current user: public

If you have questions about the server, please let us know.

Query: HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# E-value Template Links and tools%idFirst MRKLVKLILLCLIAYPIISIVSSCSEEEDCSMNARPMMQCYLYKIDGETERVVNDTLDSLTITAFGTDSIILNNQKRVHGLSLPLRYTADSTVLVFHYSKDVKIKKDTIVIRQKNTPYFLSMDCGYQMKQSITGRSYSRHLLDSIYIQTAEVSIYGTENLKLFYRNLast
1 4.000e-39UniRef50_UPI000B4BEF13 hypothetical protein n=1 Tax=Robiginitalea sp. O458 TaxID=1982593 RepID=UPI000B4BEF13  ali  16  1...............MALLAGSGCEKDDICVDGDTPLLVVTFYDIENPGEAKAVNRLRAVGL-GNGTPVTSFPDRSTRDSIGIPLRIDSGQTGFVLIQNSEDEGNRDTLYFDYEIREEFVSRACGFVGQFDNLEVSDASNWIDSVTVIATTVENSLSAHVSVYH.. 156
2 7.000e-39UniRef50_UPI000DCBDCAF hypothetical protein n=1 Tax=Sinomicrobium sp. N-1-3-6 TaxID=2219864 RepID=UPI000DCBDCAF  ali  16  1MKFIKKTVIALSLVGLMALLFPGCEKDDICPEDTTPLLVITFHDSDDRDVREAVNTLSVYG-QGMEAPVDTFRDSTSIDSIAIPLKLFENETVYAFTLNSIQINNADTLRFRYQTEQHFISRACGFITNYSGLTAEDSQQWISSLEIVNPTIQYQNTAHVKIYH.. 181
3 6.000e-38UniRef50_A0A1M6MSY7 Uncharacterized protein n=11 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6MSY7_9FLAO  ali  18  1MNKT-KISILLLTALITVFGFMACEKDDICIEGNTPLVVVRFYDVDNPTELKKVSKFRIVGV-GQNTTVPGVSDRSDIDSIAIPFKVTENSTGFYFIKNSVTGGDLDTLYFNYDRNDKFISRACGFITNYDNLSQELSDNWIKNVEIVTPLVENSISAHVKIYH.. 179
4 1.000e-37UniRef50_A4ASI3 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A4ASI3_MARSH  ali  16  18.....................SACEKDDICVDGNTPLLVIRFYDTLDPESTKNVTTLRVVG-SGQASTVNTYADRSTADSLAIPLRPDVASTTYLLIANSATTGNTDTLTINHDTKEVYISRACGFIANYENLATTDTDNWIKGIEVISPTVENSNTAHVKIFH.. 167
5 2.000e-37UniRef50_A0A1K1RJW6 Uncharacterized protein n=1 Tax=Sinomicrobium oceani TaxID=1150368 RepID=A0A1K1RJW6_9FLAO  ali  17  1MKRLA---LALFVTGLAVVFLLGCEKDDICPEDTTPLLVITFYDRNDATTKEEVSLLSV--VGRDMEDTLPSVDSIATDSIAIPLKVFEEETVFAFIRDTIPTHNADTITFRYQTDQIFISRACGFITNFSNLTATDSERWISSIEVVNPTVENQSAAHVKIYH.. 174
6 3.000e-37UniRef50_A0A1I6GRL0 Uncharacterized protein n=2 Tax=Robiginitalea TaxID=252306 RepID=A0A1I6GRL0_9FLAO  ali  12  4....VRLAFALSLTAVFLVLLNACEKDDICVEGDTPLLVITFFDAENPETAKEANRLRIIGLGQ--GDPITPSDRQTRDSIAIPLRPDTTRTGFVFILNSNETGNRDTLYFDYSTDELYVSRACGFVSQYDGLSDELTENWILDVEVIQTAVTSSVSAHVNIQH.. 170
7 3.000e-37UniRef50_W2URL1 Uncharacterized protein n=2 Tax=Zhouia amylolytica TaxID=376730 RepID=W2URL1_9FLAO  ali  20  1MKKI---FLPALIILLIFIGVLSCEKDDICPPDSTPNLVIRFYDADNPQETKL---VNNLRIIGVGQETDAWP-LSTTDSVAIPLKSFANSSSFVFIMDSSETGVIDTLTFNYGTEEVFISRGCGYVSYYNNLGYTPTEGWVSRLRIISTDIENQNQAHVQIFH.. 168
8 1.000e-36UniRef50_UPI00040C9CC1 hypothetical protein n=2 Tax=Salinimicrobium TaxID=561367 RepID=UPI00040C9CC1  ali  19  1MRKFQKWLFSGIFIFLSL----SCQKDDICPEETTPLLIIQFYDPEDPTRL---KAVQNLTVRASGMEEN-YLGPVTTNEISIPLRTDANSTEYIFTYNSSDQENEDLVSFSYSPNPQYINRACGYKINYTNLDVQDDQNWILSEIILQENVENETEAHISFTH.. 162
9 2.000e-36UniRef50_A0A2G6F5U2 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G6F5U2_9FLAO  ali  15  1....MKGKIIMLFLISSLIWIAACERDDICIEPTTPQLIIRFYNNKAPEDFKSVNSL-LVRVIGRENDSLTF---AGKDSIVVPIRVNALETKYLLTYSDTAKKITDTLSLSYQTEDVFVGRSCGYKSIFKNVNYKATNHWINGLEVVATIIENENNAHVKMYH.. 158
10 7.000e-36UniRef50_A0A0A2GZ16 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0A2GZ16_9FLAO  ali  17  1MKK-----FFYILLLIICFGQSACERDDICAEPTTPLLIIKFYDADSPSDSKAPNNLAIIAEGSIPEDT-GFTVSAGTDSIAIPLRTIEDVTTYSFIINDDEPINVDDLVFTYIRDEEYVSKACGFRVIYDELLAEDDGSWIQNIIIENPTVNDQVEAHISIFH.. 168
11 9.000e-36UniRef50_A0A2A4G423 Uncharacterized protein n=1 Tax=Sediminicola luteus TaxID=319238 RepID=A0A2A4G423_9FLAO  ali  18  16..................FWLASCEKDDICVDGDTPRLIIEFYDTDNVDNLLPVPNLRI--IGENGEKDTILVNRQSLNKVELPLKVNTERTEFRFIINNNETGNIDELAFDYMVKDRFVSRACGFVANYEGVTDDLTNNWIDSIEVVVDTITNENDTHVKIFH.. 170
12 1.000e-35UniRef50_A0A0S1S8M1 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0S1S8M1_9FLAO  ali  18  1MKKILAIGAILMIIIS----FSACEKDDICVDGDTPLLVVGFYDINDTATVKRVTKLRVAGIDQEFTVNTVPDR-TDLDLVELPLRINSPTTSFVFISSNEETGNADVVTFNYETKEVFVSRACGFIANYASLNTSDTDNWIKEIEVVQTTINDQATAHVKIFH.. 168
13 2.000e-35UniRef50_A0A1B7ZDG8 Uncharacterized protein n=2 Tax=Maribacter TaxID=252356 RepID=A0A1B7ZDG8_9FLAO  ali  17  1....MRSLRIGILLFTAILSVASCEKDDICVEGDTPLLVIEFYNISDTSALKNVPTLRVVGVGKNITVNTVADR-TALNTISIPLKTDEDATSFILISDGSETGNVDTINFSYQRIEDFLSRGCGFVINYDSLQTVDTDNWIKDIEIIKSQVTNSDSTHVKIYH.. 168
14 3.000e-35UniRef50_A0A0A2M535 Uncharacterized protein n=1 Tax=Flavobacterium rivuli WB 3.3-2 = DSM 21788 TaxID=1121895 RepID=A0A0A2M535_9FLAO  ali  16  1MKRLIGSVTLLLLICG---YLWSCEKDDICPESTTPSLIIRFYDTNN---HVSRKSVINLQVFMEGKDTV---SLGTTDSIALPLRTDATATRWGLIFNRTSQSVTDFIEFKYTTREEYVSRACGYKVMFTLDDLTDTHFWIDEFTLENKNIENENKAHVKIYF.. 177
15 4.000e-35UniRef50_E6XAH2 Uncharacterized protein n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=E6XAH2_CELAD  ali  16  1....MSKLIYILALSVVVFAFNSCEKDDICVDGDTPLLVIRFYDATITTDLKAPSNLQVKGLLDTGEYGDIITN-TSTDSIQIPLRIDGLSTTYNLSINDAENANEDVLIFDYTTKEVFISRACGYVVNYEELTTTDTDNWIKNIEIINTTVEDQTTAHVKIYH.. 165
16 4.000e-35UniRef50_A0A0B7IQL8 Uncharacterized protein n=6 Tax=Capnocytophaga canimorsus TaxID=28188 RepID=A0A0B7IQL8_9FLAO  ali  15  1MKKNWIIRIGASVLLLIFSVLTACEPDDLCEKVTTPRLILRLKDTDKPTKTKAAEKLLVY-----GKDQKQILSFTTTDSLALPLKISEPQTTYLLVKDATFDANSGTITFSYQPEEQFVSKGCGFKVVYHNLKVDPTSVWIKSVRINKTDIEDEKKAQVTIYH.. 171
17 6.000e-35UniRef50_A0A223V0X1 Uncharacterized protein n=3 Tax=Maribacter TaxID=252356 RepID=A0A223V0X1_9FLAO  ali  17  1MRKLNRVIFTFLL----TITLTSCEKDDICVEGNTPLLVLEFFNVADTTAVKNVTALRIVG-EGQTVTVNTFTDRSNLSSVAIPLRTEENSTTFYLISNSASTGNIDTLTFNYDRIEDFKSRACGFVVNYDNVSTELSGNWIADIEVIRASVTNSDSTHVKIFH.. 168
18 8.000e-35UniRef50_A0A255Z7M0 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A255Z7M0_9FLAO  ali  15  1MKKGI----IMFMLLLSAAYFISCEKDDICAEGTTPSVVIEFYERDNRTQ---PKSVLNLRVIAENMETPVLFSGSDVTSIRIPLRTDADTTTYRLIYNTNGTRNEDRITFNYTRNEIYVSRACGYKTHFVLLQDTGDNFWISEVGVERTNIEDQNEAHIYIYF.. 174
19 9.000e-35UniRef50_A0A0B7HZ85 Uncharacterized protein n=2 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7HZ85_9FLAO  ali  16  1MKSYSKLYIVIPLLALSFLWITSCESDDLCDQKNTPQLVIRFRDMSTQKE----KKVSNLIVYGEGKNTLLIN--ASTDSIALPLKVAEPKTSYVMVSNANYNNTTTTITFTYQVQEEFVSRACGFKATYNTVSATPDDTWIQSINVTKTEVENEKNAHIQLYH.. 170
20 1.000e-34UniRef50_A0A2G5KMD1 Uncharacterized protein n=3 Tax=Maribacter TaxID=252356 RepID=A0A2G5KMD1_9FLAO  ali  15  1....MKIFRIAFFTLLCFIAFASCEKDDICVEGDTPLMVIEFFNIDDTTALKNVTALRVVGQGQTVTVNTVADR-SNLNTITIPLKTAEDTTNFLLISNSASTGNIDTVNFSYSRLEDFKSRACGFVINYDNLDATDTDNWIQGIEITQTQIINADSTHVKIFH.. 168
21 1.000e-34UniRef50_A0A1I7FBU2 Uncharacterized protein n=1 Tax=Pustulibacterium marinum TaxID=1224947 RepID=A0A1I7FBU2_9FLAO  ali  17  2..KFKFTIGILITAIISIFGFYSCEKDDICVDAVTPRLIVRFYDQTDYDQTLDVTNLRVSDLDGNAVLSDAETVISNVDSILIPLKTLEDSTTFIFHTNGTISGNADTLTFNYVRNELYVSRACGYKVNYSELAEEDDDNWIFNVTIENNEVLDETAAHVYIYH.. 173
22 1.000e-34UniRef50_A0A1M5P1N7 Uncharacterized protein n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M5P1N7_9FLAO  ali  18  1MKKILPSLLIAFLLIH----FASCEKDDICVDGDTPLIVVGFYDIEDTTVFKD---VPSIRIRAVDNDQILSDSDASPDSLSIPLQISTGSTQFEFISDSADTGNIDQLTVNYAVREEFVSRACGFVAQFDNLSITSAENWIQDINVVQQTVENSNNIHVKIFH.. 175
23 1.000e-34UniRef50_I0WFH6 Uncharacterized protein n=1 Tax=Imtechella halotolerans K1 TaxID=946077 RepID=I0WFH6_9FLAO  ali  15  11.......IRYFLGIPLLLLLFSGCEKDDICVETSTPNLIIRFYDQVNRSQFKEVPTLRVIGVGSQ----YILIDRITTDSISIPLKTLENTTSFMLINASEETGNSDVLTITYTPKEIFINRACGYKMNFEEANGSVTTNWIQDVQIINPNIQNERKAHIHLYH.. 170
