50_A0A1I1MCU8 Transposase DDE domain-containing protein n=9 Tax=Comamonadaceae TaxID=80864 RepID=A0A1I1MCU8_9BURK  ali  15  327..VLRSKQPELVMQEVWGVLLAHTLLRRWMRLMAEHVG--VAPLRISFHTAKHAIMGALTLPKHLQLLLDQARYFVLPPRPDRSFPREVKRSRSKYP..... 430
381 2.000e-10UniRef50_A0A258QPA7 Uncharacterized protein n=1 Tax=Halothiobacillus sp. 28-55-5 TaxID=1970386 RepID=A0A258QPA7_9GAMM  ali  29  308.ENFSGKSVEAIRQDFYAKQVAHNLTAILAMGAQARLLGRKHPYKVNFAQALSGMKNQIIHLLRETNILPRIAQNIEACRPDRRFMRRV............. 406
382 2.000e-10UniRef50_X1A0I1 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1A0I1_9ZZZZ  ali  17  1...LRCKTPDMVHKELWTHLLAYNLLRTVMAVAAGESG--IEPRRVSFKGAKQALTAFAPKLPLIDAMFTIIAYHRVGNRPGRWE................. 89
383 2.000e-10UniRef50_X0W510 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0W510_9ZZZZ  ali  11  86MDILRAKSPDMLRAELWSCLLAYNLIRLRMLQSCAA--HGRDPRSVSFTTTMQLLATNWLLCAVLAQLGQAMCSEQVGHREGRLEPRKNKRRPKI....... 185
385 2.000e-10UniRef50_A0A0D8IYF2 Uncharacterized protein n=1 Tax=Ruthenibacterium lactatiformans TaxID=1550024 RepID=A0A0D8IYF2_9FIRM  ali  31  2.............QDIFARMTLYNLASLLRLHASFMQLKGEYLYRVNDAFAAHIAREFLLGFVSTTKVESLITSFLLPVQPDQPKTRNMRVKRPVSFQYR.. 88
386 2.000e-10UniRef50_A0A1G7LJH1 Transposase DDE domain-containing protein n=1 Tax=Mucilaginibacter pineti TaxID=1391627 RepID=A0A1G7LJH1_9SPHI  ali  21  208LEAFSGQRVTTIMQDFYITFFLSNLQAIIAKPCEKKTSKRLHQYKINKNIAFGIMKNRLIDLFIVHHLEELFIHYLEPVRPNRKYPHCRKTYKSRS...... 314
387 2.000e-10UniRef50_U5PNL1 Uncharacterized protein n=3 Tax=Lactococcus lactis TaxID=1358 RepID=U5PNL1_LACLL  ali  35  1.....................MYNFSMQIAMGVEIKKNSTQYLYQINYTRAFSICREYFKHPKCP--VEDLVQNFILPVRPNRGDQRKIKVKPFVGFLYWIA 79
388 2.000e-10UniRef50_J2SS11 Uncharacterized protein (Fragment) n=1 Tax=Chryseobacterium sp. CF314 TaxID=1144316 RepID=J2SS11_9FLAO  ali  20  37.EHFSGYSHQSILQDFFATLFVSNVQTLIVGDLAEEIKENKYNYKINTNLSYGFMKNRIISMFLIEELKELFKNHLVPIRPNRSNKRDIGKYRNR....... 142
391 2.000e-10UniRef50_W8PSC3 Uncharacterized protein n=4 Tax=Pseudomonas TaxID=286 RepID=W8PSC3_9PSED  ali  15  4.............KELWVYLLAHNLIRMLMAQSALLADC--LPRELSFKHSLQLWLALRQYGSGEKHLLKLIAQRRVGNRPGRVEPRAIKRRPQAYPL.... 91
393 3.000e-10UniRef50_A0A173RJ49 Transposase DDE domain n=1 Tax=[Eubacterium] rectale TaxID=39491 RepID=A0A173RJ49_9FIRM  ali  34  158............................................QVNFTIAIYICREYLRRNLSPPDVINLIEKHVLPVRPGRKDPRKVNPQAAVSFLYRVA 217
394 3.000e-10UniRef50_UPI000B3DC1D6 hypothetical protein n=1 Tax=unicellular cyanobacterium SU3 TaxID=1982589 RepID=UPI000B3DC1D6  ali  17  3MDILSCQTPEIVRKEIYVYLLAYNLLRSIMYEAGITFDRQATRQHLDNFSSKWVDKPRKRVKKMYKTMLKKIADSYEKRRVGRVEPRVRKRRPKAYPL.... 107
395 3.000e-10UniRef50_A0A1Q7XDE4 Uncharacterized protein n=1 Tax=Cyanobacteria bacterium 13_1_40CM_2_61_4 TaxID=1805101 RepID=A0A1Q7XDE4_9CYAN  ali  17  338..TLRSQTPQGIEQEFYGLLLAYYAVRVLMLQAAQPLG--LDPDRLSFTHAITVVTDALPQEALFERLMADLRTPLLPPRRLRSNPRVCKRPGSKFPRPR.. 442
396 3.000e-10UniRef50_UPI0002F86001 IS4 family transposase n=1 Tax=Paenisporosarcina sp. TG-14 TaxID=1231057 RepID=UPI0002F86001  ali  25  306.ENFTGTSKLVIEQDFYASIYLSNMISLVKNEANEAEKNLKHKYQVNTNILIGKLKESMILLLLEENLVKEIIKNKTPIRLGRKYPRNRNLKSNRFSPSRK. 421
399 3.000e-10UniRef50_A0A1Q9YD29 Uncharacterized protein (Fragment) n=2 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A1Q9YD29_9FIRM  ali  26  251..QVHSRKQNQIEQEIDMAVMVYNLISAISKCALPKQPGMKLQYKTNRKALSEIVLRFLTGKALQKEVIWTIENEVVPIRKNRHFRRAK............. 337
403 3.000e-10UniRef50_A0A0F9H3Q4 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9H3Q4_9ZZZZ  ali  16  149..HLRSETPAGVIQEMYALSLGHFVIRALMFEAAER--EQLDPDRLSFTGCFQILRCRLPECDWCESLLWELGQERIAPRRNRINPRVIKQKVSKRPKKR.. 253
404 3.000e-10UniRef50_A0A1J0EU63 Uncharacterized protein n=1 Tax=Pseudomonas frederiksbergensis TaxID=104087 RepID=A0A1J0EU63_9PSED  ali  15  1..........MAIKELWVYLLAHNLIRMIMVQSAALADC--LPRELSFKHSLQLWLAMRQYGAPERDLLRLIAQRRVGNRPSRIEPRAIKRRPQTYPL.... 90
406 3.000e-10UniRef50_A0A2M8G9Q7 Uncharacterized protein n=2 Tax=unclassified Syntrophobacterales TaxID=1674873 RepID=A0A2M8G9Q7_9DELT  ali  22  17.ENFSGKSVESVYHDFHAKVFAMNLTAAITHPIPNENGQRKYAYRINVTQALSKMKDSIVLLFLLNKLLDLFIATIEPIRLGRKYPRK.............. 114
408 4.000e-10UniRef50_UPI000CF5AE57 IS4 family transposase n=1 Tax=Streptococcus suis TaxID=1307 RepID=UPI000CF5AE57  ali  50  253LTHFHAKKKEGILQEIYARFINFNVCKWLTSHVAIKTSKLKQTYKICFSDAVYACRKFLRDKLTSFQLETYIA............................. 325
409 4.000e-10UniRef50_A0A1M7PZQ5 Transposase DDE domain-containing protein n=2 Tax=Cyclobacterium lianum TaxID=388280 RepID=A0A1M7PZQ5_9BACT  ali  26  82VEQFGCRKPVGIYQEFYAHILAMNMVALTGMEIKKKNAKRKLTYKYNWKNTFLHLRAKIVKLFILDNLIIKVALNLVAVKKGRKFPRK.............. 180
410 4.000e-10UniRef50_A0A2M8PP69 IS4 family transposase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PP69_9CHLR  ali  17  337...LRSRKPVGVMQELYGLLLAHFIIRSLI--GYTAHAQQLDPDCLSFVHAVRLLKMVLPTLQLLDQLANDLARHRLPPRANRINPRVVKRRTSR....... 437
412 4.000e-10UniRef50_A0A1H9TX66 Transposase DDE domain-containing protein n=2 Tax=Pedobacter rhizosphaerae TaxID=390241 RepID=A0A1H9TX66_9SPHI  ali  28  248LEQFGSRKPEGINQEFKAHIFMMNLVALITVQDTIEKNKRRYNYIFNWQNAFRFVRNSLIELLITKGLVKQISETVVAVKPRRSFPR-IKVRQNKS...... 353
414 5.000e-10UniRef50_Q7MLW1 Transposase and inactivated derivative n=410 Tax=cellular organisms TaxID=131567 RepID=Q7MLW1_VIBVY  ali  20  334..VLRSKTVELVYQELWGLLLGYNLVRREASQAAVAHGRMAN--EISFKYACQFIASQLKTPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKA 441
415 5.000e-10UniRef50_A0A0G9L829 Uncharacterized protein n=11 Tax=Firmicutes TaxID=1239 RepID=A0A0G9L829_9CLOT  ali  28  306.ENFTGATQIAIEQDFYATMYLTNMVSLAKKDADQKDKNLKYEYKVNTNILIGKLKDNLILMMLEKEIKAEIQRNIIPIRPDRSFERK.............. 408
416 5.000e-10UniRef50_A4BL98 Uncharacterized protein n=5 Tax=Nitrococcus mobilis TaxID=35797 RepID=A4BL98_9GAMM  ali  21  302MERLRCKSPERVRKEIAAHLLAYNLVR--ANLNRAAQCFEKIPRQLSFKSALQLLNNAASQLLLLTALLQAMA--LSPIRQKRPQPRAVKRRPKPYPL.... 406
417 5.000e-10UniRef50_A0A1G0GTP8 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_40_19 TaxID=1798281 RepID=A0A1G0GTP8_9GAMM  ali  22  319VEDFHSSTERGVKQELYAHLLLINIARIFESEAKNKLPPPTATDKINFKNCLLVVERYLLKLFWLPKAISLIARVKQKIRPGRHYPRFSHKPIKKW...... 443
420 5.000e-10UniRef50_A0A2W6C8Z7 IS4 family transposase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6C8Z7_9CHLR  ali  20  338...LRSKLPVGVVQELYGLLIAHYLVRAVMVDAAATVS--LAPTRMSFLESLRLIREAMPHALIYAALLTDIAATALPPRANRINPRVVKQKLSNFPVKR.. 441
422 5.000e-10UniRef50_V1H431 Transposase IS4 family protein n=1 Tax=Salmonella enterica subsp. indica serovar 6,14,25:z10:1,(2),7 str. 1121 TaxID=1173950 RepID=V1  ali  22  329..TLRSRFPEGVRQEIWGILIAYNLIRKEMSFIAEEAK--VLPVRISFIAALNLIESQVRYCELSPRMRKNIMLYILPIRKHRHYDRTVLYIPDKY...... 430
424 6.000e-10UniRef50_A0A1M6F3S3 Uncharacterized protein n=1 Tax=Geosporobacter subterraneus DSM 17957 TaxID=1121919 RepID=A0A1M6F3S3_9CLOT  ali  20  87LEKFTGDTDRAVQQDFYASIYISNLASIMIADAQEEYDKKKHEYKINQRMAIAYLKEDLLHMKLYEKFVKKLSKHVVAIRRDRKFERPTRHNPK........ 196
