current user: public

If you have questions about the server, please let us know.

Query: HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# E-value Template Links and tools%idFirst MPYRLLPNTDQARIRALKTAVVKGDMCDVYDLPVSLKTLGEARIFLSKFETAHSYYVHCYGEQSRNSKKHQANVKTARLYISHFIQVLNLAVIRMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIEGERKRTSQGGIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQLASMRVQADRLILDIWNQVEAKFQDVSPNEKRLEKCRDYGLIIIIGPEKNRIRRFFKICLSIHIPIFFWKSLQKITFRYGTCPCCRCDAYLYALast
1 0.000e+00UniRef50_A0A1Y1CI19 Uncharacterized protein n=7 Tax=Bacteroidia TaxID=200643 RepID=A0A1Y1CI19_9BACT  ali  42  1MPYRRLPNTDLARVRALKSALDISYRTNRFKLAFSFVLLQKVETFLPHYELAIRNHRQALSQQSIKSKQYNEKLRKARLYVSHFIQVLNFTIIRGEMKPEIREFYGLKTSSKAAPSLLQDAKVIEWGEKLMKGEQERMRTGGNPIYSPSIALVRVNCENFKEAFNDQKILQNNTHRFSEKVAEYRAEADSLILTLWNEVEAKFADLSDEEKR-GKASDYGIVYVWRKGEKE.......................................... 230
2 0.000e+00UniRef50_A0A1F3N7I0 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3N7I0_9BACT  ali  39  1MPYRRLPNTDAARIRAMRIALEKGREVHPSHMAFSPKTIVRLQRFLPQFENMIQLQRQCYASQNSKNKDYAEIIRKARLYLTHFIRVMNMAIFRGDLPVETRAFYGLATNESTVPSLNTENELISWGKRIIEGEEFRIRKGGCPITNPTIAVVKVRYQNFLEAWNFQKTLAKRTLDYTEKNYELRKEADEIIIQIWNEVEDTHSTL-PEDKRMAESENYGIVYFYRKNE............................................ 228
3 0.000e+00UniRef50_A0A1T5E0F6 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1T5E0F6_9BACT  ali  43  8MPYRRLPNTDQARLRALKSAIKKGSSLSPVDLAFSQKLLLELKAFLPHFEQVLNQYQYNRERQANTGKQLGEHYKSARLYVSHFFQVVNLCIARGEIKPEARTYYGLSVDEKSVPEIGTEQQLLQWGKSLIKGEEDRMAGGATRIYNPSLAMVRVKFEKFLEYYNIHKDLLATSQKLLDKVNDYREQADKLITSVWNEVEAKNENLSPDE-RREICSHYGVVYVFRPSEKE.......................................... 237
4 0.000e+00UniRef50_A0A1F3LX90 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3LX90_9BACT  ali  42  1MPYRRLPNTDAARIRALKTALEKGKELPPYKMAYSAKTIVRLQKFLPLFEHSIQLQRQSIASQNKKSKDYCETAKKARIYLTHFIRVMNMAIYRGDLPPETRAYYGLATNESTVPSLNTENELISWGRRIIEGEEFRIRKGGGPITNPTIAVVKVRFENFIEANNYHKTLAKKTMDYTERTCDMRREADSIILDIWNEVESTFASL-PEDVRKKECEEYGLVYFYRKNE............................................ 228
5 0.000e+00UniRef50_A0A2N3HR52 Uncharacterized protein n=17 Tax=Bacteroidetes TaxID=976 RepID=A0A2N3HR52_9BACT  ali  42  1MPYRRLPNTDSARVRALKSALEISYQTNRFDLAFSFILLQKVETFLPHYELAIRNQRQALSQQSIRSKEYNEKLRKARLYVSHFIQVLNFTIIRGELKPEVREFYGLKISSKAAPSLLQDAKVIEWGEKLIKGEQERMRTGGNPIYSPSIALVRVNCENFSQAFNNQKTLQNNTQRFSEKVAEYRAEADSLILSLWNEIEAKFSDLSDEEKR-EKASEYGVVYVWRKGERE.......................................... 230