24 2.000e-34UniRef50_F0RH29 Uncharacterized protein n=20 Tax=Flavobacteriaceae TaxID=49546 RepID=F0RH29_CELLC  ali  18  1MKKI-----GILAAILLFTGFTSCEKDDICVDGDTALLIVNFYDFEAEEETE--KAVTKLRIVGEGQDSPFDNDRTNLTTISIPLRANETTTTYNLISNSDETGNTDTVTFNYATNEVYISRACGYVIHYNELTSTLTENWIKNVEVVETTVENIAVTHVKIYH.. 170
25 2.000e-34UniRef50_A0A239B5T1 Uncharacterized protein n=1 Tax=Dokdonia pacifica TaxID=1627892 RepID=A0A239B5T1_9FLAO  ali  17  1...MTKRLFIIGTVLWGCIMLSSCERDDICAEATTPLLIIDFFDIENPTEPKTPVDLTIREVNGDTLDG----SPFNTSTVSIPLRTNQDQTDLLFVLNTETPENIDGLSINYVRIEEYISKACGFRITYDALDATPSSQWIQDVIIINTTVEDETSAHIQIFH.. 168
26 3.000e-34UniRef50_A0A285X3Z3 Uncharacterized protein n=2 Tax=Salinimicrobium sediminis TaxID=1343891 RepID=A0A285X3Z3_9FLAO  ali  16  19......................GCQKDDICPAGTTPLLVIEFYDSQNPGRL---KAVQDLRVQASGMEEI-YFGPETTNSISIPLRTDQNFTEYTFTYNSEEDENEDVVTFRYSPNPEYINRACGFRINYGNIDVSVDDNWILSTSILQQNIENETEAHISFTH.. 162
27 4.000e-34UniRef50_G2PNC2 Uncharacterized protein n=5 Tax=Muricauda TaxID=111500 RepID=G2PNC2_MURRD  ali  20  1MKKIIP----ILLIASMLYYVSSCEKDDICVEGDTPLMVIGFFDIEDTTEVKRVSSIRIIDIDSILTNGSFSDRANSPDSLMVPLRSSATSTMYQIISGSRDDGNIDTLTISYDLGEAFISRACGFVVNYNNITVTSAENWIQDIKVVQPNVENTDNIHVKIFH.. 172
28 4.000e-34UniRef50_A0A1T5BNS6 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=A0A1T5BNS6_9FLAO  ali  18  1....MRSFRIGIVLFIGILAVASCEKDDICVEGDTPLLVIEFYNINDTSALKIVPTIRVVGVGQNVTVNTVADR-TALNTISIPLKTDVDVTSFIIISDGSETGNIDTVNFSYKRLEDFLSRGCGFVVNYDSLQASDTNNWIKDIEIIRAQVINSDSTHVKIFH.. 168
29 4.000e-34UniRef50_A0A1H5M9E3 Uncharacterized protein n=3 Tax=Salinimicrobium catena TaxID=390640 RepID=A0A1H5M9E3_9FLAO  ali  16  8...........IFLAGFIIIAQGCQKDDICPEETTPLLVIEFYDAADPSQL---KAVQNLVVRAAGEE--IFLGPETVNTITIPLRTNENVTEYSFIRNSSTTENEDRISFSYDPAPEYLNRACGYKVNFTNIDANTEDNWIISEVILLENVENETEAHISITH.. 161
30 6.000e-34UniRef50_A0A1X7LBI9 Uncharacterized protein n=2 Tax=Arenibacter TaxID=178469 RepID=A0A1X7LBI9_9FLAO  ali  17  16...................GFGACEKDDICIDGDTPLLVIRFYDIDNPTVLKKAPKFRIVGV-GQNTTVTTVSDRVDTDSIAIPLKVAESSTGFYFIRNSSDVETTDTLYLNYTRIDKFISRACGYIANYEDLNSTETDNWIKDIEIITPLVENSTAAHVKIFH.. 176
31 7.000e-34UniRef50_A0A1M6BNE4 Uncharacterized protein n=15 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6BNE4_9FLAO  ali  16  2..RINKFPLFLFLLAGISLSFWGCERDDICAEGTTPMLIIKFLDFDNTSEIKNPVELEVRAVGVENP----FNFGTVTDSIMIPLRTNESITEYQLTINSDTTSNTDTISIQYTPEEEYVSSACGFRVTFQGLSAGDDGTWIQDINVERLNVTDETTAHIFIFH.. 171
32 8.000e-34UniRef50_V6S0U8 Uncharacterized protein n=4 Tax=Flavobacteriales TaxID=200644 RepID=V6S0U8_9FLAO  ali  16  1....MKRLTIIAMSLLLANSFWSCEKDDICPEPTTPNLVIEFYDAANPETL---KPVTNLGVVASGFSTGFPYN--GVSKITVPLKTNEDQTILQFIQNGSNNDNIDVLTFNYSRNDIYVSRACGYKTVFQLTETDDSSLWILSRFVTQPNIQNENETHIKIYF.. 165
33 2.000e-33UniRef50_A0A1G7WV39 Uncharacterized protein n=5 Tax=Psychroflexus TaxID=83612 RepID=A0A1G7WV39_9FLAO  ali  17  1MKKTLFTSLVILFILSI---FTSCERDDICAEETTPKLVIDFFDVNNPSN---PRNVRNLAVREIENDTAILFN--STSSIAVPLKTDANETTYVFNLNSESGGLTDTLTFSYDTRELYVNRACGFKVNFIDFRVEIQNNWIRDIQVRENSIENEFETHLYIFY.. 166
34 4.000e-33UniRef50_A0A2T6AG73 Uncharacterized protein n=8 Tax=Gramella TaxID=292691 RepID=A0A2T6AG73_9FLAO  ali  15  1MKNNFYKLLFIALLFSGI----ACQRDDICPTDTTPLLIIRFYENEEPNDLQSPQNLSIRAIDSDGGNSPVRYFRFSGDSIAIPLKTNADQTSYVFTLNTSNSGIRDTLSFTYARSEEYINRACAYKVNYVGLKTSLESGWIQEIEIEQTDIEDENQAHVSIFF.. 182
35 5.000e-33UniRef50_A0A0C1CY00 Uncharacterized protein n=69 Tax=Flavobacteriia TaxID=117743 RepID=A0A0C1CY00_9FLAO  ali  21  1MKKI------ILLVFAIALFFSSCEKDDICDANTTPRLVITFYDYDNPSVLKTVTKLKV--VGAGMTDGIIFNATATDDSISIPLKTNEDTTSYSFTLNYGNAVNEDNIKFDYTRKEVFVSRACGFKTLFTLNTANPYTHWIKYISVEKSNIENENETHIKIFF.. 179
36 7.000e-33UniRef50_G0KZZ1 Conserved hypothetical lipoprotein n=9 Tax=root TaxID=1 RepID=G0KZZ1_ZOBGA  ali  21  17....................FSACEKDDICTDYDTPQLVIRFYDVLNPTEFKDVQNLIVWGILPSGGKDTIAN--VALDSIVLPLRVDADNTSFALSRQSIDDINVDTLTFNYDVTELYKSRACGYIANFENLTVTDDSVWIQTIDVDNALIENTASAHVKIFH.. 162
37 1.000e-32UniRef50_A0A2D7MPE7 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7MPE7_9FLAO  ali  12  5........FKLLLSIVGCILLTQCEKDDVCVEGDTALLHIAFYDKDATDEQPLPKVVNKLRVISVDENATVFTDRSSQDDILIPLDSRKNIGDFILISNSATEDNLETIRISYTPEAVYISRACGFVGQYTDLGIEQTSSWISSIEINNTRIDNSDEIHVSIFH.. 169
38 1.000e-32UniRef50_A0A2S7T7P8 Uncharacterized protein n=1 Tax=Aureicoccus marinus TaxID=754435 RepID=A0A2S7T7P8_9FLAO  ali  14  1MLRSKPTLGLITILLGIFLGLGSCEKDDICVDGDTPLLVVGFFDQGDAEQETAKD-VTTLRVRELNSTGFPVSDRVTTDSIAIPLPNSATTVTYLLISNSNETGNIDTLDMSYTLSQRFVSRACGFVAVYEDLTVSDSSNWIQDLVVVDSTVNSNNSIQLKVLH.. 173
39 1.000e-32UniRef50_K9ELJ2 Uncharacterized protein n=38 Tax=Bacteria TaxID=2 RepID=K9ELJ2_9BACE  ali  87  1MRKLVKLVLLCLIAYPIAAIVSSCSEDEDCSMNARPMMECFLYTIDENNNTVLKDTLDSLTITAFGTDSIILNNQKRVHGLSLPLRYTADSTVLVFHYSKDPKIKKDTIVIRQKNTPYFLSMDCGYQMKQSITGRAYSRHNLDSIYIQKAEVISNGTENLKLFYRN 167
40 1.000e-32UniRef50_A0A1V6LQF2 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A1V6LQF2_9FLAO  ali  23  1MKR-----LLYVLIVAFLVQFSSCEKDDICVAGDTPLLMLGFYDYEEPETEKSVPNLRSTETLSN----LVVNTLGNKTTDSLPLRTDASSTTFVLHNNGTVNGNPDTVTFTYSVEEEFLSTACGYIANYNELTASDTGNWIDSIAVEVTLVKRDTLTHVKIFH.. 164
41 1.000e-32UniRef50_UPI000931AD0E hypothetical protein n=1 Tax=Flavobacteriaceae bacterium A100 TaxID=1917170 RepID=UPI000931AD0E  ali  19  1......MIKNLSVLILLVVISIGCQIDDFCTEGTTSNLHIGFYDVDFPDKIKPTDSLTVWV-----TDKDTLYRYANVDSILIPLDPNNDFTEYNFMARKND---KDTLIFNYTREEVFVSRSCGYKYNFENLDVEVSISWIKSVIVENQSVTNEVERHVKILH.. 151
42 2.000e-32UniRef50_A0A2T6C2S4 Uncharacterized protein n=1 Tax=Kordia periserrulae TaxID=701523 RepID=A0A2T6C2S4_9FLAO  ali  21  1MKKLSFIGILGMLMTLIFLSF-SCEKDDICVEGTTPLLVIEFFDAENATGEDVLKNTSDLWVEAVDPNTEVINTPQAVNTVSIPLRTMEDVTEYRFIKDYALDGNEDIITFNYSREEIFLSRACGYVTNFELSGFDDGDNWIDGIRIAETIVQNETVTHVKIYH.. 193
43 2.000e-32UniRef50_A0A1Y4HMV3 Calcium-binding protein P n=3 Tax=Bacteroidaceae TaxID=815 RepID=A0A1Y4HMV3_9BACT  ali  61  1MRQLIRIIFGSLLLCVFIGFTASCSEEADCSMAERPMMNCNLYTLD-RDGYAIRDTLDSLTVTAWGTDSIIVNNQQDVRDLTLPLRYTADSTVLVFRYSRNT---TDTVIIRHTNTPYFLSMDCGYQMQQSINEVLHTRHRLDSIYITSNEADIYGQENIKLFY.. 160
44 2.000e-32UniRef50_Q26EV3 Uncharacterized protein n=7 Tax=Flavobacteriia TaxID=117743 RepID=Q26EV3_FLABB  ali  18  1MK--IFKYILLLSFILLMTGIASCEKDDLCDPSVTPRLIIKFTDIGNPEESKEVEQLQIREIGLTELDSEGSTLLTAVDSIAIPLRTDSNNTSYEFFLDDDDGTNIDSIDFNYNLDETYINRACGYKIIYNELGAPAGDEWIINIQVVTPEVTSNNDIHIEIRH.. 172
45 2.000e-32UniRef50_A0A256A7D9 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A256A7D9_9FLAO  ali  18  1MKK-------LLLFCIVVLSLSSCEKDDICDPSTTPRLIIEFYDTNNPAVLKNLTNLYVIGEGQEENESIPIDSPVNGNRIGLPLNTEADQVVYNLTLNYNSPIFEDQIVINYSRLNAYVSRACGYKTTYKLITVTSGNVWINSIEILQSDIETENEIHVKIYF.. 183
46 3.000e-32UniRef50_A0A1L7IAU2 Uncharacterized protein n=3 Tax=Gramella TaxID=292691 RepID=A0A1L7IAU2_9FLAO  ali  17  7MKKYSFGFL-----IVGLLVLLGCQRDDLCPTNTTPLLIIRFYDFEAPDEPTPPQNLSIAEIPETETDSTVTLRRRSQDSIAIPLRTDQNLTRFYFILDTEIDGNADTLTFSYDLQEEYLNRACSFQRKFINLKVNRTQNWIREINIEENNVEDENQAHVSIYF.. 191
47 3.000e-32UniRef50_A0A0D6TIG5 Uncharacterized protein n=12 Tax=Flavobacterium TaxID=237 RepID=A0A0D6TIG5_9FLAO  ali  17  1MKKYSMIMLMVLLAIS----FWNCEKDDLCAEGTTPRVVIQFYDNGNGTMLKNVTNLKIVEVANETSTNEVLKYLFNTNKVSIPLRTDAVETKFNFIHDSAGTGEIDELTFTYTKNDTYISRACGYKTTFEITTINSTTNWIQNITVENVKIENENETHIKIYF.. 173
48 3.000e-32UniRef50_A0A0X8BZY8 Uncharacterized protein n=7 Tax=Flavobacterium TaxID=237 RepID=A0A0X8BZY8_9FLAO  ali  19  1....MKKIFLGLFVILSTLPFLNCEPDDVCPQPTTPRMIVQFFDNNNPTN---PKTITDLKVTAEGMSSSL--DFASSNKIELPLKVNNNQVRYTFQINSKNSTKEDQITLNYSRNDVYISRACGYKTEFTLNTLTTPKNWIQEVTIQKTSIVNENETHLKIFF.. 164