425 6.000e-10UniRef50_H8YYE1 Transposase family protein n=2 Tax=Thiorhodovibrio sp. 970 TaxID=631362 RepID=H8YYE1_9GAMM  ali  18  287MENLSGRTSLAVRQDMHAKVLAMNLAAMLRAVAQLVAKRRRFDYKVRMTSALSHLSDQLFDLLLITRIIQRLSQTTEQVRPGRSFPRH.............. 387
427 6.000e-10UniRef50_A0A239LPB8 Transposase DDE domain-containing protein n=1 Tax=Anaerovirgula multivorans TaxID=312168 RepID=A0A239LPB8_9FIRM  ali  20  301.ENFSGYTPLSIEQDFYATIYLSNLASGFIYDAKHAKEPKKYNYKVNRNELYGSLKNKLMQIKLFDKVMLKMKRNMVPIRPERQPDRKNKTPGIKYPIN... 413
428 7.000e-10UniRef50_A0A151B2M7 Transposase DDE domain protein n=8 Tax=Firmicutes TaxID=1239 RepID=A0A151B2M7_9CLOT  ali  27  188.ENFTGETQIAIEQDFYATMYLANMVALAKKDANEKDKNLTYEYKVNTNVLIGKLKDTLITLISMNNIQEEIERNVIPIRPNRNFKRK.............. 290
429 8.000e-10UniRef50_A0A2A4WE58 Uncharacterized protein n=1 Tax=Piscirickettsiaceae bacterium TaxID=2030828 RepID=A0A2A4WE58_9GAMM  ali  21  24MDVLKSKTPDNFEKEILMYVIVFNVIRQLIYGASKDHKPSQYSFKSSVQTLLGYCSEYLSLNQLKQNLLTEIEFCVLYQRQGRVEPRELKRRTKP....... 123
430 8.000e-10UniRef50_R9L2H8 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium COE1 TaxID=1235793 RepID=R9L2H8_9FIRM  ali  24  141LENFSGKNPQAIRQELYAALFISNLSALIKNEIREELNRGRHRYQLNRSYIIGAVSRYIRCLINLQQLIQRAKNVRSIIRLDRHFKRKV............. 240
431 9.000e-10UniRef50_R9IJK5 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=R9IJK5_9FIRM  ali  27  19.ENFTGTKPILLLQDIYSTIYISNLAEDIIAELDEKERHRKHKMMINRTLSIGILKNDLIYILLETDIYEDISKNLVPIRPDRHYHRTK............. 120
434 1.000e-09UniRef50_A0A2N3AGN3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-1 TaxID=2013677 RepID=A0A2N3AGN3_9BACT  ali  19  7LEDFSGKTARAVKQDFFAKVFLLTLCAAYAHPIEEKDDKRKHPQKINRTNALSMTQDILIYKQALEAFDKIVASTREIICPGRSFKRKKRPEKTYSMNY... 119
436 1.000e-09UniRef50_UPI0006C92408 IS4 family transposase n=1 Tax=Herpetosiphon geysericola TaxID=70996 RepID=UPI0006C92408  ali  15  340...FRSQKPVGVIQEFYGLVLAHYAIRAVMHDAGT--YGACDPDRISFVLVVQEIQATLRHERLYQRLLDACSTMRLPKRRFRINPRVVKQKMTKFL..... 440
437 1.000e-09UniRef50_UPI0009DCD723 IS4 family transposase n=1 Tax=Verrucomicrobium sp. BvORR034 TaxID=1396418 RepID=UPI0009DCD723  ali  17  307MDMLRTRSPHMVARELLMHMIAYNVVWLLMAQA-EPLRDLESKGHLSFKGTRDRIDQWRQAQTWYVQMLQSIADDPVLERPFRREPRCLKRRPKNY...... 411
438 1.000e-09UniRef50_A0A1M3FWW5 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3FWW5_9SPHI  ali  22  15.DNFSGKTARNVKQDFYAKVFMMSICACLSHPIEQKAAKNRHPRQINRTSALAFYRKIWVYLWIKPKLSKFLAKTTDIVRPGRKFERKKLPKKPPSMQY... 124
439 1.000e-09UniRef50_A0A1S2LYF9 Uncharacterized protein n=1 Tax=Anaerobacillus alkalilacustris TaxID=393763 RepID=A0A1S2LYF9_9BACI  ali  23  2............EQDFYASVYLGNMMALLKHEANEKIKDLKHKYEVNANILVGKLKNSLILMFLEKQIMQEIVRNKVPIRPGRSFKRNMGLKANKYSLNRK. 106
441 1.000e-09UniRef50_A0A2U8E2U0 Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E2U0_9BACT  ali  14  84LDVARCLTPGMVEKEIWMQAIAHNTVRALMLEAAKTHGADVER--LGFMGAVDAMRAWAEWLRLLLEMLLAIASDQVPFRLGRSEPCAKKRRPKSH...... 186
442 1.000e-09UniRef50_A0A2N3ILX4 IS4 family transposase (Fragment) n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N3ILX4_AERSO  ali  20  128..TLRSKKAAGIRQELWGVLLAYNLLRSQMVKMAASLKGYTAS-QLSFHMASVYLIHELSCMPRVAELEKQAGQFVLPARRERSYPR............... 220
444 1.000e-09UniRef50_A0A1Z7ZXB1 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7ZXB1_9GAMM  ali  18  199.EDFHSHSERGVLQECYAHLLMLNIARIFENEANKHLPDLSKDKSITIKSQDNYWKDFLIRCYWLDNLIQGISRIRQKIRRGRHEPRVSRRPLRKW...... 323
445 1.000e-09UniRef50_UPI00064DD9B3 IS4/IS5 family transposase n=2 Tax=Ornithinibacillus californiensis TaxID=161536 RepID=UPI00064DD9B3  ali  21  177LQKFTGDTPLSVEQDYYATMFLSNMASFMAHEVDEEGKNLEYLYKSNTNIIIGKLKSNLIHLILYKQLLEEAKRSRIPIRPGRSYKRRTR............ 282
451 2.000e-09UniRef50_A0A090KIM0 Uncultured bacterium genome assembly Metasoil_fosmids_resub n=2 Tax=root TaxID=1 RepID=A0A090KIM0_9BACT  ali  16  345MDVLRCTTFTGVMKELQMFVVAYNLVRRVMVEAGQRQQ--VEPNRVSFVDALRWLRHAEPGEALP-------RLKVNPDRPGRVEPRARKRRPKSY...... 431
452 2.000e-09UniRef50_I5AWD9 Transposase family protein n=2 Tax=[Eubacterium] cellulosolvens 6 TaxID=633697 RepID=I5AWD9_EUBCE  ali  26  332.ENFTGSKPVIIEQDVYATGYLYNIMVDIMQDADTERTDYKHPLQINRNIAIGLMKEAVIRLLLTEDLITEINRFLLPVRPGRSCYR............... 431
459 3.000e-09UniRef50_UPI0009E967E7 IS4 family transposase n=1 Tax=Burkholderia sp. MSMB1078WGS TaxID=1637900 RepID=UPI0009E967E7  ali  17  141..TLRSRTVEGVDQEIWGALIAYNLIRREIA--SASWEARLDLTDISFVRAFHVIQHEMMWPAWLNRLHARLAFEIVEKQRGHKCPRVVKALPQRY...... 242
463 3.000e-09UniRef50_Q82QY0 Putative IS4 family ISFsp6-like transposase n=20 Tax=Actinobacteria TaxID=201174 RepID=Q82QY0_STRAW  ali  20  331..VLRSQDVAGIQQELWAHLTVYQALRRAMVEAVETLPGT-DPDRASFTVALETAKEQLITAANPGRITSALLHDLLPPRQARVNPRRVKCPISRY...... 429
464 3.000e-09UniRef50_V4I0S6 Transposase DDE domain protein (Fragment) n=3 Tax=Pseudoalteromonas luteoviolacea TaxID=43657 RepID=V4I0S6_9GAMM  ali  20  181..TLRSKKPELVIQELYGMLIAYNLIRHEAALAGKQVKVRGAQISFKTTMSMATTNSIHTLPKRLKDLTDTVKDFILP-KPDRNYPRAVKMKKKEFPVKR.. 286
465 4.000e-09UniRef50_T0YKU7 IS4 family transposase (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0YKU7_9ZZZZ  ali  11  1MEVLSCKTPEMCEKELWVYLLAYNLIRLLMARAAVQAG--VHPRQLSFKHTAQLWTEWVAQGL....................................... 61
468 4.000e-09UniRef50_G2G171 Transposase DDE domain protein n=1 Tax=Desulfosporosinus sp. OT TaxID=913865 RepID=G2G171_9FIRM  ali  19  323.EKFTSSIPQLIEQDFFSSVLAYNIVQSVKNEAEQTINQTEYKYEINENMAIGFVKNDLIRLQMYDAMLTKVARHKVPIRKGRKFPVKFKTDNNNSIN.... 431
469 4.000e-09UniRef50_A0A0F9IVB0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9IVB0_9ZZZZ  ali  20  334.ENLRSLSKDGIFKEISIRITLGNLIRLIILEAGKSEGLNKTLEKVTDTILIMIRSSVYSWPFIYRRMIEEIRQFKIIKRPNRSFPRHKKRK.......... 431
470 4.000e-09UniRef50_C7RIX6 Transposase IS4 family protein n=2 Tax=Candidatus Accumulibacter phosphatis TaxID=327160 RepID=C7RIX6_ACCPU  ali  14  256LEHLSGMSWLAARQDFGAKILCDNINALAVHAASESDPNTRASYFINRGDTFSRIKRTLGRLDNITSVFNELIKNLVQIKPNRSYPRKFTQKPHLSHAY... 363
471 4.000e-09UniRef50_A0A0P9I817 Transposase DDE domain protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0P9I817_9GAMM  ali  18  138...LRSQSVEGIEQEIRGILIAYNLVRLEISRIAKEAK--VSPLRISFMMALRDIQDELMWCAILRAMRERVKRYILPERKKRPKSRTVRISKTRYPI.... 239
472 4.000e-09UniRef50_A0A1M7LC01 Transposase DDE domain-containing protein (Fragment) n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A1M7LC01_9FLAO  ali  25  320.EEFSGYSNQSILQDFYATLLVSNIQSLIVGELNEELQEKKYHYKVNTSLSYGFLKDRVLSLLFSKDLKMLFRNHLIPIRPDRANKRNIGKYRAR....... 425
473 4.000e-09UniRef50_F5P238 Putative transposase n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=F5P238_SHIFL  ali  20  100..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMVMRMLMTLQRIPELMRDLASMKLPTRRGSEPPRESWR........... 196
474 4.000e-09UniRef50_G8X798 Transposase DDE domain-containing protein n=5 Tax=Flavobacteriales TaxID=200644 RepID=G8X798_FLACA  ali  28  213VEEFSGYSNQSIMQDFYSTLFVSNIQILIESERKEEQKNRKHEYKINTSLSYGFMKDRILELFIINELKKLFKDHLIPIRPNRGFERKIKYRGRI....... 320
475 5.000e-09UniRef50_K0NLE6 Predicted transposase, IS4 family n=1 Tax=Desulfobacula toluolica (strain DSM 7467 / Tol2) TaxID=651182 RepID=K0NLE6_DESTT  ali  19  225..NFSGESALSVYQDFHSKIFTKNLIWVLASPTEEAVKQNKHEQQLNMTQAISKSKDTLILLFLIQQIHSVFMNATEPIRPGRKFKRKHKVNKREYHMN... 334