6 0.000e+00UniRef50_A0A1G6P061 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6P061_9BACT  ali  44  1MPYRRLPNTDSSRLKALKTAYRKGKDLPPVKLAFSQSTSQRVQLFINSFDMAMDRYKKVYEIQVKYNKDYTSVTKKARLYLSHFIQVLNMAIQRGDHKVAIRAFYGLEDYNNRLPSLTTDRELVEWGIKIITGETQRTSKGMAPIMNPSIAMVKVWFENFEEAYKQQKVFQQNTARAQAELDGLRNTADDIILNIWNEVEATFKDLS-DDTRREKAKDYGVVYIFRKNE............................................ 228
7 0.000e+00UniRef50_A0A2N5ZFK7 Uncharacterized protein n=1 Tax=Salinivirgaceae bacterium TaxID=2053305 RepID=A0A2N5ZFK7_9BACT  ali  41  1MPYRRLPNTDTARIRAMRSALEMGMKKSPSELAFNQSILMKTRTFLPVFEQAVSNQRNYQKSQVERNKKYQDVLKKTRLYLSHFVQVMNMAVMRGEAKPEMREFYGLKVSDKKVPDLNTEKDIIVWGKKIIEGEEARLATGASPITNPTIARVKVHFQDFTRAYQEQQNYYDIFQKAHQKVADQRNEADEIILELWNQIEKHFESLSPDEAR-EQASAYGVKYVYRKNE-KMRPFLNV................................... 236
8 0.000e+00UniRef50_A0A1F3KWK3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_35_48 TaxID=1797343 RepID=A0A1F3KWK3_9BACT  ali  41  1MPYRRLPNTDNARYKALKIAYDLGKVTSPVNLAFGQATFFKVKSFTPNFEMVLNTYKETYSNQVKRSKEYNELQKKAKLYISHFIQVMNFGIARGELPPSSRVFYGIDENETKVPNLISEADIIAWGEKLIKGDSERVSKGGNYITNPTMGNVKVRYDKFLDFYWKQKSLQETCVNSLNRVTALREEADKIILSVWNEVEEHFKKICDEEERREKCAEYGVIYVWRPTEEEIKK....................................... 237
9 0.000e+00UniRef50_A0A0S2I134 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0S2I134_9BACT  ali  42  1MPYRRLPNTDSARIRAMRNAQDMGSRQTPGELAFSQSTLMQIRTFLPVFEQAVNNQRNYQKSQIERNKKFQDVIKKTRLYLSHFIQVMNMAVARGEMKPEIREAFGLKKNDKRVPDLNTEKDLILWGKRIIEGEEARLASGASPITNPTIARVKVHFQDFMRVWQDQQHYHDIFQKAHEKVANLRKDADQLIVNLWNQIEANFEDLKPDEAR-EKASKYGIKYVYRKNE-KLRPFLNV................................... 236
10 0.000e+00UniRef50_E6ST26 Uncharacterized protein n=42 Tax=Bacteroidetes TaxID=976 RepID=E6ST26_BACT6  ali  70  1MPYRRLPNTDQARIRALKAVVVKADICNVYDLAVSLKTLTDARNFLMKFEAAQFYYADCFDRQSKAGRKHQANVKTARLYISHFIQVFNLAVIRSEIRLSHKEYYGLETRNNNVPDLATEAALAEWGRKIIDGENKRISQGGIPIYNPTIAKVRVHYDIFMDSYEKQKNYQLLTARSLEVLSSMRADADELILDIWNQVEERFESVTPNEKRLNLCRDYGIIYYYRTNEK........................................... 230
11 0.000e+00UniRef50_A0A139KGX4 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A139KGX4_BACUN  ali  69  1MPYRRLPNTDQARIRALKAVVVKGDICNVYDLAVSLKALTDARNFLTKFEAAQAYYADCFERQARAGRKHQANVKTARLYISHFIQVLNLAVIRSEVRIAHKEYYGLDTSNNNVPDLSTEPALAEWGRKIVDGENKRISQGGIPIYNPTIAKVRVHYDIFMDSYEKQKNLQSLTARSLDTLASMRAEADGLILDIWNQVEKKFEEVTPNEKRLDLCRDYGIIYYYRTGEKRKE........................................ 233