49 4.000e-32UniRef50_A0A1D7Y1R4 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1D7Y1R4_9FLAO  ali  20  1MKKFICLFLIVIF---------SCEKDDICPDTTTPRLVIEFYDLTSPDEILAVPGLYALGLDSEGMEVAINNEIVTTSSITLPLKTNDTETEFILYKDGVVSGNPDTIKVTYDTEDVYVSRACGYKTNFNIQTFSITDQWMISSEILITEITNENDIHVKILH.. 166
50 4.000e-32UniRef50_A3J136 Uncharacterized protein n=7 Tax=cellular organisms TaxID=131567 RepID=A3J136_9FLAO  ali  17  1MKKIVFITLSLLLAVS----FWNCEKDDICAEGTTPRVIIEFYDATNTTVLKSVTNLGV-----IEPTFTTGLSFTGASKIEVPLRTTADLTSLNFIQNDTTNDNIDLLTFNYVRNDVYISRACGYKTVFYLDAIADGNNWIQNIEVIQPNIETENEVHVKIYF.. 167
51 6.000e-32UniRef50_A0A2E2SPP6 Uncharacterized protein n=1 Tax=Cytophagaceae bacterium TaxID=2026729 RepID=A0A2E2SPP6_9BACT  ali  16  5.........LLLGIVVLTLILIACERDDICTTPTTPQLVIKFYDVANTTEPKPI----VLAVNEMGNEDTLFFAQDTV--LRVPLRTNEEVTQFNFIKNPGGETNTDVVTFNYETNELYISRACGFRISYDNLSAITTGRWIEDLQIESQTILDEETTHVSIYH.. 160
52 7.000e-32UniRef50_A0A1B2Z6P1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1B2Z6P1_9BACT  ali  14  5..........ILFLVIALGCFWSCEKDDICIAGDTPMMRITFVNFIDETLEKAPERLLIVGKDKTTPITTISPGSSSITEALIPLVPNTNQTEYYLVTNASIDGNIDALILSYTPNPKYISKACGYIVSYDNLITPDTDNWIKKITVLSPSITNENEVHLKIYH.. 167
53 1.000e-31UniRef50_F3PPI0 Uncharacterized protein n=9 Tax=Bacteroides TaxID=816 RepID=F3PPI0_9BACE  ali  65  1MKSLIRLIISGALLCPIISIAISCSEEADCSMATRAMLQCTLYTIDPVTQMVENDTLDSLTVTAYGTDSIIINNQKKVHDISLPLRYTADSTKLVFRY---SKVTADTIVIHHTNTPYFLSMDCGYQMKQAVTDIRYTRRNLDSIYVSNKEAGIYGRENFKLFY.. 161
54 2.000e-31UniRef50_A3UBS2 Uncharacterized protein n=1 Tax=Croceibacter atlanticus (strain ATCC BAA-628 / HTCC2559 / KCTC 12090) TaxID=216432 RepID=A3UBS2_CROAH  ali  13  1...MKHSFIAILVLLVIGFTTNSCQRDDICPESTTPKLIITFYDINTPTELKDVPSLSITAVGVNNPVSLNESGEANTDSIAIPLNPASTVVDFLFVRNSGNDENIDELQFSYTPQDEYINRACGFKSNYLDLNFEDTDSWIQNIEIIESNITDELTTHVTIFH.. 171
55 2.000e-31UniRef50_A0A1I5BUU5 Uncharacterized protein n=2 Tax=Salegentibacter TaxID=143222 RepID=A0A1I5BUU5_9FLAO  ali  18  1MKK---VFLNIIFVGLGIFFVSGCQRDDLCPTNTTPLLIIKFFDVQEPEETRSPTNLR---VWDQERDTILLNR-VNVDSIAIPLKTFEDNTEYAFTINAREIPNTDILRFTYGREQVYVNRACAYKVIYSNIDAGDDEPWIQTYTIEQTEVEDETNRHISIFY.. 176
56 2.000e-31UniRef50_A0A0X8G5C2 Uncharacterized protein n=4 Tax=Flavobacteriia TaxID=117743 RepID=A0A0X8G5C2_9FLAO  ali  22  1MKKNYVLIFIFL------FTFLSCEKDDICVETTTPNLIIKFYDNDDPTVIKQ---VTELTVWAETKDSIYINK--SLDSIIIPLNLNENFTKYILENN----TIKDTVKFTYNRNDIFVSRSCGYKTIFENLQIESTTNWIKSISINNSTIDNEKATHIYIFH.. 150
57 2.000e-31UniRef50_A0A1M5D0V7 Uncharacterized protein n=9 Tax=Salegentibacter TaxID=143222 RepID=A0A1M5D0V7_9FLAO  ali  17  19....................VMSCQRDDICPETTTPMLVLRFYDAEDRDSPKTPTNLSIRATVA-GKDTALY-KTINRDSFAIPLRTDRNLTTYAFTLFDNADEKTDSLSFTYGREQIYINRACAYKVIYNSMKLTLSGSWIDSYIIEEPNIEDETQAHISIFF.. 175
58 3.000e-31UniRef50_A0A2T2VV81 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T2VV81_9BACT  ali  17  2MKNRCAPFVFLLL---CSYLISSCEKDDICLIETTPRLIVRLFDKDNRLNPKAADSITIYGVGQERALVTL-----TTDSLVLPLKTQTAFTQYAFLLKTSTVSTTDTLQFNYSRYDEYLNRSCGYRANFILDDNLISPNWIESFEILIDTVSNEQQTHLAIYH.. 166
59 3.000e-31UniRef50_A0A2G2P0H1 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2G2P0H1_9FLAO  ali  19  1MKKYITLLILVVFTIL------SCEKDDICIDATTPSLIFRFYDNDSQTDLKQIK---LDSVWVEGKIKIQAYVNVSLDSIAIPIDLNENNTTYIIENNAV----KDTLKFSYTKNDVFVSRSCGYKTIFDNLQISYTTNWIKNISINNSTIDNETSAHLSIFH.. 152
60 4.000e-31UniRef50_A0A2G5GJG3 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2G5GJG3_9FLAO  ali  17  1MKMKSFKFFFLPIILLIIGVTASCERDDLCPESTTPSLIIRTSDVSNQD---SKKNVFGLRVQGVGIDDVLTFNIVSTDSIVLPLKTNTDSSQYKLITDDVIGGNEDIITINYTREEVYVSRACGYKTIFKDVTISVEDNWIQLTQPFNNSVEDETAAHFNLFH.. 183
61 4.000e-31UniRef50_A0A1J5LQP7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium MedPE-SWsnd-G1 TaxID=1860094 RepID=A0A1J5LQP7_9BACT  ali  19  6..........IATLIALFILIISCQRDDICVEPITPYLVIRFYDTDNPNTF---RNVNGLTVKAADKGIFESYDNVTTDSIALQLDPAENFTTYHLTSENG----EDVITIDYLRNEVFVSRSCGYKYNYSELDLSNSNNWIDNTEITQENVTDE-TEHIKIYH.. 152
62 6.000e-31UniRef50_A0A2N0EW64 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2N0EW64_9FLAO  ali  14  24...................ALNGCTRDDICSEGTTPLLIITFKDSANP---LVAKDVPNLTIETADNNSTQVITQTTTDSIAIPLNVSADISKYRFKYDDEGNPNMDILTFTYSREDIYVNRACAFKTVFDNLAAEGSANWVFSIIVEQQRIENETQAHITILH.. 172
63 7.000e-31UniRef50_UPI0004015816 hypothetical protein n=1 Tax=Gramella portivictoriae TaxID=326069 RepID=UPI0004015816  ali  16  5.........FLLFGLLSSIFLLGCQRDDICPESATPFLILRFYDIDDQQLEKAPQNLSIREVGDDTNSSTITYFRYSQDSIAIPLRTNAGETNLEFILNTENPQNTDILRFSYTVEEEYLNRACGYKANYINLDAGEDDSWIQNIQILETNIDDQNNAHVSIFF.. 187
64 8.000e-31UniRef50_A0A1Y4GQE2 Uncharacterized protein n=2 Tax=Barnesiella TaxID=397864 RepID=A0A1Y4GQE2_9BACT  ali  28  14...........LWLCGCALLLGSCGSDG-CVENRNSIPRAQFYAYNINEQALAIDSISIYGIGQP-NDSMLLDSAVAVSQVYLPLRFTQDSTQYVIRYSLASPRNNDTLTFVYRAYPYFASIDCGAMYNFSIETCRYTRHVLDSVAVIVHEITNDDVESVRLYY.. 167
65 9.000e-31UniRef50_F3QQR0 Conserved domain protein n=3 Tax=Paraprevotella TaxID=577309 RepID=F3QQR0_9BACT  ali  33  1MKKL-KGITLTLVCISIFIAAVSCESTD-CPINNVVYSTYGFYAATDEGESK-IQVLDTLTVTAAGTDSILINRLVRGSEVELPVSYSAATDTLIFHFTDTGRTRRDTIWIDKENTPHYESPTCPASMFHHVTAVRWTRLLVDSVSIVNPNINYNVSENFKIYFRS 164
66 1.000e-30UniRef50_A0A0A2LVT6 Uncharacterized protein n=1 Tax=Flavobacterium beibuense F44-8 TaxID=1406840 RepID=A0A0A2LVT6_9FLAO  ali  17  1MKKI---ITVFLLALLTAVSFWSCEKDDICAEGTTPSLIIEFYNRDNHTD---PKNVTFFSYFSADLDTIGTINGTNH--IEVPLRTDTTATTWNFRLGSSQTYNTDVITFNYETKELFVSRACGFKSNFTLDSEDEEGLWIQEYTIEESNIENEDEVHVKIYF.. 176
67 1.000e-30UniRef50_H7FTW6 Uncharacterized protein n=19 Tax=Flavobacteriaceae TaxID=49546 RepID=H7FTW6_FLAFP  ali  15  1MKKT------FLLLLVLAFTFSSCEKDDICDANTTSRLVISFYDINNSSVLKNVTDLTIIGEGKTEGITFNGSTLINASTVSIPLKTDADVTSFRFILNYGNTVYEDILKFNYSRTDVFVSRACGFKTEYTLDPLTPYVNWIQYIAVKNSIIANENETHLEIYF.. 173
68 2.000e-30UniRef50_A0A2E3AB91 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E3AB91_9FLAO  ali  18  1MKKQAAPF---ILFTLLFSILGGCEKDDVCLVETTPRLIIKLFNKDDRSLSKAADNIKIYGIGKENPLITL-----TTDSLVLPLKTQDAFTQYAFLLPTSTASLTDTLQFNYRRYDQYLNRSCGYRANFILDKNTVSYPWMDSFEILIDTVSNEQQTHLAIYH.. 165
69 2.000e-30UniRef50_A0A2U0TMB0 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A2U0TMB0_9FLAO  ali  15  1MKKIIAFLMIL------GFASSSCEPDDICDPSTTPRMLIQFFDISNPSVR---KNVTNLKVIGEGKTEGVVFNPTSADSILLPLNTDADIVKYKFILNSGNKVNTDNLEFKYTRESKYVSRACGFKTIYDLDSVNPDEMWIHYVIVAKNNITSENETIIKIFF.. 179
70 2.000e-30UniRef50_A0A1G9P398 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G9P398_9FLAO  ali  23  1....MKKLNIVLSILSGIIFISSCEKDDICVDGATPLLSIEFYDVTDTTELKDVPTLVVQGVLEDSVYPIIAN--VSLSSIELPLRVDATTTTFIISENDTTTVNKDTITFNYETKELFTSRACGFTVNYDNLSETDTDQWMKEIKIVTALVENDTLVNVKILH.. 166
71 2.000e-30UniRef50_A0A2S1LS32 Uncharacterized protein n=1 Tax=Flavobacterium sp. AJ004 TaxID=1981981 RepID=A0A2S1LS32_9FLAO  ali  19  1....MKKIVIALLLIAIPIIYWSCEKDDICTEDTTPKMVVTFYDNDNPSVPKRFVKLQVVLDGNAYNNPNKLV-FTNLDSIGIPLRPNSESTKYHLFLTNDTIITNDIVEFKYSKEDLFVSRACGYKSNFRLDPIVPTDSWIKNITVINREIINETAAHVKILY.. 172
72 2.000e-30UniRef50_A0A1H7F8U2 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H7F8U2_9FLAO  ali  16  2..KLYKAFIPIILGITGIYLSSSCERDDICAEDTTPLLIIKFIEDGTVSDIKQPNELQIGSPGFLN----IIDYETNQDSILIPLRTRGLLTDFEFIISDSDTPNTDVVSFQYTPVEEYVSSACGFKVNYNGLTASVDGNWIKSIIIEEDNVTDETAAHVLIFH.. 167
73 3.000e-30UniRef50_A0A2S1R0Y8 Uncharacterized protein n=1 Tax=Flavobacterium sp. HYN0059 TaxID=2175091 RepID=A0A2S1R0Y8_9FLAO  ali  20  1MKRLIASVTLLLIATCFVL---SCEKDDICATNTTPSLIVEFYDKDNTEELVNVVNFKYYAVGETDTLPDVADDTTTVNKIKLPLRTNATTTKWGLIFTRRTTPNTDFLEFNYTTNQFYVSRACGYKTTFTLDSDAADGLWIDDISLETTNIENENETHLKIF... 182