476 5.000e-09UniRef50_UPI000983C37E hypothetical protein n=1 Tax=Clostridium saccharobutylicum TaxID=169679 RepID=UPI000983C37E  ali  20  57.EEFSGTKPIAIEQDFYASIYISMVAALIKKDADAKDKNLKSEYQANRNFILCDVLKKIIVMRILEHILEKAKKIRSQIRPNRNCERKNKHPRKKHHSQRKS 171
477 6.000e-09UniRef50_UPI0005838151 IS4 family transposase n=1 Tax=Chromobacterium piscinae TaxID=686831 RepID=UPI0005838151  ali  17  204..TLRSRAPETVRQEVWGALLAYNLVRLEMAEVAREVGVV--PTDLSFTTALHYLRYEWSWLAIPGTLPARLLRLREKQRRGRECPRVVKKLPSCY...... 305
480 6.000e-09UniRef50_UPI000307F62F hypothetical protein n=1 Tax=Anabaena sp. 90 TaxID=46234 RepID=UPI000307F62F  ali  20  24...FRSKTSELVEQELYAMLIAYNLLRDLIYQSANEYN--KNPLLLSFLESLQLVIDLVQLISHSSLKLREIQHQYLRPRRKRINPRVVKIKMSK....... 123
481 6.000e-09UniRef50_A0A162AJE1 Uncharacterized protein n=1 Tax=Pseudoalteromonas luteoviolacea NCIMB 1942 TaxID=1365253 RepID=A0A162AJE1_9GAMM  ali  16  44..TFRSRLPELVKQELWGILLTYNLIRYQMTQMCMMLKGDYLPYQLSFNGALDHIMSLIIGLP....................................... 104
482 6.000e-09UniRef50_A0A1Q7BY78 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 13_2_20CM_2_71_6 TaxID=1803494 RepID=A0A1Q7BY78_9ACTN  ali  18  346..VLRSRTPDGVIQEIYAFLVIY--QALCTLQHRAATTENIDPDRISFLVTIRTARADLIQYVTPHEVITTILEDRLAQRRSRTSPRQRRPPANKYPSKR.. 449
484 6.000e-09UniRef50_UPI000C14B592 IS4 family transposase n=4 Tax=Parabacteroides sp. Marseille-P3668 TaxID=1944636 RepID=UPI000C14B592  ali  23  323VECFSGISPVSIEQDFYANIFVFNLQAVIEESCEEVNRQRTIKYKINKNVCWALMKGRVIDLFLLKELTSLFERYLEPVRPGRKYTRTKKSIK......... 427
485 6.000e-09UniRef50_I6H5Z7 Putative transposase n=5 Tax=Enterobacteriaceae TaxID=543 RepID=I6H5Z7_SHIFL  ali  20  59..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMVMRMLMTL........................................ 117
486 7.000e-09UniRef50_G4L1Y5 Putative transposase n=1 Tax=Oscillibacter valericigenes (strain DSM 18026 / NBRC 101213 / Sjm18-20) TaxID=693746 RepID=G4L1Y5_OSCVS  ali  36  1...................MTAFNFASRVCREVVIRRPEGIYAYKVNFKMAVALCKEYIRTPKDGDKLMENIARYTVPVRPGRQDQRDLCVREFPGFVYRVA 85
489 8.000e-09UniRef50_A0A1Y4QQH0 Uncharacterized protein (Fragment) n=1 Tax=Massiliomicrobiota sp. An142 TaxID=1965564 RepID=A0A1Y4QQH0_9FIRM  ali  26  202MEKVTSEKAELILQELHSQVIVHNLAAMIKKESDKLITHEKYNYQTNINNLIQLLRANLAKLLNMKDIIRKASKNKEPIRPNRLFGRNVYTKKPTTLKYRV. 312
490 9.000e-09UniRef50_A3ZMM8 Transposase insG for insertion sequence element-like protein n=1 Tax=Blastopirellula marina DSM 3645 TaxID=314230 RepID=A3ZMM8_9PLAN  ali  19  342.ENLRAKSVEMVMKELMGSVIAYNLVSQLR--RGAAKLARVEPRRLSFTGVWRSCETFEQWSKAFTKALVSASKRRLPNRKSRSYPRVAHPRRAK....... 443
491 1.000e-08UniRef50_A0A0P9TNG8 Plasmid stability/partitioning protein n=2 Tax=Pseudomonas amygdali TaxID=47877 RepID=A0A0P9TNG8_PSEA0  ali  20  167VEDFHSQTERGVKQEIYGHFLLINLARLFETDTRNRLPCDDQPLKINFKHCLFVVGRHLENLVLMPKAMVAVARIRQRKRPGRQYPRRFKPRTR........ 285
494 1.000e-08UniRef50_UPI00030C5552 IS4 family transposase n=1 Tax=Pedobacter arcticus TaxID=752140 RepID=UPI00030C5552  ali  25  324LESYSGQKVNTIQQDFYCSVFLANLQTVISKACEPINKKRLHDYKINQNIAIGIMKNRIIDLFIHQELEKLFSKYVEPVRNNRKNPHVQKFQRRKG-KYR.. 433
502 2.000e-08UniRef50_A0A0Q8NQB0 Uncharacterized protein n=4 Tax=Streptomycetaceae TaxID=2062 RepID=A0A0Q8NQB0_9ACTN  ali  20  352...LRSKTPELVCQEVYALLTVYQALCALEVHAAEQ--GQVDPDRISFTTTVQLARLKVTLHTARREVVQELLNDLLPQRRDRRCQRVKKPPKN........ 449
503 2.000e-08UniRef50_UPI000B85A7FE hypothetical protein n=1 Tax=[Clostridium] populeti TaxID=37658 RepID=UPI000B85A7FE  ali  45  55LCNFHSYKPEYIEQEIWAKLIAYNITEVMINHTVLEKHDTKHEYKVNF...................................................... 102
504 2.000e-08UniRef50_A0A1G8JFI7 Transposase DDE domain-containing protein (Fragment) n=5 Tax=Pseudomonas benzenivorans TaxID=556533 RepID=A0A1G8JFI7_9PSED  ali  16  67..TLRSKVKELVYQEVWGLLLAYNIIRREAGQAAVAFGRS--PCDIRFKPVAQYIAVQLIVMRRLSELRAGIGGLFLDHRPRPSRPRTVKISKTRYPVDRKA 174
505 2.000e-08UniRef50_A4BUY0 Uncharacterized protein n=1 Tax=Nitrococcus mobilis Nb-231 TaxID=314278 RepID=A4BUY0_9GAMM  ali  21  136MERLRCKSPERVRKEIAAHLLAYNLVR--ANLNRAAQCFEKIPRQLSFKSALQLLNNAASQLLLLTALLQAMA--LSPIRQKRPQPRAVKRRPKPYPL.... 240
506 2.000e-08UniRef50_A0A0K2L2R3 Uncharacterized protein n=15 Tax=Piscirickettsia salmonis TaxID=1238 RepID=A0A0K2L2R3_PISSA  ali  17  1..........MVHKEIAVHFLAYNLIRTLIAEAC--RNTERLPIQVSFKGVIQLFNSFVSLLSFSADLLHAIIKNKVGNRLGRIEPRAVKKRPK........ 89
507 2.000e-08UniRef50_UPI000B85FB8A hypothetical protein n=1 Tax=Fontibacillus panacisegetis TaxID=670482 RepID=UPI000B85FB8A  ali  51  37LTNFHAKRRESITQEIFARMIMYNFAEMMTSYVVISQMDKRHPYQVNFTVAVHFAKTFCR.......................................... 96
509 3.000e-08UniRef50_A0A1F8TZ03 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWB2_37_7 TaxID=1797677 RepID=A0A1F8TZ03_9FIRM  ali  22  2..........LLQQDFYATIYLSNLMTMAKNEANQEQEGLKYDYKVNMNILIPRMTRTLIKSFYEEDAMKKITKNLVPIRPNRSFPRREPSRKNKYPSN... 104
513 3.000e-08UniRef50_UPI0009704912 hypothetical protein n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=UPI0009704912  ali  20  58LDVLRSRSAGMIRKELAAATIAYNLV--ILVRKLAAAEARVEPRRLSFARVRSLVKALLPQRLSIDQVLRMAAQCKIPHRPGRSYSREAFVKPTKYP..... 162
516 3.000e-08UniRef50_UPI000B44BDA7 IS4 family transposase n=1 Tax=Paenibacillus donghaensis TaxID=414771 RepID=UPI000B44BDA7  ali  17  207.ENFSAETPQLIEQDFYATVLVSNLASIFMCEKNRTQTLKYSEYRINKNILVGKLRNRLIEMVLEEDFLEELQRNIVPVIDGRTFKREKQSKSNK....... 317
517 3.000e-08UniRef50_A0A1Y4W077 Uncharacterized protein n=6 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A1Y4W077_9FIRM  ali  25  329MERITSEKPELILQEMHSQVLVHNLAAMIKKESDIVVHTPKYKYQTNINNLIQLLRANLPKLLNQKQKIKELLENKEPIRPNRLYPR............... 424
518 3.000e-08UniRef50_UPI000A06A762 IS4 family transposase n=1 Tax=Desulfatirhabdium butyrativorans TaxID=340467 RepID=UPI000A06A762  ali  23  199.ENFTGKSVLSVYQDFHARVFSKNITAMLARLSIEQENDKRYPYQINFTQAISKMKDTIILLFNRPALHDLFVKTVEPVRPN.................... 291
519 4.000e-08UniRef50_A0A1G4AGL7 Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8 TaxID=1802434 RepID=A0A1G4AGL7_9BAC  ali  16  323LDETYPKMPATAHRRIWAHALAYNLMCCLLADVAAKHNVPRNRLSLKDALTAGLGLRVTTLLEAWEWVADRVARDLLPDRPDRIEPRALKRRPKP....... 420
520 4.000e-08UniRef50_UPI0002F06777 hypothetical protein n=2 Tax=Thiorhodovibrio sp. 970 TaxID=631362 RepID=UPI0002F06777  ali  18  55MENLSGRSSLAVRQDMHAKVLAMNLAAMLRAVAQLVAKRRRFDYQVRMTSALSHLSDQLFHLLLIIRIIQRLSQTTEQVRPERSFPRHNKRKAGYSIPY... 168
521 4.000e-08UniRef50_A0A1E3WZ37 Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E3WZ37_9GAMM  ali  17  46...LRSLKQEGIYQELWGILTSYNIVRLKMAEMAKAHK--VEPLRISFINALYLIQDEFLWCKKLKELRENGKRLILPEKRKRKYPRAVLAKTQKYPV.... 148
522 4.000e-08UniRef50_A0A0F5IQX5 Uncharacterized protein n=2 Tax=Parabacteroides sp. HGS0025 TaxID=1078087 RepID=A0A0F5IQX5_9BACT  ali  23  190.ECFSGINPISIEQDFYANIFVFNLQAVIEKGCEEVNRQRTIKYKINKNVCWALMKGRVIDLFLLEELTSLFERYLEPVRPGRKYLRTRKSIK......... 293
523 4.000e-08UniRef50_UPI000C9A480D hypothetical protein n=1 Tax=Streptomyces noursei TaxID=1971 RepID=UPI000C9A480D  ali  14  10..VLRSHDPAGVEQEMWSLLTLYQVLRRTMVQAAESQPGT-DPDRCGFTVALQTARDLLVGAGVFEQGIGEIGRRVLPARRGRVSTRKVKSPISRY...... 107