12 4.000e-98UniRef50_W7Y5G7 Uncharacterized protein n=4 Tax=Marinilabiliaceae TaxID=558415 RepID=W7Y5G7_9BACT  ali  43  1MPYRRLPNTDQARLRALKAALEKGRQNYPYDLAYSQQLYLDIQGVLPQFEQIVSQYNFSKERQAKYGKLLADQFKEARIYVSHFIQVLNFCIIRKELKPEVRKMFGLDVDDKSVPDLSTEQLLLHWGKKVVEGEERRMMTGGTRIYNPSIALVKVKFEKFVEYFNNHKNLLQTTQKMHEKVVDMRDRIDHLIVKIWNGVEECYKDL-PGDQRRSKCAHYGVVYMFRKDEK........................................... 229
13 9.000e-95UniRef50_A0A1V5F1D3 Uncharacterized protein n=88 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5F1D3_9BACT  ali  49  1MPYRRLPNTDQSRLRALRIALEKLENQDFTHQIVNFKTIHEAESILGVFENQMQQYRQALKNQVEANKRYQKLVGNVRMYISHFIQVLNLSVIRGDIKKEHKKLYQLDPEVNNVPDLTSEAALLHWGKCIIDGENERLRLGGFPIYNPTIAKVKVHYEIFKENKLNQKLYQSNTSRTLEDLGNLRIKVDEIIIDIWNQVEANFKDEKPY-SKIQKCKEFGLIYYYRKGEKKL......................................... 231
14 1.000e-94UniRef50_A0A170YC94 Uncharacterized protein n=1 Tax=Paludibacter jiangxiensis TaxID=681398 RepID=A0A170YC94_9BACT  ali  50  1MPYRRLPNTDQARVRALRTALDESDRQHL-QLVISYKTQHEAKVLLQKFEQAMGLYKQTYDNQVNSNKDFQQIFRNARLYISHFIQVLNLAVQRSEIKKEYKKLYHLDPEDFSVPDMVSSESLIEWGQNIIEGEALRMKAGGVPLYNPAIAKVKVHYDIFKEYRDNQLFLQQNTARYADKVNVLRQPVDDLIVDIWNQIEGFFNELPPF-SRMESCKAFGVIYYYRRGEAELTP....................................... 232
15 2.000e-94UniRef50_W0ENL7 Uncharacterized protein n=37 Tax=root TaxID=1 RepID=W0ENL7_9BACT  ali  51  1MPYRRLPNTDNARITALEKGVAMEHACDVEHQAASYKTLNEARALLRRFKSAVEQFQYCYTAQAEANRQYQNHLKMARLYISHFIQVLNLAVVRNEVRKEHKPFYGLDPDDFTVPDLTSEKHILVWGERLIEGERERLSHGGAPIYNPTIAKVKVHYDIFKDAYYEQQNYKLNTTRSQSGLDALREEADRIILDLWNQVEAFYAALP-PAARLARCRDYGIVYYYRSGEKR.......................................... 230
16 2.000e-94UniRef50_A0A239RJN7 Uncharacterized protein n=5 Tax=Prevotellaceae TaxID=171552 RepID=A0A239RJN7_9BACT  ali  42  1MPYRRLPKTDAARLKVLKTLLDNNDIYTVRNRFIDWKSLNRAQPVYDHLLTACEQYRVCRQAQTRHKGRIEKLQRNATMYVSHFLQVLLMTVERGEIKRSTLKLYGLPDDTTALPNLKTMDGLTEWGKHTIEGERERLKRGGRPIYNPTIGMVSTHYDIFVDIYQQQKQLQERTQRALDDIQRLRPEADEVILDIWNQIEKHFENEPP-EVRFAECRKFGIIYYYRRHEPHI......................................... 231
17 2.000e-94UniRef50_A0A2H0B943 Uncharacterized protein n=7 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2H0B943_9BACT  ali  41  1MPYRRLPNTDIARLKALKSAMAAGVEIPPFKLAFSQSTFQKLRNFYTSFEQMMHQQKASFISQSAKSKELGIITRKAKLYISHFYQVLNFAIMRGEIMPAARKFYGLRENDSRLPNLNSEKNIIFWGDKLIKGEAERILKGGNQITNPTAAVVKVRYDLFIEAIYYQKMLQKTTAYATDKISAMRAEADNIILSVWNEVEVTF-DILPEEARRNKAEKYGVVYIFRPNER........................................... 229