74 3.000e-30UniRef50_A0A0R2S256 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium BACL21 MAG-121220-bin10 TaxID=1655592 RepID=A0A0R2S256_9FLAO  ali  15  1MRFSYWMFLTVLLFGM------SCTKDDLCSTPTTPLLQIEFRDYLDRD---ALKPVTDLTVRLANGDSTLVQSGINASLLALPLNTEADQSVFYWTQFASDDLNRQRVSFFYQRSEVYVNRACGFKTQYTSMAIETEINWIQDLDLLTPNIENENQIHLIIYH.. 162
75 3.000e-30UniRef50_A0A2K1DW77 Uncharacterized protein n=2 Tax=Hanstruepera TaxID=1707752 RepID=A0A2K1DW77_9FLAO  ali  15  1MRKYHAILNFSITV-VLAILTWGCERDDICDPSTTPRLYLAFYNIESPEDL-NPKNVTRFRVQGVGNDETLLDGTSNKQEILLPLKTTEGITEYKLHKNDVIGGNEDIVTIEYTTEEVYVSRACGFKTVFKNVRITDGDRWIQNYLSVNDNVENENAPHFILFH.. 184
76 3.000e-30UniRef50_I3ZYH4 Uncharacterized protein n=1 Tax=Ornithobacterium rhinotracheale (strain ATCC 51463 / DSM 15997 / CCUG 23171 / CIP 104009 / LMG 9086)  ali  24  1MKKY---ILGIFLTMISGLIFWACEEDDICTENKTPELIIKLKNTTHPGETM--DSLYVLRQDSKD-EFTLIASGKGRDSISVPLPLKSTETNLIFSRRKTTDQFLDVLKIKYKYSTEYVSKACGFKAVYSDLSATSSSHFIKSIEILQHEVTDQNAAHILLTY.. 160
77 3.000e-30UniRef50_I3YZ80 Uncharacterized protein n=7 Tax=Aequorivita TaxID=153265 RepID=I3YZ80_AEQSU  ali  13  1......MFKRIIVLILIIFAFKGCTKDDICPEDTTPNLIIVFNDIANPANRKK---VEVLTVTTDDENAYEVLKLVSTDTIVIPLNTNSDTTKYVFIVNTDTTKIDDNVMFIYDRKNGYVSRACGFKTEFDNLREEVTNNWIEDVMVNRNTVNDENSAHVTMLH.. 161
78 3.000e-30UniRef50_A0A2E4RWJ0 Uncharacterized protein n=4 Tax=Aequorivita TaxID=153265 RepID=A0A2E4RWJ0_9FLAO  ali  15  18.....KMIRKISIAILIVFAFKGCTKDDICPPDTTANLVIAFNDISNPTNT---KNVTVLSVLTDNIDSTAVVSFENTNEIAIPLNSASDTTKYLFISSTDTINNIDKLTFVYQRKEDYVNRACGFKVEYFNLEASLENNWIQEIIVKRDTVNDENSAHITVLH.. 183
79 3.000e-30UniRef50_R7LGP0 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=R7LGP0_9BACT  ali  28  1....MKLPFLILAVFVVALFPSSCSNI-NCPLDNVVMMQCNFYASETHQELKLAD---VLSVCPANSDTVLINHITNVSSILLPLREGADRDTLLFQLNSAGQAATDTLFVTHTRTPHFESVDCPASVFHNISQVSFTSHTIDSISLVRSIVNYDDIENVRIYLRS 166
80 4.000e-30UniRef50_UPI0004179E99 hypothetical protein n=1 Tax=Flavobacterium filum TaxID=370974 RepID=UPI0004179E99  ali  13  1MKKIWLFSWLIVLVL-------GCEKDDICTENTTPRLIIDFYDSQNTSVLKQ---VANLEVIGEGANSTLSFNLVTR--IELPLKTNENFTQYSLNINSTSSTNIDILRFNYTRNDIYVSRGCGFKTNFELNLFEDDEYWIENIELIKNKIDSEDDVHIKMYF.. 163
81 4.000e-30UniRef50_A9DVL6 Uncharacterized protein n=3 Tax=Kordia TaxID=221065 RepID=A9DVL6_9FLAO  ali  18  1MKKLSYIGILGMLLIAAFISF-SCEKDDICVEGTTPLLVIEFFDINNNSGEELAKNVTNLWVEAVDPNTEVINTPQTTNTVSIPLRTQEGTTAYRFISGYEEDGNEDILTFNYETQEIFLSRACGYITNYTLVVTDDSENWINTILISNINVQNETVTHVKIYH.. 192
82 4.000e-30UniRef50_A0A2D8UKW1 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2D8UKW1_9FLAO  ali  15  1MKRY-----FALSFLVCLLCISSCQRDDICPETTTPKLVIEFFNFEDVDQPKDVRRLNVVA----EGDTIAFFDETNKNKISIPLRTDQDFTNYTFYRNDEYTTNGDKIQFSYAVNEEYVSRACGYKAEFDLVSEENNGNWIKNIEVQQPNILNEQITHLYIYH.. 173
83 5.000e-30UniRef50_A0A2M8ANC6 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium CG_4_9_14_3_um_filter_33_16 TaxID=1973993 RepID=A0A2M8ANC6_9FLAO  ali  17  3.....YYKFLAILFGIITLFSMGCEPDDICPESTTPNLIIRFYDVSIQE---SKKNVFGLRVQGVGNNSPLTNNVVTTDSIVLPLKTDATTTSFTLTSDDMIGGNEDVITINYTTEQVYVSRACGFKSIFKNVTLTDSENWIQSKESLNDNVEDETSAHFKLFH.. 180
84 6.000e-30UniRef50_W0EVG1 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=W0EVG1_9BACT  ali  29  13..........IMALCAITLLLGGCGSDG-CVENRNSIPRAQFYAYGAQDLALSVDSISIYGIGQP-TDSILLDSAVAVTQVYLPLRFTQDTTQYVIQYSLSSVRYNDTLTFVYQAYPYFASIDCGAMYNFNIDTCRYTRHVLDSVSVIVPEITNHDVENIRLFY.. 167
85 8.000e-30UniRef50_L7W6S9 Uncharacterized protein n=2 Tax=Nonlabens dokdonensis TaxID=328515 RepID=L7W6S9_NONDD  ali  16  19......................SCEKDDLCTPDQTPRLVIEFKDALNPLEDKAVDRIQVQEIGSTDIDSDDTLVLTNATTISIPLRTNSSTTSYNFILTEDNEVNSDNINFNYTLSEEYVSRSCGFRIVYNNLIAVQTTRWIDRVLILEDDITNNTDVHVQILH.. 170
86 1.000e-29UniRef50_A0A2D8LJF1 Uncharacterized protein n=3 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D8LJF1_9FLAO  ali  15  1MKAFVKISTILFLVISMV---AGCTRDDICDPLTTPLLIITFKDNANP---LQGKSVTNLVIRKNNSDSTFVFRTSATDSIAIPLDTEFDSTQLIFTLNDDTTTNADNLLFTYQREELYVNRACGFKTIYSNFAAEDSDNWITSFQVLQNEITDEIEAHLSIRF.. 167
87 1.000e-29UniRef50_C9LHW1 Uncharacterized protein n=2 Tax=Prevotellaceae TaxID=171552 RepID=C9LHW1_9BACT  ali  26  1MKK------WCFIVCASLVLLVSCSSID-CPLNNVVGLKAGLRSAATGASYTLQDTL---TITAAGTDSVLLNRATGIASLGLPLKYFGTTDTLRLRFDAQGRVATDTLYISHDNIPHFENQDCPVLMFHKLGKIRWTSHTIDNVVVVRPLVDYQNAENIRIYLR. 163
88 1.000e-29UniRef50_A0A2S7TNM5 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2S7TNM5_9FLAO  ali  18  1MRKIFFLIFGMLLL-----FTSSCEKDDFCVQPVTPNLVLRFYDTENITETKIVQRLSVIADGKQITDS--LFTSTSTDSIAIPLNTNTLETIYLLKMNDGNGSSTQTLTIRYTPEEDYVSRSCGFRFIFKDLTLETSSSWIDSLSVKEPLIDNQFQAHVQVYH.. 166
89 3.000e-29UniRef50_K2Q061 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=K2Q061_9FLAO  ali  17  1MKK---VLALLFVFSASLALFTSCEKDDICPGDTTPVLKLGFYNISNQDRFKSVARLRVIGINEDGTQRDTLNTFPDRSSIDIPLQTSESYSAFLFIKNSSDRGNIDTLRFNYTRQEEFISRGCGYAVRYNLDSIPNDQEWITSVFVQDPNLQHQDTVHVKIYH.. 190
90 3.000e-29UniRef50_A0A0A2MUB3 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A0A2MUB3_9FLAO  ali  18  1....................MVSCEKDDICAEGTTPSLVVEFYDK---SDEATLTNVNGLKYFVEGMTDTI--SPGSVSSIRVPLRVDATSTKWGFVYYRPNTPNTDFLEFKYIPRTEYVSRACGYKTLFTLDGTDATSLWIDHVDVITPNIENEDDVHIKIYF.. 158
91 3.000e-29UniRef50_A0A2W7HYY1 Uncharacterized protein n=2 Tax=Mesonia algae TaxID=213248 RepID=A0A2W7HYY1_9FLAO  ali  16  1MKKNTYIFLLMVFLI-----FSGCQKDDICSESTTPHLVIKFLDNENPSNTKAVTNLQ---VQEENLLEDYFETPINDTLIKIPLRTTANFTNYIFTLNDDALPNEDHLDFSYGTVVEYVSRACGYKTLFVGFEASSNTNWIERIEVQQPNITNEIDTHLFIYH.. 175
92 3.000e-29UniRef50_A0A1M5I860 Uncharacterized protein n=4 Tax=Flavobacterium TaxID=237 RepID=A0A1M5I860_9FLAO  ali  18  16.....................SSCEKDDICDANTTPRLVISFYDINNSS---IPKTVTNLKIIGEGMTDGIIFKGSDLTTVSIPLKTDANTSTFRFISNNPAAVNEDIIKFDYTREDFFVSRACGFKTLFTLDPLTPFTHWMQYVAVKKSNIETENETHLEIYF.. 173
93 3.000e-29UniRef50_A0A2M9TY21 Uncharacterized protein n=3 Tax=Psychroflexus TaxID=83612 RepID=A0A2M9TY21_9FLAO  ali  15  1....MKAFKYLFITALTLLLFSACERDDICPEDKTPQLVIQFFDVSNPEIL---KNVPKLKIVAPGNDTLDFD---TTSEIKLPLKTSENMTEYDFIQKSSNSPNVDRLIFDYARTNEFVSRACGFRVVYLDFQINDSNEWIKGVLVEESNINNENETHLNIYH.. 160
94 4.000e-29UniRef50_R7HMS2 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:279 TaxID=1262924 RepID=R7HMS2_9BACT  ali  28  7........ILLALSIGVIMWMASCSNNG-CEENSSSLPLAGFYSSQTKTSI-AIDSLTVYGIGSPG-DSAIIRNQSSTKQVYLPFDVDADCSRFVIQYNQQDEGITDTVTVSYDRVPFFYSKDCGAFYVFDVTDYNVSHNLIDSIQVPQRRIDNTNTENIKIFFR. 161
95 4.000e-29UniRef50_A0A2A4TQZ0 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4TQZ0_9FLAO  ali  18  4..KYIFMKRILILLACSFFVISSCETDEICDQTPTPSLVVTFYDNDNPDTRKEVTDFSAKLI-----DKDDVISLKTTDSINIPLDIFNLNTSYQF----NQGELIDNMEFTYTTKQIFMSKSCGYRTQFSDLSATVTNNWIKKISVEETIINDQKTEHVKIYH.. 158
96 5.000e-29UniRef50_C7PC32 Uncharacterized protein n=10 Tax=Chitinophaga TaxID=79328 RepID=C7PC32_CHIPD  ali  22  1MKYISGIIAILLL-----SVFAACEDETTCDSTLLSDLGMNFKKDTLQGFLVKDTIWPKVTLYAIGNDSVLIRRQP-RSSAFIPLDPLHDTCRFYLQLDSIAIP--DTLTFRYKRVPSFVSPGCGFATFYSLDTVVTTYNTIDSIHINNREVNSSNDTHISLFF.. 157
97 5.000e-29UniRef50_A0A2E1L417 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1L417_9FLAO  ali  13  2......KIHFYIYLIISFSLLVACEKDDICAEPTTPQLVITFKDANNINESKAVESLAVYAIENNELIPIETINGINTDSIAIPLRNDIGISNFKFYKNHSQEGDENHIYIDYNTVQVFISRACGFINNYIDLSVTPEGNWISGYEVINPILENENQAHVNIFH.. 175
98 5.000e-29UniRef50_UPI0003A9CF62 hypothetical protein n=2 Tax=Gillisia TaxID=244698 RepID=UPI0003A9CF62  ali  14  14.........LIFGLILMLILNLGCQRDDICAESTTPLLKISFFDAEAGNDSIA-KPVSNLSIKAVG-DTVNFPILSNPSEISIPLRTDVDFTSYEFILDASDEENTDIVDFTYARNQEYLNRACSFRVTYIDLKAKVTNKWIKRIEVDQSTVEDETTTHISIFH.. 180