524 5.000e-08UniRef50_UPI00087F5639 IS4 family transposase n=1 Tax=Pseudomonas sp. NFACC37-1 TaxID=1566196 RepID=UPI00087F5639  ali  11  277LEALSCKTPDMAVKELWIYLLAHNLIRMLMMQSALLADC--LPRELSFKHSLQLCLAWRQYEAQEQELLELIAQKR.......................... 355
526 5.000e-08UniRef50_UPI000D3D04A7 hypothetical protein n=1 Tax=Limnohabitans sp. WS1 TaxID=1100726 RepID=UPI000D3D04A7  ali  19  1..........MVRKEIAVFLLTYNLVRWSM--MRAAQLVKVAPRDLSFTGARRLLLAFASRMSLTATLLRKISECVLPKRPGRIEPRAKKRR.......... 89
528 6.000e-08UniRef50_UPI00035E5BE3 hypothetical protein n=1 Tax=Paraburkholderia tuberum TaxID=157910 RepID=UPI00035E5BE3  ali  22  22METLRSQTVQGISQELLGAPIAYNLIRLEIAKAAL--DAGYAPEDLSFIRASHIIQYEMTWPALLTRLRERLKQLPNKKRPGRTRARAVKSRPLRYFLKR.. 133
529 6.000e-08UniRef50_A0A1G0GVP7 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_40_19 TaxID=1798281 RepID=A0A1G0GVP7_9GAMM  ali  21  1MDILRGKTPEMVRKEIWAHILAYNLVRKMMAQAAVMYE--KNPRQLSFKLAF--CPRKIMMCMTYFFVLLHIKKQRI......................... 73
530 7.000e-08UniRef50_W6QWG9 Transposase for insertion sequence element IS231C n=2 Tax=Pseudomonas pseudoalcaligenes TaxID=330 RepID=W6QWG9_PSEP5  ali  22  44LDNFSGRSVTAVKQDFHAAQLLKNLALLMQHVIEQRHKGRKLRWKVNFTQGVSRLKNTLVELLVLSNVLALMAKSLSAVRSGRSFARQRKRAASR....... 148
531 7.000e-08UniRef50_UPI000486A7BD IS4 family transposase n=1 Tax=Ruania albidiflava TaxID=366586 RepID=UPI000486A7BD  ali  20  266..VLRGKHPAAVTQEVWALLAAYQVLRIAISDTALARPD-LDPDRLSFTTALRTARDQIIQAATTIDLIGRIGAALLPARRTRTRQRVIKRAISKY...... 367
533 8.000e-08UniRef50_L0DFL4 Transposase family protein n=3 Tax=Singulisphaera acidiphila TaxID=466153 RepID=L0DFL4_SINAD  ali  18  342MDVLCCETVDGVLKELAVFTLAYNLVRSVMGESA--RLQGVDPDRIGLVDAVRWL-----IGTEEGDLSVLV---VNPSRRGRVEPRVKKRRAKQYML.... 429
535 8.000e-08UniRef50_A0A1I4VZI7 Uncharacterized protein n=2 Tax=Streptomyces sp. cf124 TaxID=1761903 RepID=A0A1I4VZI7_9ACTN  ali  15  58..VLRSHDPVGIEQEMWALLTLYQLLRRTMVEAAESQPGT-DPDRCGFTIALQAARDLLVCAGVFEQGIGEIGRRVLPARRSRVSTRKVKSPISRY...... 155
536 8.000e-08UniRef50_U5UFM5 Uncharacterized protein n=1 Tax=Streptococcus suis T15 TaxID=1340847 RepID=U5UFM5_STRSU  ali  44  35LTHFHAKKKEGILQEIYDRFINFNVCKWLTSHVAIKPSKLKQAYKICFSDAVYACRKFLRDKL....................................... 97
539 9.000e-08UniRef50_UPI000983CA6A hypothetical protein n=2 Tax=Clostridium saccharobutylicum TaxID=169679 RepID=UPI000983CA6A  ali  20  22.EEFSGTKPIAIEQDFYASIYISMVAALIKKDADAKDKNLKSEYQANRNFILCDVLKKIIVMRILEHILEKAKKIRSQIRPNRNCERKNKHPWKKHHSQRKS 136
540 9.000e-08UniRef50_UPI000D6B416F IS4 family transposase n=3 Tax=Gemmata obscuriglobus TaxID=114 RepID=UPI000D6B416F  ali  16  319LDQTRGRTVPMVEKELGAALLAYNLATQVR--RVAAAARGVEPRRVSFAGVWSLVRAMVPMLRWFERLVKAAGQRLVPARPGRQYPCELIPKRRGYP..... 424
541 9.000e-08UniRef50_A0A1H2KF04 Transposase DDE domain-containing protein n=7 Tax=Jiangella alkaliphila TaxID=419479 RepID=A0A1H2KF04_9ACTN  ali  20  346...LRSKSPDLVDQEIYALLVTY--QALCTLRTDAADTVGVDPRRISFTITIRVTRDTITAGRLDQNAIAAISSDLNPPRRARVTQRVKKPPRNTFKAKR.. 444
542 9.000e-08UniRef50_UPI0003814895 hypothetical protein n=1 Tax=Singulisphaera acidiphila TaxID=466153 RepID=UPI0003814895  ali  18  14MDVLCCETVDGVLKELAVFTLAYNLVRSVMGESA--RLQGVDPDRIGLVDAVRWL-----IGTEEGDLSVLV---VNPSRRGRVEPRVKKRRAKQYML.... 101
543 1.000e-07UniRef50_UPI0009F53481 IS4 family transposase n=1 Tax=Jiangella alkaliphila TaxID=419479 RepID=UPI0009F53481  ali  20  260...LRSKSPDLVDQEIYALLVTY--QALCTLRTDAADTVGVDPRRISFTITIRVTRDTITAGRLDQNAIAAISSDLNPPRRARVTQRVKKPPRNTFKAKR.. 358
549 1.000e-07UniRef50_A0A257W9V6 IS4 family transposase n=1 Tax=Planctomycetales bacterium 12-60-4 TaxID=1970541 RepID=A0A257W9V6_9BACT  ali  20  340.EGIRARSVDMFHKELFASIVSYNLVTQFRRQAAAMINQP--PRRMSFKRTWTTFREFLLWREQYRTALNYATKDKLPDRPGRRYEREAYPKRPKSFKKRK. 448
550 1.000e-07UniRef50_UPI000C9A9386 IS4 family transposase n=2 Tax=Streptomyces noursei TaxID=1971 RepID=UPI000C9A9386  ali  18  215..VLRSKTPTLVNQEIWAYLVTHQAIRRTIAATDHRLDADRLPFTVALTVARDTIRTTVRTGTHLAEMTASLLANLGPERRLRVCPRAVKRPNAIYP..... 313
551 1.000e-07UniRef50_H1MWA6 Transposase family protein n=3 Tax=Singulisphaera acidiphila TaxID=466153 RepID=H1MWA6_SINAD  ali  12  331LEEMRGRSTEMVAKELASATVAYNMANLIR--RMAAARVEIAPRRLSFNRVWSLVKVLLLESLDTTDVLRMSGQCKLANRPGRHYPREVIARRRKFPL.... 436
552 1.000e-07UniRef50_A0A2P8B3U3 Uncharacterized protein n=1 Tax=Micromonospora sp. MH33 TaxID=1945509 RepID=A0A2P8B3U3_9ACTN  ali  21  66..VLRSPIPALIAQEIYALLTIYQVLRIAITDT-TDAAGGVDPDRASFTTAVQTAKDLIVQAATTIDLIGTIGRHLLPTRRLRVSPRAVKRPLSRY...... 167
555 2.000e-07UniRef50_A0A2M6GG58 Uncharacterized protein n=1 Tax=Cytophagales bacterium CG18_big_fil_WC_8_21_14_2_50_42_9 TaxID=1973956 RepID=A0A2M6GG58_9BACT  ali  23  48LENFSAKTVLGVQQDFQAHLLAANLSALLVADANQEDKHHQHCYKVNRAVALGLVQDNLASLLLYDRIKQKIKRRKQAIRPNRSYPRKRKLNYKFHLNKR.. 161
556 2.000e-07UniRef50_UPI000831D0C4 hypothetical protein n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI000831D0C4  ali  17  66...LRSGDPVGVEQEMWALLGLYQALRIVMVDAAESRPGT-DPDRCSFAIAFHTARDQVVTSGLLGRIGVRILGHLLPRRRQRVSTRKVKSPMSRY...... 167
558 2.000e-07UniRef50_B6FJ10 Uncharacterized protein n=3 Tax=Lachnospiraceae TaxID=186803 RepID=B6FJ10_9FIRM  ali  35  1..........................MLIAQHVKPKEKDLKYKLQINFTQAAKICLNFFRYKGKEPDIEATIQRFLLPIRPNRKRQRVSVSTCVVSFNYRLA 78
559 2.000e-07UniRef50_B2IXJ5 Uncharacterized protein n=2 Tax=Nostoc TaxID=1177 RepID=B2IXJ5_NOSP7  ali  16  163MDVLRCKTPSMVRKEIYVYLLAYNLLRGLMWSSGTTYRTP--PLRLSLQATCHHLNNFIPELL....................................... 223
560 3.000e-07UniRef50_A0A2X4LXZ3 Insertion element 4 transposase N-terminal n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2X4LXZ3_SALCE  ali  12  331..TLRSRFPEGVKQELWGILVSYNLLRKEMTDIAAEAG--VAPTRISFVAALNILVSQVRIPKHLKGMRENVKFFILPERKHRRYDRSVLYVPPKYP..... 433
562 3.000e-07UniRef50_A0A2V5TZQ5 Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5TZQ5_9BACT  ali  19  2LENFSGQTTEAVRQDFFATLFLCNVESVLTQALREQSAGDKHPKQVNRGVAYHALKDQLLDLLYSEKLQRMFLGAAVAVRP..................... 94
563 3.000e-07UniRef50_A0A1Q7UM41 Uncharacterized protein (Fragment) n=1 Tax=Cyanobacteria bacterium 13_1_40CM_2_61_4 TaxID=1805101 RepID=A0A1Q7UM41_9CYAN  ali  13  339..TLRSLTANGVIQELYALLLAHTLVRTLM--LRAAQPQGLAPTTISFTDTIRLVDDSLVPLSLVSSLLQELGTFRLPKQQVRIQARVVKRVRSRY...... 439
564 3.000e-07UniRef50_E6LSL2 Uncharacterized protein (Fragment) n=2 Tax=Lachnospiraceae TaxID=186803 RepID=E6LSL2_9FIRM  ali  27  81.ENFTGIKSVLIEQDINSTIYVSNLAEDIICDIEESKNDYKHTMQLNRNLSIGLLKNDLIYILIEKDLYDEISKNVVPIRHDRHYHRTK............. 183
565 3.000e-07UniRef50_A0A0C2RBS0 Uncharacterized protein (Fragment) n=1 Tax=Rickettsia asembonensis TaxID=1068590 RepID=A0A0C2RBS0_9RICK  ali  21  332VEAFHSKTERGVKQETYAHFVLINLARLFELAAKAKYDKNSGNTKFNFKNCLNVIEQSIQTIIYKSELFYQISQIKQKIRPMRKYLRISHKPFNRWVLNR.. 440
566 3.000e-07UniRef50_A0A2N6FRJ6 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2N6FRJ6_9PROT  ali  22  322LENFTGLSALAIKQDFYATIFISNLETLVTLGTNKKLSKQKVNKSISFNIVKNYCFELFYSNKDIEIIFEEMSKNTISIRPNRKYER............... 419
569 4.000e-07UniRef50_D4TT91 Uncharacterized protein n=39 Tax=Cyanobacteria TaxID=1117 RepID=D4TT91_9CYAN  ali  16  339....RSKNPREVVQELYGWLLAHYCLRCLMFQSAT--LKNISPLRLSFVGSLRVIRRAIPINLYYSWLMAEISDLEIPLRQQRSNPRVVKKARSK....... 438