18 3.000e-94UniRef50_A0A1F3PKA2 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3PKA2_9BACT  ali  42  1MPYRRLPNTDSARLRALKTAFQQSDGLSPYQLPFSQPTYSKLRTFCPDFDQAIINLKACHQNQVSKSKNYQEVYKKAKLYLSHFIQVMNFAIVRGELPPITRTFYEMDEDEKRIPNLYTEKDVLEWGEKLIKGEITRISKGRNPITNPTIAVVKVRYEQFIAAYRSQKSLQITTQRANERIISMRSEADSIILALWNEIENHYKDIPAEEMR-EKAKVFGVIYYDRNDREEIAREESVIEEIFEP............................ 245
19 2.000e-93UniRef50_A0A1F3BRT9 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A1F3BRT9_9BACT  ali  41  1MPYRRLPNTDSSRLKAIQIAYKKGKETNPIDLAFKQGTFQRVQSFMPKWDKVMTEHKTTYDIQIKNNKEYLKKYKKAKLYISHFIQVVNMAIVRGELQPSVKSFYGLEDDFTKLPSLNTETEIIDWGKKIIDGETSRKMQGLTPITNPTIALVKVHYDNFIEAFKFQKMLQKNHARALGSLAELRAEIDDIILNVWNEVEDHFSEFPEDLKR-NKAQDYGVVYVYRKNE............................................ 228
20 2.000e-93UniRef50_A0A1F3K285 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3K285_9BACT  ali  40  1MPYRRLPNTDKARQRALAKALQMGNEMPPFKLAFSQGTLQKARFFYPIFDSAIQEYQNAYNFQVKKNKEYVNLMKRAKLYISHFIQVLNFAIARGEVTGESRKYFGIIEDSKRLPSLNTEESMIKFGERIIKGEQERIANRNNPMTNPTIAVVRVHYEKWLEAYRYQKNLQEIHNRALQKIADMRHEADKIILSIWNEVEESFSIHSEDLKR-QYSMEYGLVYVYRKSEKNKQ........................................ 232
21 2.000e-93UniRef50_A0A1V5W826 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W826_9BACT  ali  38  1MPYRRLPNTDAARIRALTNAINKTMSMHPDDIAYSYKVLQNAKFFLPTFKTGINYQRADYSQSVEKNSNYNSLQKRAKMYISHFIQVLNMAIARDEMPADARSFYGLEKFTKKLPPLTTDDEIIAWGKKLIDGEEARVQQGGNPMVNPRIAMVKIQYDKYVNAYRSNSFIQSKNERAFEYVQELRQKADDIILSIWNEVEQTFAHLPAAEKR-KQAEEYGLVYVFRKHEK........................................... 229
22 4.000e-93UniRef50_A0A0L8V3Z2 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A0L8V3Z2_9BACT  ali  38  1MPYRRLPNTDQARIKAIEMALEKGKRTALSELAFRQQTLDRIQMLYPRLLGAVRQLQAAKQVQFDRANEYGNIFKKAKLYLSHFVQVLNFAIQREEMKPQVREFYGLNPNAFDVPPLNLEKDVLAWGEQIILGEQKRCMQGGSAIYSPSIALVKVHFENFKDAFHHQKILQNNTDRASMKMEETRDEADALIQQLWNEVEERFAQL-PDDMRREKAQQYGLVYVYRQSELK.......................................... 230
23 3.000e-92UniRef50_F8WXX1 Uncharacterized protein n=13 Tax=Bacteroidales TaxID=171549 RepID=F8WXX1_9BACT  ali  47  1MPYRRLPNTDNARIRALKTAIEKSN--TFFSQNVITLDIYKLQHLLRNFETAQVRYRDSLEVQAAANRKFQRLVKNARLYISHFIQVFNFSVIRNEIKKEVKQLYGIDPSDFTVPDLTSNDSLLFWGENIIKGEQTRISQGGTPIYNPTIARVNVAFSLFKDAYFAQKTYQNTTSRQLETLSQQREDIDATLTLVWNQIEKAFASLPPKE-RLERCKEYGVVYYLRKEEKE.......................................... 228