99 6.000e-29UniRef50_A0A2D9BC21 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D9BC21_9FLAO  ali  15  1......MIKKLSFAFLILFAINGCTRDDICPETTTPLLIITFKNAAISTE---PKQVPGLTIETTLENSEIVLDNETTDSIAIPLNAGADITQYRFTINSDSEPNTDVVAFNYEREDIYVNRACSFKTNFTNLQAALEDNWIFQINVTNNTVEDENDTHITILH.. 165
100 6.000e-29UniRef50_A0A1J1E9K2 Uncharacterized protein n=1 Tax=Ichthyobacterium seriolicida TaxID=242600 RepID=A0A1J1E9K2_9FLAO  ali  22  1MKK--------IVLISVFFLFLSCEKDDVCIDGVTPKLKVEFFTKKKTSDIDQKKHLTDLTVIWKDTTDTIIKDSKNVQSVDLKLDFTKNHTEFVFI----TGENKDTIKVKYNRKPVFVSKACGYKITFNNPKFEYSKNLIKEIKLVETNITVDDETHVKIYY.. 157
101 6.000e-29UniRef50_A0A1Z9CP01 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TMED120 TaxID=1986702 RepID=A0A1Z9CP01_9FLAO  ali  18  7.........LFLVMLGLYSLFYSCEKDDICLEETTPRLNISFVDAQNPE---LSKEVQGLQIKSLSIDSILPVS----DPYLLPLRQDQSFTEFEFTTNLGTDTESKTIQFTYQRKDEYINRACGFRGTYFLNEQSPSNSWILGFEIRQDTISNEETVHLALYH.. 162
102 7.000e-29UniRef50_UPI000D6A9C7F hypothetical protein n=1 Tax=Chitinophaga sp. XJ-2 TaxID=2164099 RepID=UPI000D6A9C7F  ali  19  5.....RYMKYLILLLCCITAFASCDDDTICDQDTRTFANLRFYPNPNNNNIEKDTALPKVTVFALNKDS-LIKKRVGITGLQLPLDLGNDTSRFYFQTDSAR--VADTLTFAYKRQPHFVSAGCGVVMYFNIDSAWSTNHIIKSVQLSVKNITTINETHIILHF.. 162
103 7.000e-29UniRef50_A0A167H680 Uncharacterized protein n=1 Tax=Ulvibacter sp. LPB0005 TaxID=1763537 RepID=A0A167H680_9FLAO  ali  13  1....MNFIKKGILVSLITLFFYGCSRDDICSGETTPKLIIVFKNVLNPLEASSVVGLSIEADFT--TTGGVVLETTTSDSIAIPLRTNALETQFRFIQNTATNENTDIVTFNYITNELYVNRACGFKTNYDNLEGVVTDNWIQNLTIEKQLVEDEQETHITILH.. 164
104 7.000e-29UniRef50_A0A229I3C3 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A229I3C3_9BACT  ali  26  1MRKIIPMVILMMVLT-----MVGCSTLD-CPLNNTTYTKYKL----MGNIKTLQDTMTISTTKTAGTDSVLINKDVKVDSFILPMSYHQPEDVFYFEINRDHQVWKDTVTVKKENYSHFESVDCGPSFFHTITEVKTTHNYIDSIVINNKEVNYDSKAHFYIYFGN 158
105 7.000e-29UniRef50_A0A2N2ZEF3 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2ZEF3_9BACT  ali  13  8..FKMKASIYLLLFLVFLSAVSGCERDDLCTIPKTPGLVARFFNEANPDSLLAVTNMRVKFVGIDDSLTIGNSFTFNLDSIAIPLKTGVGETQIVLINNATNVRNADTLDVSYLAEKEFISKACGFKNNFVLQNITDANNWINSVQIINDTIQDERKAAVRIFH.. 178
106 8.000e-29UniRef50_A0A2E4PDU7 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A2E4PDU7_FLASP  ali  20  18....................FWSCEKDDICAEDTTPNMIVTFYNADNQEVRKSGRILQFM-----EGDSIEGRDAVAVDSLVVPLGADAESVRWGFTLVTNAPGNTDYIEFKYTHNEVYISRACGFKSLFYLDTIPADNLWIQEIQVIESNIENENTEHIKIFY.. 176
107 9.000e-29UniRef50_A0A1W6MGB8 Uncharacterized protein n=1 Tax=Nonlabens spongiae TaxID=331648 RepID=A0A1W6MGB8_9FLAO  ali  14  17.....................SGCERDDLCTPDTSSRMVVVFKDFLNPDTVKPVENLRVRVLGASELDFEGSTSLEMADTVYIPLRNFDDQTIYDFETDNEEDGNIDRLNFSYTRQDEFVSRACGFKVNYNDLQASPNQPWIIETEVIDSTVNNRNEVHVEIFH.. 170
108 1.000e-28UniRef50_H2BV62 Uncharacterized protein n=2 Tax=Gillisia TaxID=244698 RepID=H2BV62_9FLAO  ali  14  6..........FFSLALGLMLLTSCQRDDICPEETTPQVRISFFDFEERDIPKPPANLR---VKLSDTDSILLNR-VNVADIRIPLRTNRNVTEYDFILNEDATGNPDRLLFAYARDEIYINRACSYKVNFIDLNVDLSTTWIKEINLVEETIANETNTHIFIYH.. 171
109 1.000e-28UniRef50_A0A1L3JI03 Uncharacterized protein n=1 Tax=Tenacibaculum todarodis TaxID=1850252 RepID=A0A1L3JI03_9FLAO  ali  21  5.........FIIFLIATVSLNSACEIDDICVEPTTPNLVLRFYDATSTTTIKATDSLY---IWAEGKDSLYLNEA--VDSIAIPLNPLTSETVYNL---SQGTLLLNKLTITYTPEEEFTSRSCGYRFTYKDVSLSPSNSWISSITPIIPSITNQDSAHVQVFH.. 155
110 1.000e-28UniRef50_A0A2E1S4X2 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1S4X2_9FLAO  ali  19  1MKKLLTLIAVLVL------CLTACEPDDICLEGTTPKLIVMFYDKNQTE---AKKSVVDLQVKGVDMEGLLFD--ATADSIALPLKTLASSTSFSLTTTQNGNAVEDIITFNYNPEDQFISRACGYKTVFNNLTFSTTNNFISLIEILTDTNSDTNNTNVKILH.. 157
111 1.000e-28UniRef50_A0A1D8P614 Uncharacterized protein n=1 Tax=Lutibacter sp. LPB0138 TaxID=1850246 RepID=A0A1D8P614_9FLAO  ali  21  1MKKY------LILAIVIISTLLGCENDDFCVDPVTPNLVIRFYDNNDPTVL---KRVRKLYVWVNELDTI--YENVASDSIAIPLNPLEDFTILHLSADD----IQDDITINYNKKEVFVGRSCGYKYNFENIGLTINNNWILDTEITNETVENE-TEHIKILH.. 149
112 2.000e-28UniRef50_A0A2S0HYW8 Uncharacterized protein n=1 Tax=Aureitalea sp. RR4-38 TaxID=2094025 RepID=A0A2S0HYW8_9FLAO  ali  13  5..........ILLFTFVLISFLGCTRDDICEEGTTPLLIITFNDIANPSER---KSVTNLSVETADLEGTEVIAAVTTDSIALPLRNTGNLTRYRFNSGGTTTPNTDIISFNYTTEDIYINRACAFKTVYHDLSVEGTANWIIQVEIETTDVIDETETHITVLH.. 162
113 2.000e-28UniRef50_A0A1G5ITF5 Uncharacterized protein n=1 Tax=Flavobacterium caeni TaxID=490189 RepID=A0A1G5ITF5_9FLAO  ali  19  1MKKILALLLLVFTL--------GCEKDDICDTNTTPRLVLSFFDYNDPS---VAKNVVNLKVVQEGREDGIVFNESGTDSVSLPLDTSADRIRYILTLNDPGLIYTDTLEFNYSRQTLYISRACGYSVYFNDDQAATQGNWIQNITIANRNVISENETHLNIY... 182
114 2.000e-28UniRef50_A0A2W1K614 Uncharacterized protein n=2 Tax=Mesonia sp. K7 TaxID=2218606 RepID=A0A2W1K614_9FLAO  ali  16  5..........FFYFLLLLIGFSACQKDDICSEPTTPHLVIQFFDINNITEAKIAPNFNAYEVTDNGNISYYYETAINDTIAKIPLRTDQNFTDYNFINDGEISENTDQVSFTYGVNDKFVSRACGYKTEFLGLDAQVDQNWIKTIEEQQPNVIDENTTHIYIYF.. 171
115 2.000e-28UniRef50_A0A0Q1DYC1 Uncharacterized protein n=4 Tax=Nonlabens TaxID=363408 RepID=A0A0Q1DYC1_9FLAO  ali  15  6.........IIAVLLLVACCFSSCEKDDLCIPEDVPRLVIVFLDARNPLLRKPVERLQVFETFAVSLNGTGATSLTQVDSISIPLRNDQNVTNFAFTRTSNGAVNADPINFRYTEEEVYLNRACGFTSSFLDLSLEPVNPWISNVIIRNADVISKNDIHVEIRH.. 170
116 3.000e-28UniRef50_A0A2G5KSZ8 Uncharacterized protein n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2G5KSZ8_9FLAO  ali  14  1MKKIK-----LILLTLCCISLLTCERDDLCPEPTTPSLVIGFFNNALPEN---PKTVNDLYVIGLDNDNVLPYSVVNVDELILPLRTDQNSTTFTLISDNVTSGNSDTVTITYETEDVYVSRACGYKTIFNNVIVATDGNWIILAQPENDNLTIEDETTTHYYFNH 172
117 3.000e-28UniRef50_L0JCW6 Uncharacterized protein n=11 Tax=Bacteroidales TaxID=171549 RepID=L0JCW6_PREDD  ali  31  10.........LSAGMLLAVLVTAACSSVD-CPLNNTVYANYKL----MGRVTTLPDTLTISTTRQNGFDSVIINRQVGTDSFSLPMSYVQDEDVFYLRTNAT----MDTIRLRKTNHPHFESVDCGLNYFHTLTGVTFTRHALDSVVIHHQEVTYDPTKHLHVFFK. 157
118 3.000e-28UniRef50_F3ZUI7 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=F3ZUI7_9BACE  ali  44  3.KRYTFILSVALCFISITGLLISCSEDSDCSMTARPFMVSYIYKYGANKNILLPDTLKSLTVKALETDSILLNKGELVHTFDSPLRYTKDTTALVLEYSDEAK-NNDTIWISHKNTSFFVSIECGYQMRQSIEKVIYTQHTLDSVSLRNNEANNYGRENIKIIY.. 165
119 4.000e-28UniRef50_G2Z2L2 Uncharacterized protein n=7 Tax=Flavobacterium TaxID=237 RepID=G2Z2L2_FLABF  ali  16  1MKKI-------IALLLITFGFLGCEKDDICDAATTPKLVIHFYD----STTNLSKNVVNLKVIADGMSEGVVFNSSGVSSIKIPLKTTADATKYTLIYNNASTVFTDILTFNYTRKNEYISRACGYKTIFNNLETNTTGNWIDGITIKKYNITSENETHIDIYF.. 183
120 4.000e-28UniRef50_UPI000B520538 hypothetical protein n=1 Tax=Geofilum rhodophaeum TaxID=1965019 RepID=UPI000B520538  ali  24  1MKAKHWMGVLLF----GSFLWASCSQNEICLSNQHA-LQSGFYSALALED--KDTLLTEARIYGILPERDPLYDNETVGKLFLPLSFQKDTTAFVLY---SGEFMKDTLWIRHSSELKYISRDCGFTFNFELDSVWFTRVFIDSVAIENPGVNYENFENVKIYIY. 156
121 4.000e-28UniRef50_UPI000DC1FDD5 hypothetical protein n=1 Tax=Flavobacterium lacus TaxID=1353778 RepID=UPI000DC1FDD5  ali  19  1MKNSLKIFFLLL----TTGLFSGCEKDDICADPTTPRLIIEFYSKDNSTVRKI---VANLKIQGEGAATTLNFNQ--VDTIELPLKTNENFTNYSFNINSTSTNNTDLIRFNYIVNDIYVSRACGFKSFFNLNGVVKTNPWIENVEIVKSNVETEEDVHIKMYF.. 169
122 5.000e-28UniRef50_A0A2E1N0V7 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1N0V7_9FLAO  ali  14  3..........VFYTLILILLVLSCESDDICPESTTPRLIITFYDMQNTEVKKNVEDLAVYAIKDGQLNLMNEINGITTDSINIPLRNDQAISNFKFYKNNVPSGMIDHLYVDYEIYQKFISKACGFINNYNLLNFLTNDNWIGGYVIEXNLIENENQSHVKIFH.. 172
123 5.000e-28UniRef50_A0A2M8Y033 Uncharacterized protein n=3 Tax=Flavobacterium TaxID=237 RepID=A0A2M8Y033_9FLAO  ali  15  1MKKI------LAFLMILGFASSSCEPDDICDPPTTPRMLIQFFDFNNAN---VAKSVTSLKVIGDGMNEGVVLSPTNENSILLPLNTEADLVKYTFIINYDNKVNKDNLEFKYTRQNIYVSRACGFKTIFDLDEAPADQMWIKYVIVKKKNIQFENETIIQIYF.. 179