572 5.000e-07UniRef50_UPI0009111DE8 hypothetical protein n=3 Tax=Moritella viscosa TaxID=80854 RepID=UPI0009111DE8  ali  19  132LEDFHGHSERGVLQECYAHILMINIARIFESEADKEHQEPQDSYNINFKNCLLVLGRGLVKLIWINRLVQSISRIRQKIRRGRHVPRISRRAIRKW...... 257
576 6.000e-07UniRef50_UPI000789432F IS4 family transposase n=1 Tax=Grimontia marina TaxID=646534 RepID=UPI000789432F  ali  16  241...LRSQSVEGVIQEIWGLLIAYNLVRLEISRIAREAQ--VSPLRISFMMALRDIQDELMWCAILRAMRERVKRYILPKK...................... 324
577 7.000e-07UniRef50_A0A0F9GGQ1 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9GGQ1_9ZZZZ  ali  22  136...LRSRTPQSLAYEVAGHVLFYLLVRWMMVEAAIRHGE--DPLRLSFTAALRELSDLYEKLLLLPRLLARIASHLVPIRSGRHYCR............... 227
579 7.000e-07UniRef50_A0A2V2YVL0 Uncharacterized protein n=1 Tax=Paenibacillus cellulosilyticus TaxID=375489 RepID=A0A2V2YVL0_9BACL  ali  44  1...................MIKYNFAEMITSHVVISQIDTRHEYHVNFTVAVYVCRHFLRSREDPPDVEALIRKNILPIRPIRKKTRKVRWKSAISL..... 83
581 7.000e-07UniRef50_A0A1W1CML9 Mobile element protein n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A1W1CML9_9ZZZZ  ali  24  114VERFSGKTVESIKQDYYSRILVGNLHALIVEDAQAEKKLKYSKYKINKSISFGLLRGSLEWLKKYNDLVKKTKMYKVPIRENRTYER-IKNGNLKYSNN... 226
582 7.000e-07UniRef50_A0A2Y5A300 IS4 orf n=1 Tax=Shigella flexneri TaxID=623 RepID=A0A2Y5A300_SHIFL  ali  20  28..TLRSKKPELVKQELWGVLLAYNLVRYQMIKMAEHLKGYC-PNQLSFSESCGMVMRMLMTL........................................ 86
583 7.000e-07UniRef50_A0A1I5L1T9 Uncharacterized protein n=4 Tax=Enterovibrio norvegicus DSM 15893 TaxID=1121869 RepID=A0A1I5L1T9_9GAMM  ali  15  2.......KSEGIYQELWGILTSYNIVRLEMAAMAKEHK--VEPLRISFLNALYLIQDEFIWPNALKMLRENGKRLILPNKRKRKYPRAVLKRPAKYPT.... 100
584 8.000e-07UniRef50_UPI00099B6E23 hypothetical protein n=1 Tax=Streptomyces sp. XY413 TaxID=1519479 RepID=UPI00099B6E23  ali  13  82....RSRTPEGVRQELWAYLAVHHAIRQFAHTAALARPA-VDPDRVSYLRCVRIVRRSIPSQRSFTEAGWEARVRLLPARRGRDCPRAIK-KPNRWPVLR.. 184
587 8.000e-07UniRef50_A0A257RZS5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium 21-66-5 TaxID=1970506 RepID=A0A257RZS5_9DELT  ali  16  80.EDFRGKSAPLIDQEIAAVHLYCLLARILVMESALA--HGLLPSEIAQQAAFHATSRFLQALALLKDCLAEISWKRYKKRPGRIFPRKSRSRTGKW...... 182
588 9.000e-07UniRef50_A0A2W7LSU9 DDE family transposase (Fragment) n=1 Tax=Lachnoanaerobaculum umeaense TaxID=617123 RepID=A0A2W7LSU9_9FIRM  ali  26  222..NFTGVKSVLIEQDINSTIYVNNLAEDIICDIEESSQEHKHTMQLNRNLSIGLLKNDLIYILIEKDLYDEISKNVVPIRHDRHYHRTK............. 323
589 9.000e-07UniRef50_A0A1Y5KAQ4 Uncharacterized protein n=1 Tax=Paenibacillus sp. MY03 TaxID=302980 RepID=A0A1Y5KAQ4_9BACL  ali  41  1...................MIMYNFAEMMTSHVVISQMDKRHQYQVNFTVAVHVCRRFLRSRDAPPDVKALIRKTFCRFDP-FDQDRRIRAKS......... 73
590 9.000e-07UniRef50_A0A2H0FRW0 Uncharacterized protein n=1 Tax=Ignavibacteriales bacterium CG18_big_fil_WC_8_21_14_2_50_31_20 TaxID=1974047 RepID=A0A2H0FRW0_9BA  ali  22  48.ENFTGKSLETIKQDYYSMVLVGNLHSLIIADAQEEVDKKYEQYKINKSVTFGIMKEQINWKKQYKLLVRESKKYKIPVI---KFPKNKKGKSKIS-NY... 156
591 1.000e-06UniRef50_A0A238DR68 Transposase n=18 Tax=root TaxID=1 RepID=A0A238DR68_9BURK  ali  12  337..VLRSKTPELVQQELWGLLLAHFAIRQLMAQAA--WPRGLDPDRLSFTHAVRVIKRKLPQAAAVP.................................... 398
593 1.000e-06UniRef50_C5EN30 Uncharacterized protein n=1 Tax=Clostridiales bacterium 1_7_47FAA TaxID=457421 RepID=C5EN30_9FIRM  ali  32  1.......................................MKWEYQVNLSIAIKICFAFLSDHMGLGNVNGLISRYILPIRPDRTYARQLRFQSPASFTYR.. 61
594 1.000e-06UniRef50_A0A1G9U176 Uncharacterized protein (Fragment) n=1 Tax=Nonomuraea jiangxiensis TaxID=633440 RepID=A0A1G9U176_9ACTN  ali  22  63...LRAQHPDTVRQETYAYLIVYQAIRWVIVHAAA---GRLDPDRISFTRTLNAVRIAHTHPATLADIEATILRHLNPYRLGRIYPRAL............. 148
597 1.000e-06UniRef50_A0A1S5Y1J7 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1S5Y1J7_9BACT  ali  18  277LERFSGTSSLAIEQDFYGVIFLASLESILSKQRQAEQQQRKYAVQVNHAVSYLALVDYTVSLLLLEDLHRLFRMTPTPIRPGRKFPRDKTTK.......... 383
598 1.000e-06UniRef50_A0A1J5P696 Uncharacterized protein n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5P696_9ZZZZ  ali  17  100VEDFSGKTAIAVKQDFFAKVYMMTMCAILAFPIEEQXXXXXXXXXANYRDVMISVFIKRIYRPALEAFDNIVKKTTEIIRPSRLLPRKHRTKKQYHMNY... 211
599 1.000e-06UniRef50_Q32FF7 IS4 ORF n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=Q32FF7_SHIDS  ali  19  159..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMVMRCRALHRD...................................... 219
600 1.000e-06UniRef50_A0A1Y4WI61 Transposase (Fragment) n=1 Tax=Massiliomicrobiota sp. An105 TaxID=1965540 RepID=A0A1Y4WI61_9FIRM  ali  36  3.........................QRIVQEIKIPKKDRNKYTYRVNFTKSIHIIREFLRKKDKNPPVEYLIAKEILPIRPNRKYKRHVNPKTVVCFNYR.. 78
601 1.000e-06UniRef50_A0A238D0J1 Transposase n=3 Tax=root TaxID=1 RepID=A0A238D0J1_THIDL  ali  12  338..VLRSKTPELVRQELWGLLLAHFAIRQIMAQAA--WPRGLDPDRLSFTHAVRVIKRKMPQAAAIP.................................... 399
602 1.000e-06UniRef50_B2PVI2 Uncharacterized protein n=2 Tax=Providencia stuartii TaxID=588 RepID=B2PVI2_PROST  ali  16  61..TLRSKKPALVNQELWGIVLAYNLLRFMMAQMAYSLKDT-EPYQIGFKQTALYLSAQLSLLP....................................... 120
603 1.000e-06UniRef50_A0A0W0AW25 Transposase n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0W0AW25_AERSA  ali  15  246............RQD---ALLAYNLLRSQMVKMAASLKGYTAS-QLSFHMASVYLIHELSCMPYMAELEQQAGQFVLPARRERSYPRCVKPRPQKY...... 334
604 1.000e-06UniRef50_UPI0002FC9A89 hypothetical protein n=1 Tax=Candidatus Accumulibacter phosphatis TaxID=327160 RepID=UPI0002FC9A89  ali  14  2.......SWLAARQDFGAKILCDNINALAVHAASESDPNTRAHYFINRGDTFSRIKRTLGRLDNITSVFNELIKNLVQIKPNRSYPRKFTKQPHLSHAY... 102
606 1.000e-06UniRef50_A0A2S0VUC7 Uncharacterized protein n=1 Tax=Catenovulum sp. CCB-QB4 TaxID=2172099 RepID=A0A2S0VUC7_9ALTE  ali  24  227.ENFTGLTPLAIKQDIQAQVVSKNMATLWQVHVSERNKNCRRDYKVNFSYLLGKFKDNFVKSILGGKLVEQLSSSTHAFRPERCMERRPKK........... 327
607 1.000e-06UniRef50_C4Z7V9 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=C4Z7V9_EUBE2  ali  20  45..................QLFQCNFGIFIANEAAEENLKKKYLYELDFSSALKTARKFFMRRDSGRDIIRLMMKYVHAVKRFRQFQRPLRGISAIHFGYR.. 135
609 2.000e-06UniRef50_A0A2G6FFX1 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium TaxID=2044940 RepID=A0A2G6FFX1_9DELT  ali  19  24..NFSGTTVLSVCQDFHSKVLAKNLTWILSSPAQEANHDKTHEYQLNMTQAISKSKDTIFFLFLIKDLHAVFMAATEPIRPGRKF................. 119
610 2.000e-06UniRef50_UPI0009FFE7DE IS4 family transposase n=1 Tax=Actinospica robiniae TaxID=304901 RepID=UPI0009FFE7DE  ali  12  503..VLRSGSPELVLQEIWAHLTVNHALTRL--NGLLADERGRDPDEISFTKVLKEVRRSVIRQAAHTDIADDLRRYAHRPVPGRTAERTVKRSSHRY...... 603
612 2.000e-06UniRef50_A0A077LMJ2 Transposase IS4 family protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A077LMJ2_9PSED  ali  14  201..VLRSKKPELVKQEMWGFLLAHFAIRQLMIQAADKA--AIDPDRLGFTNAVWVVRRKLPQAAAFP.................................... 262
614 2.000e-06UniRef50_Q31YS4 IS4 ORF n=10 Tax=Bacteria TaxID=2 RepID=Q31YS4_SHIBS  ali  23  123..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMV............................................... 174