24 5.000e-89UniRef50_U2NNX9 Uncharacterized protein n=78 Tax=Prevotella TaxID=838 RepID=U2NNX9_9BACT  ali  38  1MPYRKLPKTDAARLKALKTLLDCDDIYTVRNRFIDWKVLNRAKTACEHLQTAVEQYHISFQAQTRHNTKMEKLQRNATIYVSHFLQVLLMCVERGEMKRAVLPLYGLDTGDTSLPNIKTIAGLTEWGRKAIEGEKARVKAGGRPIYNPPIGIVTTHLDIFCEFYERQQRLARRTKQDLTELMRLRPDVDAILQELWNQVETHYAEEPP-EVRYAQCRRLGIVYYYRKNEEHL......................................... 231
25 9.000e-89UniRef50_A0A1V5S8A8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin302 TaxID=1852811 RepID=A0A1V5S8A8_9BACT  ali  43  1MPYRRLPNTDAARMRALQVARKQYELKGAENVPYSSKIVHEISAFIPFFERAIAEYKTSVETQFAKNQKYQNQVRMVRMYISHFIQVLNLSCQRNEIKPEKKLLYKLLPDNYSVPDLSTEMLLIEWGKNIIDGESERTRSGGAPIYNPAISKVSVHYDQFCDSFQTKKVSKKNTDRYLESVQKLRIQADALILNLWDQIEKAYAELGTEE-MQNRAKEFGIVYYLRRKERQ.......................................... 230
26 2.000e-88UniRef50_A0A2G6GV83 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2G6GV83_9BACT  ali  39  1................MQAAYGMGKELHPNELAYTQETYSRLGLFINSFTEATQQYKTAYQQQSESSQEYQDMVRKTRLYVSHFIQVVNMAILRGELNPEVRTFYGIDEAETRLPSLASDQDIVEWGRKIIDGEFNRTAQGSGPITNPSIAMVRVQYEQFFDGYTRQKVFQQNTNRTLQQLNDLRDTADSIILSVWNEVEATFSNLPPNLAR-DRCREYGVHYVYRKNE............................................ 212
27 2.000e-86UniRef50_A0A1M6KI38 Uncharacterized protein n=2 Tax=Prolixibacteraceae TaxID=1471398 RepID=A0A1M6KI38_9BACT  ali  35  1MPYRRLPTTDKARIRALEAALNIASEQNSEKLAFSKQTLYELKNVKTAFENHLTHYELDTKIESEKIGDYKAAMDKARLYISHFIQMLYMSIEREEIKIETLAFYGLQDLEMKLPSLANEKEVLDWGWKIIDGEQKRMQNGGSPFYNPSIALVKVKVEDFKDAAIFQHNLKRNTLRSYDKMQELRKTTNDFISKLWTEIEENVPADAPKH-RRQIAQEYGVVYVFRRNEKEKLR....................................... 233
28 2.000e-85UniRef50_A0A2N4S6Z0 Uncharacterized protein n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A2N4S6Z0_9BACT  ali  44  1MPYRRLPNTDLARIRALKTAVQKSAGVEFRQSLIDNKTLSDAETLLLLFERKCKQYRQYYEIQVKAGKQLQQKAKNARIYLSHFIQVLYMCVMRSEIKSEQLALYGLENHNLIVPELTSNELLLSWGKKVLQGEELRTAKGGVPIFNPSLAKVKVIFSIFEEEYAKQIVRHQNTLRALKEVEALREDVDRVICYIWNQVEK-YNEKNALEDRLRKNKEYGIIYYYRKGEK........................................... 229
29 4.000e-84UniRef50_UPI000D0FFBA1 hypothetical protein n=1 Tax=Prevotella sp. Marseille-P4119 TaxID=2079531 RepID=UPI000D0FFBA1  ali  34  1MPYRRFPKTDTARLNSIRTLLDNNDVYAANKRFIDIDLINKVKAYQEQLKSLCNYFRLCYDAQMDNYRCIAKPQKRMMMYVQHFMRVLDMSIERGEIKPTAQTFYTVDDINETLRLLHNADDAYRLTPNIIEGEKKRIAQGGRPIYNPTIGMVATHYDIFKDIYEQQHIMNEKADRALAELKALRAKLDPIIVDIWNQVEAHFAELPP-ETRFDECRKYGLIYYYRTGEKK.......................................... 231