124 6.000e-28UniRef50_A0A090QLA7 Uncharacterized protein n=2 Tax=Nonlabens TaxID=363408 RepID=A0A090QLA7_9FLAO  ali  12  1...MSKFKATFILIWAIFFLVSGCEKDDLCTLDQNARINIVFKDRSIPSDNKV---VSQLRVLLENVDTEVPLNSTNTDSISIPLPIDVNTVTYRFERIENENENQDAITFTFDTREEYVSRACGFRVVYDNLTATGTNNWINSVVVNETTIEDNQIIHVEIRH.. 171
125 6.000e-28UniRef50_A0A1M6E1J3 Uncharacterized protein n=1 Tax=Mesonia phycicola TaxID=579105 RepID=A0A1M6E1J3_9FLAO  ali  14  1MKKYT-----LFTIIIALLFTSSCQKDDICPEQTTPKLVIEFFDIENPE---LSKSVSNLNVIAEGQTDYYFETTEDLSTITIPLNTAQDFTNYTFVRNYDVDTNEDQIQFSYAVNLEYVNRACSYKAEFLNFNATDEVNWIKAIEVLQPNILDEEDTHLYIYH.. 170
126 7.000e-28UniRef50_A0A2E1UVT8 Uncharacterized protein n=4 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E1UVT8_9FLAO  ali  16  1MKYN--FFLISILFISTMWIFIRCEKDDICLDGTTPRLIIRFFDADSVENLKPTGALLVNKV-EDSIDVYIRKNIFGTDSISIPLDAKNNLTELKFYYQGFENENIDTLSFHYDRYDIYLNRACGFKGQFILKDYQTSESWVKSYKIIKDSILDEKSMHLAIYH.. 169
127 7.000e-28UniRef50_A0A024FKT6 Uncharacterized protein n=2 Tax=Winogradskyella sp. PG-2 TaxID=754409 RepID=A0A024FKT6_9FLAO  ali  17  1MKKLKFLILF------VTIALISCERDDICAETTTPRLLIEFYDVSNTDDLKSVPRLTLYGEDLVTNPTIAFNENVNAADLPLQINTEGTVTTSRFIIDGTGDSNIDILEISYVPEFIYVSRACGYKSIFTALTVTDTDNWINNIEIVESTVENENTVHVRIFH.. 178
128 7.000e-28UniRef50_A0A162P3F4 Uncharacterized protein n=8 Tax=Flavobacterium TaxID=237 RepID=A0A162P3F4_9FLAO  ali  18  1MKKI------ILLVVALALSFSGCEKDDICDSNTTPRLVIGFYDFLNPSVL---KNVSNLKVIGEGMTTGILFNGAETTSISIPLKTVGTTTTYSFTLNSGNTVDQDIIRFDYSTQELFVSRACGYKTIFTFDPTNPYTHWIKFISVEKNNIENENETHIKIFF.. 173
129 7.000e-28UniRef50_A0A2S1LDU8 Uncharacterized protein n=17 Tax=Flavobacterium TaxID=237 RepID=A0A2S1LDU8_9FLAO  ali  18  16.....................SSCEKDDICDTSTTPRLVIDFYDFNDPSTAKAVIDLTIIAEGMTDGITYQSSTLINGSTVSIPLKTTADQVKYRFILNTTSLTNEDDIEFNYIRSSLFVSRACGYKTVYELDGATADELWIREIVLETRSITNENETHLEIFH.. 173
130 9.000e-28UniRef50_A0A1H9FJD1 Uncharacterized protein n=1 Tax=Hyunsoonleella jejuensis TaxID=419940 RepID=A0A1H9FJD1_9FLAO  ali  19  1MRYIKLSIILLVFIVAVTQ--VSCERDDLCPETTTARLVMEAFDVSLPDDSKNIFGLRIEGIDDEGNGIGVLYNVVTSSNLVLPLRTDEDVTKYKLHRDYTNGGNEDIITITYIREEVFVSRACGYRTIFNNVQIRDDDEWIRSIQTENDNVENEAEAHFILLH.. 181
131 9.000e-28UniRef50_A0A2U0I3L9 Uncharacterized protein n=1 Tax=Marixanthomonas sp. HN-E44 TaxID=2174845 RepID=A0A2U0I3L9_9FLAO  ali  15  1......MIKKFCIAFLVLVACNGCTRDDICAETTTPLLIITFKNAAITTEAKPA---NGLTIETTLENSVTVLDNQTTDSIAIPLNTGADVTRYRFTINTDNPPNTDIVEFSYDREDIYVNRACSYKTIYNNLDATFTDNWIFQINVNNNTVENENDTHITILH.. 166
132 1.000e-27UniRef50_UPI000DBA85C9 hypothetical protein n=1 Tax=Chitinophaga skermanii TaxID=331697 RepID=UPI000DBA85C9  ali  28  1......MFKLCAGLLLLATTFYACDDQTECDKAFRASVRMRFKYPRPIDGRVVDTTLPYVTIKSMMGDTVA-KNQTGLTGVALPLNGVIDSTWYYFKADSTVLG--DTILFRYKRHQQFISPGCGFATYYHLDTVITTRHAIDSIQIINKEVTNNEDIHLYLFY.. 156
133 1.000e-27UniRef50_A0A2T4T4R0 Uncharacterized protein n=12 Tax=Prevotella TaxID=838 RepID=A0A2T4T4R0_9BACT  ali  25  1MRKMFW------LLAAMAILVAACSTID-CSLNSRVAATYKL----AGDVKKLATPLTVTAYLGDGNDSVILNKLADADSFQLPMSYNHHEDTFYFKSDTTANAPTDTVVITKEDIPHFEAVDCNPIFFHEIKGVRHTRHFIDSIVVNNKHVTNGSKSNFFLYLKS 156
134 1.000e-27UniRef50_A0A2E4PNS3 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A2E4PNS3_FLASP  ali  18  17....................FWNCEKDDLCAESTTPRVVIEFFNNANPTELKSVTKLSKLVADASLEETDDTRYLFTANKILLPLRTTVDQSVFNFTLNGEVNEATDELIFDYTRKEIYISRACGYKTNFEITNATLPGSWIQSITVENVIIDNENETHVKIYF.. 176
135 2.000e-27UniRef50_A0A1I3MES2 Uncharacterized protein n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I3MES2_9FLAO  ali  16  1....MKHLKLYLVVLVASFSLLTCERDDLCPEPTTPSLIIDFYNNNAQDSRKNATNLYV--IGQDNEDVLDGYNVATVNQVVLPLRTDTDTTTFSLTRNNITSGNTDTVTITYATEDVYVSRACGYKTIFKNVVVTTDANWIIFAQPENDNIEDETTTHYFFYH.. 173
136 2.000e-27UniRef50_E1WQY1 Uncharacterized protein n=100 Tax=root TaxID=1 RepID=E1WQY1_BACF6  ali  59  1MKKLIKLVLFLMVAYPLTAILSACSEESDCSMTGRPMVYAKMYTINPETKAVLNDTLDSLSVTAFGTDSIIINNQKKVHDIALPLRYTSDSTILVFHYTRL---LRDTMVILQTNTPYFQSMDCGYSMKQNIISITVTNHSIDSLYIKSNAANINGTENLKIFYR. 172
137 2.000e-27UniRef50_A0A1B2Z0E2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1B2Z0E2_9BACT  ali  13  1......MIRKIVLLFLLVGIISACTKDDICTKETTPFLVIKFKNKINPLLSKNVTNLTVTTI--VNNDSIDIYKSQTKDSILIPLNTLTNNTEYLFTENNTNPGNTDKVIFTYQTDNIYINRACSFKVIFTQLEIVEGENWISEIEVNQSTVENEDETHVTIFH.. 164
138 2.000e-27UniRef50_G2ECA7 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=G2ECA7_9FLAO  ali  17  1MKKTV------ALLILLVSIAFSCERDDICTLDTTPRITIEFFDIQNPEQQ-NPKNVFKCRVQGIGNDEALLDGASPKQIILLPLKTTETSTQYSIYSNDYPTGNEDIITISYVPEEVYVSRACGFKTVFKNITITDTDNWIEIIQSVNDNLENEETANFSIFH.. 180
139 2.000e-27UniRef50_A0A099C011 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=A0A099C011_9BACT  ali  27  4..........LILLILSGVLLAACSSIE-CPMNSRVYTTYKL----QGTVKKLQDSLTVFANLGNGVDSIVLNRAIEVDSFQLPMSYANDADTFYFLYNKSGKLGRDTIVVEKTNQPHFESVDCNAVVFHTIKSVRFTTHMIENLSINNANVNYDATSHFNITFKD 156
140 2.000e-27UniRef50_D3ICL2 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 299 str. F0039 TaxID=575614 RepID=D3ICL2_9BACT  ali  26  1MKKLIYFLLFSLFI-------SACSSTD-CPLSSGVLARYKL----MGNVKKLVDTLTISTQRHTSGDTILLNRAVNVDSFNLPMSFQGNEDALFLIKNTNKEIWKDTIRITKTNEPHFESVDCAAAFFHTIQKITYSRNAIDSVVVHNSKVTNDNQTHFYLYFKS 156
141 2.000e-27UniRef50_A0A1W1Z6Y0 Uncharacterized protein n=2 Tax=Moheibacter sediminis TaxID=1434700 RepID=A0A1W1Z6Y0_9FLAO  ali  19  1MKK----RILVLGIIFTAVFAVSCEEDDVCVGEGTPNLTVVFRTLQTQENLT--DTLFVERVTSEGELIDTLYKWLITDSIKLPLGGLDESVNY-FRIKLRPTGQSDILTVNYTPTTSFVSKACGFRLTYDDLDYESTENAIRNLTPSESNVENEAATNLYIYYNN 160
142 2.000e-27UniRef50_A0A0B7H2N1 Uncharacterized protein n=5 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7H2N1_9FLAO  ali  14  1MRFFERFIYFTII----SVFLGACESDDLCDPVNTPRLVVRFHDVDATSNKKPANNMIIY-----GKDNNLILTNATTDSVALPLKIETLSTTFVMVSDTITSGNVATVTFTYGIEEEFVSKACGFRVVYNTLKASSDNSWIKSVNVKNTNVKNESSAQVHIYH.. 167
143 2.000e-27UniRef50_A0A2D8G0Q0 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2D8G0Q0_9FLAO  ali  12  1......MALRFISALFLMALFIGCTRDDICPEDTTPLLYIEFRDITDREST---KAVQDLLIYVNNADSTLVTSAINDTEVLIPLDTELNLSSFLFEYNSTSEENFDAISFNYSREEVYINRACGFKVIYNDLFVTLNGNWILDTEILKSTIDNENEVHITIFH.. 165
144 3.000e-27UniRef50_R5I975 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=R5I975_9BACT  ali  26  1MGKFLRYITITLPVWLVLIAFISC-NDTGCMENRSSIPYVTIYSDSTVPQTIYIDSLTVYGVGQIG-DSMLLDTAMNVSSMYLPLRDDKDTTRFVIRYDQKNRYKTDTLTFVYHSYVYFASAECGAMFNYIIDSLGYTTYQLQSAKLVQNEITNFSTENIQLFYH. 166
145 3.000e-27UniRef50_A0A1I5C566 Uncharacterized protein n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I5C566_9FLAO  ali  17  1MKK------LVALLILIGCLAFSCERDDICTLDTTPRLTIAFYSIENPEQQ-NPRNVARCRVQGIGNDETLLDGSTSKQIILLPLKTTENSTQYSIYKNDFITGNEDIITISYVTEEVYVSRACGFKTVFKNISMTVEDDWIKIIQSVDDNIENENATNYNLYH.. 180
146 5.000e-27UniRef50_A0A2L2WTI8 Uncharacterized protein n=3 Tax=Prevotellaceae TaxID=171552 RepID=A0A2L2WTI8_9BACT  ali  25  2......LFIRKIMAMVLLPLSVACTNID-CPLDNVVEMTCGLYRAEDGASLTLTHVLTVST--GGSKDSILLNQAQNIDAFLLPLRQGSEMDTLLLNFSDATRSATDTLFISHNNVPHFESLDCPASIFHQLTSVRWTSHTVDSAAIVRKVVDYENIENIKLYLRS 165
147 5.000e-27UniRef50_A0A2E5Z018 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E5Z018_9FLAO  ali  15  1MKSKLKKNLFYLFFILI-----SCEKDDICIESGTPRIILSFYDKIDKN---LKKPVENLLIKGLEKEDTL--DIFSGDSIAIPLRNDSNFSKYEFILNAGGNSNNDTIHIFYSRYDLYINRACGFKSNFILNDLNKDNNWINEIVKLKDTVLNEDYSHLAIYH.. 162
148 6.000e-27UniRef50_D1P8U5 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=D1P8U5_9BACT  ali  26  1MRKIIPFVVFMVLAMMGCTSL-------DCPLNNTVYTKYKL----MGDNKTLKDTLTVSTKKIEGTDSVLINKDVNVDSFSLPMSYSLDEDVLFFEIHTSKQVFKDTVTVSKVNRSHFESVDCSPSFFHTITDVKTTHNYIDSIVINQKEVNYDSKAHFYIYFGS 157