615 2.000e-06UniRef50_A0A1H8ICW3 Transposase DDE domain-containing protein n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1H8ICW3_9ACTN  ali  18  281...LRSGDPAGLEQEMWSVLTLYQLLRTVMVDAAESRPGT-DPDRCSFSIALHTARDLVIQPGDNPTIGRRVLAALLPSRRPRVSTRKVKSPTSRY...... 380
616 2.000e-06UniRef50_A0A2K8T3T9 IS4 transposase n=1 Tax=Nostoc flagelliforme CCNUN1 TaxID=2038116 RepID=A0A2K8T3T9_9NOSO  ali  17  1MDVLRCKTPSMIRKEIYVYLLAYNLLRGLMWSAGTTYATP--PLRLSLQGTRHHLNNFIPELCLTSNRLNL............................... 69
617 2.000e-06UniRef50_UPI000990A69B hypothetical protein n=1 Tax=Clostridium beijerinckii TaxID=1520 RepID=UPI000990A69B  ali  22  136.ESITGKTTVYVYQDFWAQIVIYNMIQDVLHEKETAKHEYKYPIQINENIAIGMFKEKFIKLLIEPQLQRAIEKYILPIRNLKSQERKH............. 239
618 2.000e-06UniRef50_E5VIR4 Uncharacterized protein (Fragment) n=2 Tax=Lachnospiraceae bacterium 5_1_63FAA TaxID=658089 RepID=E5VIR4_9FIRM  ali  29  1.....................LYNFTTTITQHLRYKRDRGKYQYKPNMTNALQMCKDYLRNAKTPNDVEGHILMEMTPIRDGRSFKRDKSRHQSVFTTFR.. 79
619 2.000e-06UniRef50_A0A2A9G1M9 DDE family transposase n=2 Tax=Amycolatopsis sulphurea TaxID=76022 RepID=A0A2A9G1M9_9PSEU  ali  18  363...LRGHTPIRAQQELWATLIVYQAIRLLISHAALTQN--LDPSRISFTSARDAAEHAITTPADTSRHLQWVAQDLCRHTHHRVYPRALKRTTTRYP..... 460
620 2.000e-06UniRef50_A0A1W9MP21 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9MP21_9DELT  ali  21  18LENFTGKTAESVKQDFYATIYLTGSESVLTREVNEELEEKEYQHKVNKAVSFNAIKNHVFNLILSEKPEALFRMNTICVRKGRKTERK-KQSSDRLLNY... 141
621 2.000e-06UniRef50_A0A2M7MB80 Transposase (Fragment) n=1 Tax=Piscirickettsiaceae bacterium CG_4_10_14_3_um_filter_44_349 TaxID=1974075 RepID=A0A2M7MB80_9GAMM :  ali  22  309..NFSGKTALSIQQDFFAKILVCNLTEIHCWAAQRKVNKRNQDYRVNFAQTTSKMKHWLVK......................................... 371
622 3.000e-06UniRef50_B2U2U0 IS4 ORF n=116 Tax=Gammaproteobacteria TaxID=1236 RepID=B2U2U0_SHIB3  ali  23  336..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGY-WPNQLSFSESCGMV............................................... 387
623 3.000e-06UniRef50_UPI00041D1F7C IS4 family transposase n=2 Tax=[Clostridium] methoxybenzovorans TaxID=81424 RepID=UPI00041D1F7C  ali  16  308LENFSGSSSQILRQDFYLTMFFSNLVSIMKRTVDEEIRCYQANRGFLINRIKKHLVKILLDMENVTETLELIKKIRSQIRLNRKYERKSKLTRRKHHHNRK. 422
625 3.000e-06UniRef50_A0A106BHT1 Uncharacterized protein n=2 Tax=Thiobacillus denitrificans TaxID=36861 RepID=A0A106BHT1_THIDE  ali  12  32..VLRSKTPELVRQEFWGLLLAHHVVRKLMLEAALSRQRT--PDTLSFKHSLSLIRRKLP.......................................... 87
626 3.000e-06UniRef50_A0A2T2X083 Uncharacterized protein n=1 Tax=Sulfobacillus benefaciens TaxID=453960 RepID=A0A2T2X083_9FIRM  ali  16  138VENFSGQTPVVIQQDFHASILMSNRAAVAEQDAQAEIPARIDPYRINRNILIGKMKDRLIAIALEED................................... 211
627 3.000e-06UniRef50_R9KK23 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium A2 TaxID=397290 RepID=R9KK23_9FIRM  ali  50  18LNKLHSKKTAHIHQEIFAKAIIYNFCSVITMHVA.................................................................... 51
628 4.000e-06UniRef50_T1X716 Putative transposase, IS4 family n=31 Tax=root TaxID=1 RepID=T1X716_VARPD  ali  16  337..VLRSKTPDLVQQELWGLLLAHFAVRQLMAQAA--WQQELDPDRLSFMHAVRVIKRKLPQAAAVP.................................... 398
629 4.000e-06UniRef50_A0A2S2CEI0 Uncharacterized protein n=3 Tax=Photobacterium damselae TaxID=38293 RepID=A0A2S2CEI0_9GAMM  ali  20  56..TLRSRFPKGVKQELWGALLSYNLIRLEM--VSIAQDAKVEPTKISFTAAISLIDTQLRVLAVLPN................................... 118
630 4.000e-06UniRef50_A0A1V2ILS5 Uncharacterized protein n=1 Tax=Frankia sp. BMG5.30 TaxID=1834514 RepID=A0A1V2ILS5_9ACTN  ali  13  62...LRSKSPKMVRQEFWGLLLAHYAIRALMVEAA--DTDGIDPDRLSFQRTLNIVRRQITDQAAFSPLDTRAGDHQS-HRRD.................... 137
631 4.000e-06UniRef50_A0A1Q6L272 Transposase (Fragment) n=1 Tax=Clostridiales bacterium 36_14 TaxID=1897042 RepID=A0A1Q6L272_9FIRM  ali  18  189.EEFSGATTTSVLQEFYINVLLSNLSSLIKNQVDEEIQTNKYRYQANRAFIIGRVKTILFDLSVLDILYKESLRCRSQIMPGRTFRRKKKAIGRTHFNN... 299
633 4.000e-06UniRef50_A0A220U089 Uncharacterized protein n=1 Tax=Virgibacillus phasianinus TaxID=2017483 RepID=A0A220U089_9BACI  ali  25  127.ENFTGYTPLAIEQDFYASLYLINMVSLLKNEANEKGKKLKYTYKVNTSARLSYPLPYLVR......................................... 192
634 4.000e-06UniRef50_UPI000DD313E8 IS4 family transposase n=3 Tax=Methanosphaera sp. BMS TaxID=1789762 RepID=UPI000DD313E8  ali  25  325.ENFSGRRKIIIEQDFYSDVYVFNIATVIKHDANQQNKHQYKEYSTNFNIAVGLVKKELLNLLTPDKIFKILQKNLIPIK...................... 420
635 5.000e-06UniRef50_UPI0009EACF20 hypothetical protein n=1 Tax=Ruminococcus sp. AT10 TaxID=1720300 RepID=UPI0009EACF20  ali  79  86MLNFHSKKVVCIKQEIYAHLIMYNFAEM-------------------------------------------------PIKPGRHRERNLTAKIFHGFLYRVA 138
636 5.000e-06UniRef50_UPI000A01C82B IS4 family transposase n=2 Tax=Actinospica robiniae TaxID=304901 RepID=UPI000A01C82B  ali  12  375..VLRSGSPELVLQEIWAHLTVNHALTRL--NGLLADERGRDPDEISFTKVLKEVRRSVIRQAAHTDIADDLRRYAHRPVPGRTAERTVKRSSHRY...... 475
637 5.000e-06UniRef50_A0A143X014 Uncharacterized protein n=1 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143X014_9FIRM  ali  32  219MIYFHAINRVLIQQDTNTTFLMYNVSEVMINNIEIQKQNRRYRYKANFANAVTNIRLYLRNLLNEKNLIS................................ 289
638 6.000e-06UniRef50_A0A0D8FSH2 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A0D8FSH2_9ACTN  ali  19  103..VLRSKSPDMVTQEIYAHLLVYYAIRALINAAVEPQE--LDPDRVSFLASLRVIRRQVTDQAAFP.................................... 164
639 6.000e-06UniRef50_A0A119CVQ0 Uncharacterized protein n=18 Tax=root TaxID=1 RepID=A0A119CVQ0_THIDE  ali  12  340..VLRSKTPELVRQEFWGLLLAHHVVRKLMLEAALSRQRT--PDTLSFKHSLSLIRRKLP.......................................... 395
640 6.000e-06UniRef50_A0A2V4P9P3 IS4 family transposase (Fragment) n=1 Tax=Pseudomonas savastanoi pv. glycinea TaxID=318 RepID=A0A2V4P9P3_PSESG  ali  20  65..TLRSKKVELIYQEVWGLLLAYNIIRREASQAAVAFGR--APSDIRFKPACQYIAVQLIVMA....................................... 123
642 6.000e-06UniRef50_A0A1Q7ZUZ9 Uncharacterized protein n=1 Tax=Cyanobacteria bacterium 13_1_40CM_2_61_4 TaxID=1805101 RepID=A0A1Q7ZUZ9_9CYAN  ali  12  348LVQLECKSADMAQKEWFAGLMAYNLIRAAM--LCAALQEGISALVLSFSLSRRHLENWLVHGQRWDQMLRLIGQGRLPHRRKCREPRAQRHLRQPYP..... 452
643 6.000e-06UniRef50_A0A2B7ZUY6 Uncharacterized protein n=1 Tax=Candidatus Nephrothrix sp. EaCA TaxID=2044729 RepID=A0A2B7ZUY6_9BACT  ali  20  2..........AVKQDFHAKIFLLTLMAAYAHPVEQKDENRKYGQKINRTNAISMTPHILIAKKALEDFDLIVSKTQEIIRPERSSPRKKRPGRHYNMNY... 104
644 7.000e-06UniRef50_A0A1G5IQ92 Uncharacterized protein (Fragment) n=1 Tax=Butyrivibrio sp. INlla14 TaxID=1520808 RepID=A0A1G5IQ92_9FIRM  ali  19  82LEEYSGKTKTAVFQEFYINLLMSNLTSLIKNKVDDDIDEHKYRYQANRAYIIGRLKKAFPKILYIDQIVSDAFKVRSQIIPGRKFRRKTRKLRKHFPNLR.. 195
645 7.000e-06UniRef50_UPI000A015508 hypothetical protein n=1 Tax=Saccharothrix sp. ALI-22-I TaxID=1933778 RepID=UPI000A015508  ali  17  83...LRARTPDGIDQEVHALLTAYQALRLAMADATMNHP-TISPDRAGFTITLQTARDQIVRAATTVDLVGRIGRAVLPPRRSRVGPPVVKRAIFKHRAKR.. 187
646 7.000e-06UniRef50_A0A1Z4T154 Transposase n=2 Tax=Calothrix TaxID=1186 RepID=A0A1Z4T154_9CYAN  ali  18  2.....................AYNLLRAIMWEAADTNDVSK--RLISLQTSRQYLKSFITALFLYKTMLDKIVQKLLPERSDRTEPRVIKRRKKSYPL.... 85