30 3.000e-83UniRef50_A0A0E9LVX1 Uncharacterized protein n=5 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A0E9LVX1_9BACT  ali  37  1....................MNKGSLLGPVDLAFSQKSLLQLKSFYPHFEQALAQYQHNRDRQAKIGKLLMDQFRSARLYVSHFLQVINLCVARGELKPEIREFYGIDAEERSVPEIGTEQQLLHWGKNVIDGEEQRIAQGATRIYNPSLAMVRVKYEKFVELYNTHKDLLNTSHKLLDKVVEFRTQADGLITHLWNEIEAAHDQQEPSLKR-EKCSDYGVVYVYRPTEK........................................... 209
31 7.000e-81UniRef50_A0A1F3MLV1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_49_14 TaxID=1797354 RepID=A0A1F3MLV1_9BACT  ali  35  1MPYRRLPTTDVARLNALHSSARMAGISDPDQLAYSVEHLHPLRNIVARLEGAKHLQNQARGNRIALNRSYQPKLLKTRLYLSHFIQVLNLAIQREEIPASARTFYGLDPTGSRLPELRTDRDVLDWGKRITEGEANRIKSGGIPVMMPNISRVRVWYDQFRDGYYSQITTIKSXXXXXXXXXXXXXXXXXXXXXVWDEIEAHFRHL-PEEEMHERCAEYGVVYVKRKGEK........................................... 229
32 9.000e-80UniRef50_D7JDK8 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=D7JDK8_9BACT  ali  34  1MPYRRLPNTDIARINALEVVVEI-KHTGFRDIALSQDLLTAAERQLIVLRNSHDLHRQAVKMWQENNQKYREIIKNLTAYIIDFVKAYNAAIERGEINPDSRVYYRMTDA--SLPVFNSEEDILDWGRRLSDGEQKRILAGGAPVTNPTIANLNVYYDKFTDLNFNQKTKLGYIQHTKTKLAQERENADTLIKELWNSIEATFAHL-PEDERLDKCREYGVVYYMRSNEK........................................... 226
33 3.000e-74UniRef50_X5E303 Uncharacterized protein n=2 Tax=Draconibacterium TaxID=1471399 RepID=X5E303_9BACT  ali  35  1MPYRRLPTTDKARIRALNAALAKV-IKNEEKLAFSNHSXXXXXXXXXXXXXXXXXXXXXTRLQSENIKEYKEAFDRAKMYVSHFIQVLQFASERGEINGGIRYYGNLASFEGKVPSLNTEEDIIEWGKIMVEGEQKRKQNGGSAIYNPSIALVKFKVEELHDASVFQQTLKRNTLRSFDKMQKLRKTTNDFISKLWTEIEESLEVESPKVKR-QLAQEYGIVYVFRRNEKK.......................................... 229
34 2.000e-67UniRef50_A0A1I0IL52 Uncharacterized protein n=2 Tax=Draconibacterium orientale TaxID=1168034 RepID=A0A1I0IL52_9BACT  ali  26  1MPYRRMPVSIIDRTKVLEKTSEKATSTPADQWAISTETQTRLTTLYPAFRQEIAERQEQFAKQAEASEVENAQQVVLHRCVSHFFQVFNLAVERGVFSASDRLYYGLNANQSELPKLSTEQDLTTWALNLIMGEQKRTQQTDPPMSNPSAAEVQTELMRYNELSSAQSAEKQAFDAENKDVLDMLPEIDELIRDIYDEVEFYYRKETPPN-RRKLAREWGVSYVSRPG............................................. 233
35 5.000e-63UniRef50_A0A2G6H7V5 Uncharacterized protein n=1 Tax=Bacteroidales bacterium TaxID=2030927 RepID=A0A2G6H7V5_9BACT  ali  26  1MPYRRLPATYTTRIEALRIFADIKQESATDNSIISQELXXXXXXXXXXXXXXXXXXXXXTDRQQNSNHKYRKTLAELEAHILNFVESCQQKCAEGLFDEQSFSCYGIEKEGT--PDLSTEQKTLDLAQKLQKGERERIMKGGMPMTNPTISNVSIFHDKMIDVIVSQKTNDNFINHTRKKLKEESDKADVIIKDLWDTIESTHSHL-PADKKIEECKKYGIIYYKRSSEKKKQK....................................... 231