149 6.000e-27UniRef50_A0A2P8CST3 Uncharacterized protein n=1 Tax=Taibaiella chishuiensis TaxID=1434707 RepID=A0A2P8CST3_9BACT  ali  21  1MAKKNTVVFLFIMILLGSLGWASCEKEPECYQPVNVTLISGFVNTDTFQLQYTPRRLLSPGMYALDVDSLVIGSANGEDRLSVPLNPRSDSMRYRFLADTSRKAAADTLTFYYTSSVHFISNDCGYTNYYQLDSVHTTKNVVDSIALVNNAVTNNQTNHVQLYFFD 184
150 6.000e-27UniRef50_A0A1I7N753 Uncharacterized protein n=4 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1I7N753_9BACT  ali  21  1......MRFRLWTIVCLLMIISACNQDKICEEPTDVKLTIGFYHKIDSTQY-QDTSLSLAYVQTLHQPPVLLIDTSTFQSISLPLNQLADSSGFIIQPDSVN--LADTILIYYARQQKLLSPGCGFVTFFTIDTIHYTTHHIDSASVVNKSVINIHEEHIRLFY.. 156
151 8.000e-27UniRef50_D1VX01 Uncharacterized protein n=10 Tax=Prevotella TaxID=838 RepID=D1VX01_9BACT  ali  24  4..........IIFLLSVALGFTACSSI-NCPLNNTVVTSYKL----MGSQPKLEDTLTIIAARSMGTDTVLLNRAVGIDSFILPISYAQPEDVFFFKINKDGQMFRDTLRIAKDDQPHFESIDCPPAMFHRLKSVTCTHQTLDSVIINNENVNYDATPHLYLYFK. 155
152 1.000e-26UniRef50_A6ETM5 Uncharacterized protein n=1 Tax=unidentified eubacterium SCB49 TaxID=50743 RepID=A6ETM5_9BACT  ali  10  1...MKFLKFWPQVLVSMMLLFNGCTRDDICDPNTTPFLIITFKDNLNRDDAKE---VVGLSVIGDYTPEAEILTEVTTDSIAIPLRTATNNTQYKLVRTDTSAEIIDVFLANYQTEDIYINRACAYKTIFNNLNVTDSDNWILNYEINQTNVADEIQSHITIYH.. 170
153 1.000e-26UniRef50_D3HVN2 Uncharacterized protein n=6 Tax=Prevotella TaxID=838 RepID=D3HVN2_9BACT  ali  27  7........LPAVIAAGLMLLAGGCSSIE-CPLNNTVYTKYKL----AGDVTTLTGTLTVAIKRTSGTDSVLINQDTKVDSLMIPMSYVQAEDELHFQLTTTGTTVNDTVKVKKTDHPHFESVDCNPAYFHTITGVSYTTHAIDSVVINQPNVTYDATTHFRLYFR. 160
154 1.000e-26UniRef50_A0A238VD22 Uncharacterized protein n=2 Tax=Lutibacter TaxID=358023 RepID=A0A238VD22_9FLAO  ali  22  18......................SCEKDDICLENTTPNLVLKFYDINNDT---LAKPVTSLTVWANELDTIYLDKPF--DSIIIPLDFNLNKTNYKLVSNK----IVDTIYFSYERNDIFISRSCGYKTIFENIEISFTNNWIKGFNINNTIIDNDTTAHINIYH.. 151
155 1.000e-26UniRef50_A0A257KEZ4 Uncharacterized protein n=1 Tax=Flavobacterium sp. BFFFF2 TaxID=2015558 RepID=A0A257KEZ4_9FLAO  ali  14  1.....................MGCEKDDICDPSTTPRIVLEFHDVTNPNSLKNVANLKVIGID----ESTEIGTYNGVSKIKLPLKITADQTTYKLISNSTDNTNTDILQFSYTRQTLYVSRACGYKMVYTMDNTPTDGYWMQQIILNNSSIQTENETHVIIYF.. 152
156 1.000e-26UniRef50_A0A2D7A320 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7A320_9FLAO  ali  15  4......KFLFLILITFCFTNLSNCERDDICLEGTTPNLIIRFYDAENINNPKPLRFIQEMDDDKTDISSYLIRFLIPGDSVSVPLSSNKDYTEYKLFNNNISDPQIDTLRINHSRNDTYLNRACGFIGQYIIEGISLDNSWIKSYKIVKDSILNEESKHIILYH.. 172
157 1.000e-26UniRef50_A0A1Z8SYW3 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1Z8SYW3_9PROT  ali  14  3.....KPYFKKILYLGVLFFLFSCERDDICIVTTTPDLVLLMLDKDNTNQTRTP---AGFSIRALGTEKNLATQPS--DSFALPLKIQENFIQFEFILNGTENENIDTLQINYQRFDKFINAACGYRSNYILLILNPGDNWIQGFTILKDTITNENRAHLGILH.. 165
158 2.000e-26UniRef50_U2NNX3 Putative lipoprotein n=10 Tax=Prevotella TaxID=838 RepID=U2NNX3_9BACT  ali  26  1MRKSFWLIAVIALFVG------ACSTID-CSLNTRVATTYKL----MGDVKTLADPLTVTADLGDGNDSVVLNKLVSTDSFQLPMSYNRHEDVFYFKSEGTTGTLLDTVIVSKKDKPHFEAVDCNPIIFHEITDVRYTKHFIDSIGVNNKQVTNESKSNFHLYLKS 156
159 2.000e-26UniRef50_A0A1G7HZQ1 Uncharacterized protein n=4 Tax=Chitinophaga TaxID=79328 RepID=A0A1G7HZQ1_CHIFI  ali  21  1MKYISGIIAILLL-----SVFAACEDETSCDQTLISDLGMNFKKDTLQGFLVKDTIWPKVTLFALGKDSIV--RNVPRSSVFMSLDPLADSSRFYLKLDST--MVPDTLTFRYKRKQNFVSPGCGFATFFTLDTVITTYNTIDSLHINNREVNSTNDTHISLFF.. 156
160 2.000e-26UniRef50_R7EZX1 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:485 TaxID=1262927 RepID=R7EZX1_9BACT  ali  21  1MKR-----LTLAAIFAGGFLLAACAGKE-CYENQNTLPLAGFRDMA----THRAVTLSHLTVAGIGAPDSLLTDSAAVEQVYLPFRPQSPSTSFEFRYGDT--GVADTLTFYYATQPWFASEQCGVVYHFRVDSIRHTRYLMDSVAVPGGVITNVNGQNIEIYFR. 154
161 2.000e-26UniRef50_A0A2N2YBD7 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2YBD7_9BACT  ali  16  1MKKTIYLLLFLSI-------LSACTRDDICIPEKTPLLIVRFYNAQNPETFKATTNFTIIK----EGEEFPFFNPVSVDSIAIPLATSENFTNYFFVNNSTETPEINFISFNYTRANEFISRACSFRTNFNILDTTSSTNWIESIVILTDSINNQHAAHIKIYH.. 162
162 2.000e-26UniRef50_A0A2E2Z824 Uncharacterized protein n=11 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E2Z824_9FLAO  ali  14  1......MIKKSILISLFFLMITSCESDDICPESSTPRLIITFYDISNPELRKDVENLAIYRLLNGEMEILNEINGINTDSIAIPIRDDESISNFKFYKNFTPIDNTNHIFIDYEINEIFISRACGFINNYNILSFYNYDNWILDYVILNNLVTDENESHIKILH.. 174
163 3.000e-26UniRef50_A0A1W9SLD1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_117 TaxID=1971632 RepID=A0A1W9SLD1_9BACT  ali  21  1..MIKRTLKLFALFLILTYSLNSCQADNECETSAISHAKLDFYIIEDDKEKAVG--VEGISIYGLGREDSLIYEIDTISYALLQLSPAADTVGFVFDY----GSFSDTISFLYKTNKHFESIECGFIANFDIDTVKYSENAIDSVALIDKTITSEDEEHVKIFFK. 158
164 4.000e-26UniRef50_A0A1C4DMR0 Uncharacterized protein n=4 Tax=Chitinophaga TaxID=79328 RepID=A0A1C4DMR0_9BACT  ali  19  24..RFIKFIQSYWYVLLLPLLFLACEDQTVCDQTLRSDFKMNFRHDIDSTDSQIDTALPKCTIYALGKDSI-YRKTRDVTYATLTLDPLHDTSAFYVQADSTSK--ADTLTLIYTRSPHFVSAGCGFTTFFGLTSVTCTHHSVDSLRLLQPQITTTNDTHVTLYF.. 183
165 4.000e-26UniRef50_A0A1Y0M7N5 Uncharacterized protein n=1 Tax=Polaribacter sp. SA4-10 TaxID=754397 RepID=A0A1Y0M7N5_9FLAO  ali  20  1MKKTILSLLFLIIVI------SACEKDDFCLKNVTPSLVINFYDDTNKETL---KNVRELYVWAEGKTDSIYINQ-TINSITIPLNSLATEIVYNFSKENVVNQF----TINYTTEEEYVSRSCGYKVNFNEVTFSSDTTWIISFTPETTTIENQTEAHVQIFH.. 152
166 4.000e-26UniRef50_A0A1A7R510 Uncharacterized protein n=2 Tax=Gelidibacter TaxID=49279 RepID=A0A1A7R510_9FLAO  ali  15  1....................MLSCERDDICASPTTPHLIVRFYDIDDRSETKTVRRM----VVKEENTSKFIVDDKTLDSIVLPLRIDVNTTRFEIKRDIDFETNTDILEVTYTPELIYVSRACGYKSIFNDVIASRDNNWIIDVEVINTTINNENAAHINIYH.. 157
167 4.000e-26UniRef50_A0A2G2KHQ6 Uncharacterized protein n=1 Tax=Kordia sp. TaxID=1965332 RepID=A0A2G2KHQ6_9FLAO  ali  15  1MKKTITTIAFLLLAI-------SCEKDDVCTTTNTSHLIIKFYDQLDQEVPKSVTNLLVVGVD----NTLSYGIESTRDSIAIPLRILENNTSYRLIKDDFATGNEDVIIINYVNEEIFISKACGFKNVFDDVNFGFTDNWILSTNVITNKIETEDNAHIHIFH.. 172
168 6.000e-26UniRef50_A0A090WIF9 Uncharacterized protein n=2 Tax=Jejuia pallidilutea TaxID=504487 RepID=A0A090WIF9_9FLAO  ali  18  1MKSIMKYIKILIWIFIIALIYVSCERDDLCPESTTASLVMETFDVSLPDDSKNVFGLRIEGVDNDGNGIGVLYDVVTTNSIVLPLRTDQDVTVYKLHQNYTEDGNEDILTITYIREDVFVSRACGYRTIFSNVQVRDDDEWISLIQAQDDNVENEAEAHFILLH.. 186
169 6.000e-26UniRef50_A0A2K8XFF4 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2K8XFF4_9FLAO  ali  14  1MKKIITLLLLFVCIAF------SCERDDICPEDTTPRMVVEFRNVTAIDNTKNVAGLRIEDFDDATRTLDDDHSITSEDQMLLPLKTDANETKYRVYKDGTITGNPDVITITYDTEEIYVSRACGYKTIYKNVLLTITDNWMIFAAPENDNVINEDEIHYTIRH.. 172
170 6.000e-26UniRef50_UPI000B4A5EEF hypothetical protein n=2 Tax=Polaribacter TaxID=52959 RepID=UPI000B4A5EEF  ali  12  6...........IFIVLVVLFLAACEKDDFCTKNVTPKLIITFYDDINRET---PKKVQRLSIVADSKQTDSLFTNMASDSIAIPLNSLTNQTIYTLKKNATNTNEIATFTIQYNTNTDYVSRSCGFKVIFNNLEFSANSNWIKDFSPTQTNLDDQNKAHVQIFH.. 162
171 7.000e-26UniRef50_A0A1V6ETN7 Uncharacterized protein n=2 Tax=Bacteroidetes bacterium ADurb.Bin090 TaxID=1852803 RepID=A0A1V6ETN7_9BACT  ali  23  29......................ACVSNTNCYESKEVMAYCGFYSAETG----KAGSIEKVSVRGLGSDSLIYDN-KTLSKLALPLRSDALESVFIIEIEQSSTVFRDSLRLSHTNNDWFISMECGCIVLHTLFDARPGGGFIDSVRIVNPEIKNAVTEHVKIY... 165
172 8.000e-26UniRef50_A0A1J5HWM7 Uncharacterized protein n=1 Tax=Porphyromonadaceae bacterium CG2_30_38_12 TaxID=1805325 RepID=A0A1J5HWM7_9PORP  ali  26  1MKFLVRIILFL------TLFLVGCTSTEECRENLTVALKIGVYSKTSVEASTLLTNVDSVWVNGLKKDSFLYNNVKSVSSLSLPLDISRTQSDFIVRFGNQ----TDTISIFYNNDDYFISLACGCIVKHNLEEVVTTKHYIDSIHIINREIVNVDAEHIQLFHN. 160