649 8.000e-06UniRef50_A0A2G2CF13 Uncharacterized protein n=2 Tax=Sulfurimonas sp. TaxID=2022749 RepID=A0A2G2CF13_9HELI  ali  21  274LENFTGQSALAVKQDFFATIFLTNYESILTYDINESTKDNKYVQKVNKAVSFNVIKHKVFDLLILEQMEKLFLTNTIVIRPNRSKPR............... 373
650 8.000e-06UniRef50_A0A0M6WTT8 Uncharacterized protein n=1 Tax=Roseburia faecis TaxID=301302 RepID=A0A0M6WTT8_9FIRM  ali  27  93.............QEIYSRLILYNFSIFIANEAAEENQKNKYLYELDFSSALKTARKFFMRRDSGRDIIQLMMKYVHTVKRFRQFQRPLRGISAIHFGYR.. 188
651 8.000e-06UniRef50_UPI0006CF7335 hypothetical protein n=1 Tax=Cellulosilyticum ruminicola TaxID=425254 RepID=UPI0006CF7335  ali  33  1.....................MYNFSMSITLKMLLKEKDLKHHLQVFFTQATKICLHFFKLRKLEPDIEATIRRFLLLVRPNRQRQRVAVSTTVVSFNYRLS 87
653 9.000e-06UniRef50_W8KNR6 Uncharacterized protein n=1 Tax=Halorhodospira halochloris str. A TaxID=1354791 RepID=W8KNR6_HALHR  ali  23  1MERFRTRDRWNVYQEIYARFLTLILARQMTAHRFRDYCINFRATILRFREQFHALRRSQDPLASILELLAWIVRDQEMIRPGRSNPRKSK............ 101
654 9.000e-06UniRef50_A0A1R0ZRF1 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL A5-0031 TaxID=1920420 RepID=A0A1R0ZRF1_9BACL  ali  50  9..DFHAKRRESVTQEIFSRLIMYNFPEMMTSQVVISQKDKQHQYQVNFTVAVH................................................. 59
655 9.000e-06UniRef50_A0A2M6YLZ8 Uncharacterized protein n=1 Tax=Syntrophobacteraceae bacterium CG07_land_8_20_14_0_80_61_8 TaxID=1974095 RepID=A0A2M6YLZ8_9DELT :  ali  22  356..HLRSKRADLVKQEIYAIMIVYNHIRLIMSQAAEMHGEI--PLEISFVDSYQLVLEAIPEMRISEDMKKQTHSYLLR........................ 430
656 9.000e-06UniRef50_UPI000D6B4FD3 hypothetical protein n=1 Tax=Dyadobacter jejuensis TaxID=1082580 RepID=UPI000D6B4FD3  ali  30  3LEQFGCKSFYGIYQEFYAHLFSMNLVSIIGNQVKEKTKCRKLIYKYNWQNAFRLVRAQFVSLFYWGELE................................. 75
657 9.000e-06UniRef50_A0A1N6L913 Transposase, IS4 family n=1 Tax=Singulisphaera sp. GP187 TaxID=1882752 RepID=A0A1N6L913_9BACT  ali  12  337..QLRSETPAGVIQEVYALSLGHFVIRSLMFEAAATVG--LDPDRLSFTGCFQILKCRLPECDWYEGLLWEMQGERSEPRRNRINPRVI............. 430
658 1.000e-05UniRef50_A0A0C1R1V8 Uncharacterized protein n=1 Tax=Candidatus Jidaibacter acanthamoeba TaxID=86105 RepID=A0A0C1R1V8_9RICK  ali  22  274.DEFHSKTGRGVKQEVYAHLLLINLSRFFMNQEDKEKCSAFNFYNINFKNCLRVVSNYIENLFLYEELRNWILRIRQKIRPGRSFLRQFKPRK......... 394
660 1.000e-05UniRef50_A0A1I1AVP6 Uncharacterized protein (Fragment) n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1I1AVP6_9BURK  ali  14  1........................LIRMIMLQSAL--LADVLPRALSFKHTLQLWLATGDTLRHPNDFLALVAEQTIGNRPGRIEPRAIKRRPKPYPL.... 78
661 1.000e-05UniRef50_T1BQP7 Transposase IS4 family protein (Fragment) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1BQP7_9ZZZZ  ali  12  107..VLRSKTSDGVYQEAWGMLCVHYAIRALLCQAAHNSDIDPDRVSFTRTSIRRSVGDKVSLAAGILHATQEILEELLPRRRLRANPRVVRRKMTSFAVKR.. 210
662 1.000e-05UniRef50_I7KQM7 IS4 family transposase n=1 Tax=Lactobacillus gigeriorum DSM 23908 = CRBIP 24.85 TaxID=1423751 RepID=I7KQM7_9LACO  ali  31  15................................VPRQNTERKYKCQIDFKTACCIWRQYFSSNDFSDHLLLNMIAYLTPIRLGRKDQRNLKAKLVVSFPYRLA 88
663 1.000e-05UniRef50_K0KDK7 Transposase, IS4 family n=2 Tax=Actinobacteria TaxID=201174 RepID=K0KDK7_SACES  ali  15  258...LRSKSPDMVRQEIWAFLLTHYAIRSLMSRAADEAD--VDPDELSFIRTLRVVRRQVTAQADF..................................... 317
664 1.000e-05UniRef50_A0A1F8UPH6 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWD2_32_59 TaxID=1797680 RepID=A0A1F8UPH6_9FIRM  ali  17  306LQNFSGNSQLAVEQDFYATILICNLLALSKAEANKQEKVLKFEYKVNVNILISKLKNKLILAILEPKIMEIVSRYLVPVKLGKSFKRDKGLKANK....... 416
665 1.000e-05UniRef50_A0A1Z5H5R9 Uncharacterized protein n=2 Tax=Bathymodiolus platifrons methanotrophic gill symbiont TaxID=113268 RepID=A0A1Z5H5R9_9GAMM  ali  19  628VDDFHGRSERTVKQELFAHFVLITMSRLCTNESENLLNDPKQTIQANFKNSLATMSRHLEIKKVMDDIVSSISRNHQKLRPGRSYIRKSKKPVNKW...... 742
667 1.000e-05UniRef50_F4G7M4 Transposase IS4 family protein n=5 Tax=Proteobacteria TaxID=1224 RepID=F4G7M4_ALIDK  ali  12  339..VLRSKTPELVQQELWGLLLAHFAIRQLMAQAA--WNNGLDPDRLSFVHAVRVIKRKMPQAAAIP.................................... 400
668 1.000e-05UniRef50_A0A1I0HVW7 Transposase DDE domain-containing protein n=1 Tax=[Clostridium] lavalense TaxID=460384 RepID=A0A1I0HVW7_9FIRM  ali  21  165.ERFNSRKHNIVVSEIYGKILCFMLCGRFYEAADKENISRQYDYIPNMKYIADTIRVEHRLLIYLSDLVNDFSRCVVPVRPGRHYKRWGK............ 273
669 1.000e-05UniRef50_UPI0009DBC48E IS4 family transposase n=1 Tax=Treponema bryantii TaxID=163 RepID=UPI0009DBC48E  ali  14  324.ESVTGNASIYVEQDFLAQVYVYNMMEDVRHTAEEKLQKKMYPQRINQNVAIGIFKDELLDMALEENIQAEISKYTLPVRKSKSKKRQ.............. 424
670 1.000e-05UniRef50_U4QJH5 Uncharacterized protein n=1 Tax=Lactobacillus helveticus CIRM-BIA 953 TaxID=1226335 RepID=U4QJH5_LACHE  ali  53  8.LQFHSKQDKFIEMEIYAHMIMFNAISQI......................................................................... 35
671 2.000e-05UniRef50_A0A1G1LKK0 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RIFCSPLOWO2_12_FULL_50_11 TaxID=1801834 RepID=A0A1G1LKK0_9BACT  ali  17  335...FRSKSKTGVLQELYGLLLLYHVIRSFMQEAAAKYD--LAPRRLSFTDCVQILRRGVVRMQAYEDLLDEMTSTLLPERRNRINPRVVKKHQRKFP..... 435
672 2.000e-05UniRef50_A0A2L0NCG3 Uncharacterized protein n=1 Tax=Streptomyces sp. CB01881 TaxID=2078691 RepID=A0A2L0NCG3_9ACTN  ali  17  155..VLRSGDPQGLRQEMWALLTVYQLLRAAMLDATDALPGC-DPDRACFTAALRAARDTTTRAALTSPITEAVAGTLLPARRPRVGARTVKGVSARY...... 256
673 2.000e-05UniRef50_G4KYI6 Uncharacterized protein n=1 Tax=Oscillibacter valericigenes (strain DSM 18026 / NBRC 101213 / Sjm18-20) TaxID=693746 RepID=G4KYI6_OSC  ali  51  13.................................................................DNLMENIAAYTVPVRPGRQDQRDLRVKGFPGFVYRVA 49
674 2.000e-05UniRef50_UPI0009EB0C7F hypothetical protein n=1 Tax=Roseburia faecis TaxID=301302 RepID=UPI0009EB0C7F  ali  27  15.............QEIYSRLILYNFSIFIANEAAEENQKNKYLYELDFSSALKTARKFFMRRDSGRDIIQLMMKYVHTVKRFRQFQRPLRGISAIHFGYR.. 110
675 2.000e-05UniRef50_A0A1E4IDI0 Uncharacterized protein n=1 Tax=Pseudonocardia sp. SCN 72-86 TaxID=1660131 RepID=A0A1E4IDI0_9PSEU  ali  18  159..VLRSGDRAGLEQEVWALLTLYQLLRMAMT-TAVETRPGTNPDRASFTTALQATRDQLTAPDEPADLLGVIGQTLLPTRRARFSARKVKCANSRYL..... 263
676 2.000e-05UniRef50_A0A0A6ZR89 Transposase n=1 Tax=Shigella dysenteriae 1617 TaxID=754093 RepID=A0A0A6ZR89_SHIDY  ali  20  7..TLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYWPNRM......................................................... 49
677 2.000e-05UniRef50_M6VSS6 Uncharacterized protein n=9 Tax=Leptospira TaxID=171 RepID=M6VSS6_LEPBO  ali  19  3..................KILTFNLASLLIQEAQEEYDKTKYDYKINRNIAIGILKGELPRLLSFDEMKAVLIKHRLPVIPNRTFNRKHKVRKRKFEIYRVS 104
679 2.000e-05UniRef50_A0A221NSA9 Uncharacterized protein n=2 Tax=Streptomyces pluripotens TaxID=1355015 RepID=A0A221NSA9_9ACTN  ali  18  135...LRATDPEVARQELWAYLIVYQAIRLIICQAALR-GENADPSRISFTAARNAVRHSITTEAHCEQLYQDLSRCL--ITKHRTCPRMAK-RPLFHFPSRQA 237
680 2.000e-05UniRef50_A0A2V8UEM8 Uncharacterized protein (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UEM8_9BACT  ali  14  118MHSLSAQTPEMAEKELLLAIAGYNLVSSVQMQAAREAD--LEPRRLSFSRVQAVVMTALPRLATYKRVLGWAAQGKLPNRRQRSYPRAVWGR.......... 218