36 3.000e-62UniRef50_A0A2N5YNG9 Uncharacterized protein (Fragment) n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YNG9_9BACT  ali  43  1....................MEMGKIVSPIELPFSQGTLQKIKYFLPVFEQTMIQQQQAFSNQVSRSKDYLDLYRKAKLYISHFIQVLSMAAIRGEIPAQVKELYGLNPNTKRVPTLGTEESVIKWGERIIKGETERLSKGGNPMTNPTIALVKVRYEKFVESYRSQKSLQDINAR................................................................................................. 156
37 3.000e-58UniRef50_W4PI34 Uncharacterized protein n=2 Tax=Bacteroides pyogenes TaxID=310300 RepID=W4PI34_9BACE  ali  66  1......................................................................................MFNLAVLRDEIKESQKELYGLSDVN-TLPDLLSESALIEWGAKIIEGEQRRISQGGIPIYNPTIARVKVYYDIFVDSYERQKNYQAATARSLEDLASMRSRADELILDIWNQVEAEFEGVQPNENRLEKCRDYGLVYYYRSNEK........................................... 143
38 9.000e-55UniRef50_R7E8Y3 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=R7E8Y3_9BACE  ali  66  1MPYRRLPNTDQARIRALKAVVVKGDICNVYDLAVSLKALTDARNFLTKFEAAQAYYADCFERQARAGRKHQANVKTARLYISHFIQVLNLAVIRSEVRIAHKEYYGLDTSNNNVPDLSTEPALAEWGVKSWMGKTN......................................................................................................................................... 136
39 5.000e-54UniRef50_A0A2N5YJR5 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YJR5_9BACT  ali  25  1MAHLQRPRNIDEKLKAMQVAHQMADVLKENKLAYMPETFNKLATFLPVFEREVDDVKKVLNEQSETMWLKQKDLSMLRMHVKHFIKVFNFAVERSVYSPGERSYFGIDVNTENVPYIKGEAETIIWVKKIITGEKRRVDSGSVKMQNPSADEXXXXXXXXXXXXXXXXXXXXXYSQTFNDISILINEADEIIKDIWDEVEFFYRKEDIQ-SKITQAAKYGLIYI................................................. 225
40 7.000e-53UniRef50_A0A1V6I736 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin028 TaxID=1852798 RepID=A0A1V6I736_9BACT  ali  21  40.......KSDAERFLILKSFYEKQDQIIDNDTNAGEVLSARIEKHYNIFEKLKAYESFVKEQKEKEDQEFKDLFNKAKIFVVHYFQALYMAIERGELSSQTANYYGLDFP-FEIPNPKRSENLLKIAEDLFNADAARIADGGKYFSNPSLGAVRAWVEKFKEVWLFRNSKLKSNKAEVENIENIRKDSDKLIYELYELLDKHLEDLDIIEK-AKIFAEYGLIIKTGEEN............................................ 259
41 6.000e-48UniRef50_A0A2V4ADP3 Uncharacterized protein n=1 Tax=Marinifilum sp. JC075 TaxID=2184082 RepID=A0A2V4ADP3_9BACT  ali  18  1MPYLVYPRSDLGRLKLLRVTVTASNDAELGKGFLPAELLTDIETQKSAYQSVYDKFNASLSTKSKEVREKQECFSKLDLYVRDFFDVLKRRTIRLEHPAEILRFYNVAI-NGELPDFRKDEDLLKTSENIVKGDVNAIAAGFPAMANPSAEEIGDVLTASQKEMAEIVPADRAYEMVQKELDQMREPIDDLIREIADYIQFAVRKDKSSNVRR-KMRTYGFRYQYLKNEPQ.......................................... 230
42 1.000e-47UniRef50_A0A1Y1CPL3 Uncharacterized protein n=1 Tax=Marinifilaceae bacterium SPP2 TaxID=1717717 RepID=A0A1Y1CPL3_9BACT  ali  17  1MASLVLPTSDLNRLKMLRSIATAQKDAVLGTSFIPPKLLREAEELKLKFRTVYDLSNSSLSVRQKEVREKNETFVKLEVVVRDFFDGLRRRTYRMDHPAEVLRYYNI-TAGGELPTFSKDMDLVTAAENILLGEQKAVEAGYPAMSNPSAEEVALALESAKKEFDEIAPADRAVNKVQKDLAEVREPVDEMIKEIAAYIQFSMRNETTSNVRR-FMRTYGFEYRYLQGE............................................ 228
43 4.000e-44UniRef50_X0SXQ0 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=X0SXQ0_9ZZZZ  ali  43  1.............................................................................................................NNKNLPSLNTESAIIKWGEKIIQGETLRSLKGFSPITNPTIAVVKVRYEKFLEIYNYQKILKKNSSRTLKELALLRPQADEIILNVWNEVENSFKNLPEDLKR-EKAKKYGLVYVFRKNEIRKINFLK.................................... 127
44 4.000e-29UniRef50_A0A2N5YXV7 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YXV7_9BACT  ali  27  1.......................................................................................MYMAIERVELPSNAAKYYDLTFP-FEVPEIKSDVQLLKVAEKLFEDDLKRTSEGGKYFTNPSIGAVRVWVEKFAEAVKVKNNTYNVKQAEVENIEGIRTDTDKLLSDVFDTVLSKISSETQQEK.............................................................. 123
45 4.000e-26UniRef50_R7E9K0 Uncharacterized protein n=1 Tax=Bacteroides uniformis CAG:3 TaxID=1263055 RepID=R7E9K0_9BACE  ali  65  1........................................................................................................................................................MRVHYDIFMDSYEKQKNLQSLTARSLDTLASMRAEADGLILDIWNQVEKKFEEVTPNEKRLDLCRDYGIIYYYRTGEKRKE........................................ 81
46 2.000e-20UniRef50_R5NVE4 Uncharacterized protein n=1 Tax=Odoribacter sp. CAG:788 TaxID=1262909 RepID=R5NVE4_9BACT  ali  38  1.......................................................................................................................................................MVRVNYENFKQGYEFQKRLQANSARFSSEVAQFRDEADALILNIWNEVESYFSSVKDEEEKRYMCEEYGLVYVFRRGEKE.......................................... 80
47 2.000e-11UniRef50_A0A2N5YSC5 Uncharacterized protein (Fragment) n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YSC5_9BACT  ali  34  1...............................................................................................................................................................................RALARVAELRTEADEIILNAWNEIEDTFSKYSAKLKR-EKSAEYGVVYVYRKSEKK.......................................... 55

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.