681 2.000e-05UniRef50_A0A1L9AKB7 Transposase DDE domain protein n=2 Tax=Wolbachia endosymbiont of Armadillidium vulgare TaxID=77039 RepID=A0A1L9AKB7_9RICK  ali  17  306LENFTGKSIETIKQDFWSTIFISNLESIMIEEETLSAQNSKLKKSINKSVSFNAIKNLAFDIFIMDRLSQLFLMNTLVVRKGRRVDR-HKISDIRSLNY... 413
682 2.000e-05UniRef50_R4Z675 Transposase n=3 Tax=Actinobacteria TaxID=201174 RepID=R4Z675_9ACTN  ali  16  48..VLRSKSPELVQQEIWGHLCCHFAIRTLMLAAA--HDAAVDPDRVSFVAALRITRRSLSQARGFP.................................... 109
683 2.000e-05UniRef50_A0A2G3JY84 IS4 family transposase n=7 Tax=Bacteria TaxID=2 RepID=A0A2G3JY84_9BURK  ali  20  337..VLRSKTPDLVRQEFYGWMLAHYAVRWLMH--SAARPGQKSPLDLSFTKTVHLFRR............................................. 389
684 2.000e-05UniRef50_A0A2G3J4I5 IS4 family transposase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2G3J4I5_9NEIS  ali  13  236...LRSKTPDLVKQEFWGLLLAHHITRKVMQEAGLKTDQIAND--LSFKQSLNIVRRKLPSSGAIP.................................... 296
685 2.000e-05UniRef50_C0B4F2 Uncharacterized protein (Fragment) n=6 Tax=Clostridiales TaxID=186802 RepID=C0B4F2_9FIRM  ali  29  1...................................................VNICRAYLKHGGDETETMLLIQKYLTPVRYNRKYPIHLSPKRNRDFMYRVA 51
686 2.000e-05UniRef50_UPI0002E5B4B2 hypothetical protein n=1 Tax=Coprobacillus sp. 8_2_54BFAA TaxID=469597 RepID=UPI0002E5B4B2  ali  52  21...FHARKRELIKQEIYARLILHNFCER.......................................................................... 45
687 3.000e-05UniRef50_UPI0006E1DC67 hypothetical protein n=1 Tax=Microbispora sp. GMKU363 TaxID=718014 RepID=UPI0006E1DC67  ali  21  49...LRSKLPELVNQEIFAFLAVYQALCSLKAEAARTAG--IDPDRISFTVAIRVARVHVGGRTSPAGLSQRLLEDLLPARRLRQCERVKKPPKN........ 144
688 3.000e-05UniRef50_A0A1Q3Q6X1 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 69-20 TaxID=1895696 RepID=A0A1Q3Q6X1_9ACTN  ali  12  349..VLRSKSPEMVRQEIWGILLAHYAIRALMTEAA--NDSDIDPDRLSFLGSLRVIRREADGSADFP.................................... 410
689 3.000e-05UniRef50_A0A1V6G1I1 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin070 TaxID=1852927 RepID=A0A1V6G1I1_9BACT  ali  19  331...LRSKTPDLVQQEIYGLLLAHFVVRAVLHEAALPIGE--DPDRLSFTHAVQVLRRRLPQ......................................... 386
690 3.000e-05UniRef50_A0A0F6A4I4 Uncharacterized protein (Fragment) n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F6A4I4_9GAMM  ali  15  85..TLRSNLPELIHQELWGLLLAYNLIRYKMV-LMAKSLKSVYPNQLSFRDASSHIIYKLTQMPIYPKIILDIERN........................... 161
691 3.000e-05UniRef50_UPI000365559B hypothetical protein n=1 Tax=Singulisphaera acidiphila TaxID=466153 RepID=UPI000365559B  ali  12  7LEEMRGRSTEMVAKELASATVAYNMANLIR--RMAAARVEIAPRRLSFNRVWSLVKVLLLESLDTTDVLRMSGQCKLANRPGRHYPREVIARRRKFPL.... 112
694 3.000e-05UniRef50_A0A0F9FBR3 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9FBR3_9ZZZZ  ali  17  333LSNLRSHSATGLLKEVLVQLTTNNVIRWVMAQAAAPPLCPVH---LKFLDAKRLILASVPAMTLYRQLLRDIGQRRILVRPGRSYPR............... 425
695 3.000e-05UniRef50_UPI0009DF71F9 IS4 family transposase n=1 Tax=delta proteobacterium PSCGC 5451 TaxID=1286376 RepID=UPI0009DF71F9  ali  18  251...WHCRTPTTFHQELLVHMIVVCLIRIAMLEASHLANASVS--QLSFARALTETRLFLKILLSSAEQNRWASKYRVKIKPNRHFPRDRQQYRTKS...... 351
696 3.000e-05UniRef50_N1WKX2 Uncharacterized protein n=1 Tax=Leptospira weilii serovar Ranarum str. ICFT TaxID=1218598 RepID=N1WKX2_9LEPT  ali  21  21LENVASKTSIRFLQEYYAKILTFNLASLLIQEAQIEYDKTKYDYKINKNIAIGILKGELPRLLS...................................... 92
697 3.000e-05UniRef50_UPI0009BA74B7 IS4 family transposase n=1 Tax=Pseudoflavonifractor sp. Marseille-P3106 TaxID=1871015 RepID=UPI0009BA74B7  ali  30  274..HFHAKKRPFIKQEIFSRMTFYNFASLLRLHTIFTQPEGTHVYHINAAFAVSSFLMYVFTKPPP..................................... 336
698 3.000e-05UniRef50_D4S2E6 Uncharacterized protein n=16 Tax=Clostridiales TaxID=186802 RepID=D4S2E6_9FIRM  ali  28  8..............................................SVSNAVNICRAYLKHDGNETESMLLIQKHLTPVRYNRKYPIHLRPERNRNFMYRVA 63
700 4.000e-05UniRef50_UPI00047C8DA9 hypothetical protein n=1 Tax=Selenomonas ruminantium TaxID=971 RepID=UPI00047C8DA9  ali  30  1...................MILYNFCMEITNHIKEQQKKWRYVYKLNISEALKTCHDFLKRAQHHKDIIGWILKAYCPVRAGRNYERKKSPHGAKSFNCR.. 91
701 4.000e-05UniRef50_UPI0006863932 IS4 family transposase n=1 Tax=Amycolatopsis orientalis TaxID=31958 RepID=UPI0006863932  ali  11  181..VLRSKSPEMVKQEIWGILLAHYAIRHLMLEAADTAD--IDPDRLSFIRSLRIIRRQITGQADF..................................... 241
702 4.000e-05UniRef50_A4T2G5 Transposase, IS4 family n=39 Tax=root TaxID=1 RepID=A4T2G5_MYCGI  ali  16  339..VLRSKSPDLVLQEIWGYLCCHYAIRSLMSQAAHHSGH--DPDRLSFTAALRVVRQ............................................. 391
703 4.000e-05UniRef50_A0A0R2YJQ4 Uncharacterized protein n=1 Tax=Pseudomonas libanensis TaxID=75588 RepID=A0A0R2YJQ4_9PSED  ali  19  74..........................................PRELSFKHSLQLFLAMRQYSCDEPDLLKLIAKKRVGNRPGRIEPRAIKRRPKPYPM.... 134
704 4.000e-05UniRef50_A0A1E4PWN7 Uncharacterized protein n=2 Tax=Thiobacillus TaxID=919 RepID=A0A1E4PWN7_9PROT  ali  15  2...LRSKTPDLVLQELWGLLRAHFAVRQLMAHAA--WPRGLDPDRLSFTHAVRVIKR............................................. 53
705 4.000e-05UniRef50_UPI000DCE05C6 hypothetical protein n=1 Tax=Photorhabdus TaxID=29487 RepID=UPI000DCE05C6  ali  26  37...LRSKKPEMVKQELWGVLLAYNLVRIAMIKAVKKTE--ILPNRLSFSIAHGM................................................ 85
706 4.000e-05UniRef50_M6BFC7 Uncharacterized protein (Fragment) n=1 Tax=Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee TaxID=1303729 RepID=M6BFC7_L  ali  17  17LENVAPKLQSDFFKNIMQKSYHINLASLLIQEAQEEYDKTKYDYKITRNIAIGILKGELPRLLSFDEMKAVLIKHRLPVIPNRTFNRKHKVRKRKFEIYRVS 136
707 4.000e-05UniRef50_B6FLV1 Uncharacterized protein (Fragment) n=1 Tax=Tyzzerella nexilis DSM 1787 TaxID=500632 RepID=B6FLV1_9FIRM  ali  46  67LTNFHAKKVEYILQEIFARLIIYNFCERIITKIVIQQKKSYAK........................................................... 109
708 4.000e-05UniRef50_A0A0F9DEC3 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9DEC3_9ZZZZ  ali  16  306.EDFHAKTERGVKQELFAHFVLISMNRLFANRADLELNGEDAHTQTNFKNCIHVLQRSLEELLLLEHKMDTIVRQYQKARPGRSYPRKSRK........... 421
709 5.000e-05UniRef50_A0A1H7B749 Transposase DDE domain-containing protein n=4 Tax=Cyclobacterium halophilum TaxID=1416801 RepID=A0A1H7B749_9BACT  ali  25  258VEQFGCRKPEGIYQEFFAHILAMNMVSLAAKSIKKTMKKRKLAYKYNWKNAYLSLRSSIVAL........................................ 323
710 5.000e-05UniRef50_A0A068ZAU1 Transposase n=1 Tax=Serratia symbiotica TaxID=138074 RepID=A0A068ZAU1_9GAMM  ali  18  108..TLRSRLPKLVRQERWGVLLMYNLVRYQMVRMAFHLKGNDLPYQLSLSGAISHITRLLITRCRWP.................................... 171
711 5.000e-05UniRef50_A0A0K2L587 Transposase n=1 Tax=Piscirickettsia salmonis TaxID=1238 RepID=A0A0K2L587_PISSA  ali  20  35MDHLRSKTPDMVHKEIAVHFLAYNLIRTLIAEAC.................................................................... 68
712 5.000e-05UniRef50_Q8FPL7 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=Q8FPL7_COREF  ali  14  166..VLRSKSPELVRQ<