173 8.000e-26UniRef50_A0A1I5JYJ4 Uncharacterized protein n=5 Tax=Prevotellaceae TaxID=171552 RepID=A0A1I5JYJ4_9BACT  ali  28  1MRKIVIFILTILII-------GACTSID-CPVQNKVGTVYGLKKANGTTDTLKVDTLDITSKRADGTDTILLNKATGITAYDMYISYTQPEDVFYYTLRDTGHIYQDTVYVKKENYPHFESVDCQAAYFHKLTDVRTTHHIIDSIVIKHSTVNYENHEHFYIYFK. 159
174 9.000e-26UniRef50_A0A2E5JBA3 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E5JBA3_9FLAO  ali  15  6............IFLFVVVLLFSCEKDDICLEGTTARLVVLFKDQQDP---MAKKAVDQLLIRGFEKKDTL--SIFSGDSLAIPLRNNFEFTQYEFTLHTASPSLSDSIQFNHTQYDTYINRSCGYKSTFVLENPFHNNGWIKSIEKIRDTLSDEKSSHLAIYY.. 161
175 1.000e-25UniRef50_A0A1M5AUX5 Uncharacterized protein n=2 Tax=Bacteroides luti TaxID=1297750 RepID=A0A1M5AUX5_9BACE  ali  34  1MRHLLKLLFFTVFTCCAVSFFMACGEA---SESSVGRLSPLFKFVTKSTKEKSFDSLTVVALNTVRGDSIIIDNQKTVTSANLPLSYVDTITALVFKYSKDT---IDTVWVTHTNTEHFISMDRGVAMFYHINKVEHTKHLIDSIAIVNSEVNINEKENIRIYY.. 159
176 1.000e-25UniRef50_A0A1L3J2L4 Uncharacterized protein n=1 Tax=Gramella salexigens TaxID=1913577 RepID=A0A1L3J2L4_9FLAO  ali  14  1.....................................MVIRFYENQDPFEPKAPQNL---SVRSLENDTTYFYYRFSQDSIAIPLKTDNDVTDFVFTLNTETTGNSDTLSFSYGREEEYINRACAFKINYVALKTSIEETWIKDIRIEQANIENENQAHVSIFF.. 139
177 1.000e-25UniRef50_A0A0P7AIE0 Uncharacterized protein n=2 Tax=Croceitalea TaxID=574891 RepID=A0A0P7AIE0_9FLAO  ali  16  1....................MASCEKDDICVEGDTPLLVVGFFD-DNAEDDNTAKNVENLGIIEIQGN-LLLNTISSVDSIAFPLRSDTTRTSFQLIRNANEEDGNTTITFTYVVNRSFVSRACGFVANYNQLDTLSDTDWIKRIDVVTSDIENSNMIHVKIFH.. 154
178 2.000e-25UniRef50_A0A2W5SUI9 Uncharacterized protein n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5SUI9_FLAPS  ali  16  1...............MISVYLLSCEKDDICSEDTTPGLVVQFHNKEIPTDTLVVSNFRYYVLGS--NEVLPANPSAGVYKITLPLRTDQDEVTWALQYNSTSPTNTDYLTIKYTRKNTYVSRACGYKTTFVLNPATSGNPFIDNPEVVTPYIENENEVHVKIYF.. 167
179 2.000e-25UniRef50_A0A1H1UMA6 Uncharacterized protein n=2 Tax=Gillisia TaxID=244698 RepID=A0A1H1UMA6_9FLAO  ali  14  13.........VLFGSLAILLLTISCQKDDICSASTTPLIKVNFYDIEN--DANAAKSVINLSVRAINVETDTLIKRNTTSAIEIPLNTNSSTTEYLFTISEQNPPNSDLVRFNYTRNEQYLSRACGYRILYEDVQVDTSENWIKDFTVNDSIIDNETITYISIYH.. 185
180 2.000e-25UniRef50_A0A1Y0MSQ2 Uncharacterized protein n=1 Tax=Gilvibacter sp. SZ-19 TaxID=754429 RepID=A0A1Y0MSQ2_9FLAO  ali  16  1.....................MGCTRDDICPEDTTPLLIITFKDFANRT---LSKTVPNLEVRDAENSEIVLFSVSSTDSIAIPLRNFDTRTELLFVRTDTDESNADRFNLLYTTEDIYLNRACGFITNYNDLSNEEGSNWLFSFEVLQTTISDDNAAHLTLFH.. 150
181 2.000e-25UniRef50_A0A1J4TEK2 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A1J4TEK2_9FLAO  ali  16  4..........ISLVILLFLSFCGCEKDDICIDPITPDFIIRFRDILDASKTKATSNLQ---IKNIDIDSIYRENIDTTDSITIPLNVNQTSSTYVLSINSTDTINSDTLTINYSLETVFVGRACGFKTVFNTVVISLTDNWIKSIIPSNSNVTTQTEAHVEILH.. 161
182 3.000e-25UniRef50_H8KW64 Uncharacterized protein n=2 Tax=Solitalea TaxID=929509 RepID=H8KW64_SOLCM  ali  21  2......KLIGTLLIVVTVFGVIACNTDKICSDTNSPGVVVEFYRDTLNKKTGELDTFDTLVVKGIGTDSLVVDSLRSVQRIVLPLNNNAQTSTFTFVINKLNEITKDTLKIDYEGRRAFVSQECGFKFDFTIKNATATQNRFKNSVTQQTDITNEASTALYIYFK. 172
183 3.000e-25UniRef50_A0A1I4Y6M0 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1I4Y6M0_9FLAO  ali  17  1MRKIWF-------VGLLALGLSACEKDDICSESETPNVIIGLFDRLDPEIRKS--AVKIAAIAEGFNDTLIFR---STSTIELPLQINTTETTWNLVLYQPTGSNNDTIRFTYTPEALYVSKACGYKTIFHEFNAVKTTTWIRSMNRLTNELTNTDNAHLQFYY.. 165
184 3.000e-25UniRef50_UPI00082F47A9 hypothetical protein n=1 Tax=Porphyromonadaceae bacterium H1 TaxID=1658779 RepID=UPI00082F47A9  ali  25  3...MLKKICVLLLIFAGMGCFSACDEDQNCRKERFVAVSADIKKVLTGKRSVSPFQVERLTLSGLNNDSILYNNAA-VSSLSLYLKNFSEETQYRIVLNDT----IDTLTIRHRNTDSYLSFQCGCIMTHLIDTAFITGHFIDSVAVVNKQVNTQNAKNIELY... 160
185 4.000e-25UniRef50_A0A1V5YT34 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin174 TaxID=1852808 RepID=A0A1V5YT34_9BACT  ali  20  6...........IIFMLSIALFSACKQDETCRESKEVFLRVGFFSVSNKAVIIDSLTVFALDQDGSAMDSLLYDNQKDVSNIKLPLNKEEQASLFVMQLNDLP---QDTLFILYQNIDYFISYPCGMIITHTLDTVRSTHHLIKDINMIHKNINTTDVQHLQV.... 154
186 4.000e-25UniRef50_L1MC80 Uncharacterized protein n=3 Tax=Prevotellaceae TaxID=171552 RepID=L1MC80_9BACT  ali  21  22MERTIRHSLLAITIVSTMIGVVSCTNID-CPLDNQVEMVLNFYHFETKKEVALTDTLSVYGIK-NDTTQLLFNRAIGQRTIRVPLNVASDRDTLLLRFTSRTETTADTLFVHHIRKSHFESLDCPASVFHTLTNVEWRAHQVQEVVITNHNVAYENVEHLKVFLR. 191
187 5.000e-25UniRef50_A0A1Z5SEG0 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium IBVUCB1 TaxID=1985173 RepID=A0A1Z5SEG0_9BACT  ali  18  1MTKGSTYIPFIILFWVVAMQ-VACQRIDPCLQPKSVYVKIGTFQPADTGSLGKDSLLPNPILGYTATNQAIYLGSKNVKEFYMQLSPMQDSVKWFITPDSTAAG-LDTITLFYSRNLVFLSKSCGYSYNYVINDVRYTFNRIDSLKINNGNIDKADVQHVKIFY.. 164
188 5.000e-25UniRef50_A0A0E9LVM6 Uncharacterized protein n=4 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A0E9LVM6_9BACT  ali  21  1MK--CFKIFLYIVVALLWLLPASCTQDQICLSNQHA-VQTGFYS--GRSSVDKDTMLQNSSVFGVHPQRDSIYATETFQTMFLPLSFDQDTTIFVI----DNNSLRDTLWFSHSKEMAYISRECGFTFNFTIDSVWFTRVFVDSVAIDVKEVNYENFENVKIYIY. 157
189 6.000e-25UniRef50_F8N629 Putative lipoprotein n=14 Tax=Prevotella TaxID=838 RepID=F8N629_9BACT  ali  33  16......................ACSTVD-CPLNNTVYT----YYVLRGPVRTLPDTLTISTRTGNGADSVLINKQVNTDSFSLPVSYTRNEDVLVFQTNH----LLDTISIEKTNIPHFESVDCGVNYFHTITGVKFTRHAIDSVVIHHNSVNYDSQKHFYIYFK. 150
190 6.000e-25UniRef50_A0A2S4N8I2 Uncharacterized protein n=1 Tax=Flavobacterium croceum DSM 17960 TaxID=1121886 RepID=A0A2S4N8I2_9FLAO  ali  14  4..........ITLILGLFLVFISCEKDDICDESTTPLLVVEFFQYGVPLDQ--AKNVTNLKIKASTATDFYVFNSTNTNKIQIPLQVDANFTHYTFTLNSTDTTSTDDIQFNYITQDLFVSRACGYKSVFNLNTITTSNNWIESAVVNQYFIENQKVTHVKIYF.. 171
191 7.000e-25UniRef50_C0BGU8 Uncharacterized protein n=1 Tax=Flavobacteria bacterium (strain MS024-2A) TaxID=487796 RepID=C0BGU8_FLABM  ali  19  21.......................CEKDDICIQDVTPDLILLMLDSNDENIRKSPPGFN---IRAIGTENVLLQSRG--DSIPLPLNTQEKVTQFEFILNGSENENIDTLQINYDRIDQFINRACGYRANFIITLLNPGNDWIKGFVILKDTITDEKAAHLGILY.. 164
192 8.000e-25UniRef50_A0A1V5JLM4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA012 TaxID=1852815 RepID=A0A1V5JLM4_9BACT  ali  26  1MKRLSVISFIAIMATLVMF-LPSCS-VQPCYEETNPLLKTVLLASGTGEAAKA-DSLRVYTYR--ETDTLRFINLKGASAFSVPLDPASDESEFLITLN----GITDTAVIRYSRKPHLVSPECGYTIISELTGLKTTHNIIDTLIIENKSVNLDGQKNLHLFY.. 155
193 8.000e-25UniRef50_L1N236 Uncharacterized protein n=23 Tax=Prevotellaceae TaxID=171552 RepID=L1N236_9BACT  ali  27  1MRK------VIFGLLAMLLMATACSSID-CPINNRAYTKYRL----QGNVKTLTDTLTVLTKRQDGQDTILLNKSVGKDSFELPMSYIRTVDELYFSLNKLNQTTRDTVRITKTNYPHFESVDCPLAYFHTITGVSTTLHNIDSIVVNSSNVTYDSQPHFYIYFKS 157
194 1.000e-24UniRef50_A0A1B2YXD9 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1B2YXD9_9BACT  ali  16  16......................GCEPDDICIEGSTSELIIIFHDINNPDDRKEIQNLNV--VGSINQNDFESLFFTASDSITLPLRKFSSSTNYRFILNNDNNMIIDELTIFYTPKDIFINRACGFKTIFEELNVSNSNNWIKNIVILNNTLSSNNNANIRILH.. 157
195 1.000e-24UniRef50_UPI00068A0E55 hypothetical protein n=1 Tax=Sediminibacter sp. Hel_I_10 TaxID=1392490 RepID=UPI00068A0E55  ali  15  4..KKIHSYFILIAVFVAFLITGSCERDDICDTSTTPRLFIEFRDINNQDELKPVRRLRVIGIDEAGVPDTLSIEETDPSSVLLPLRVLETTTRYILEKNSDTNSEQVIIEIRCTGNFVYVSRACGYKSVFDNGSFIITNNWALNSEIVNDFIENEDEAQVYIYH.. 186
196 1.000e-24UniRef50_A0A2H1EAM9 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2H1EAM9_9FLAO  ali  18  13.................TFFIVSCEKDDFCTKNVTPNLILRFYDAENPTALKKVDSLY---VWAKEKDSIIINQ--NTDSIAIPLNTLSNNTIYNL---SKGTLLSNQFTITYNTEEEFVSRSCGFRVIFNNVAITTTNTWIQSFTPETTTINHQSAAHVKVYH.. 156
197 1.000e-24UniRef50_A0A0P0U6T0 Uncharacterized protein n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A0P0U6T0_FLAPS  ali  17  1MKRLIASIALLLIITSYLL---SCEKDDLCAEPTTPGLVVEFYQYDNTPVLSPVTNLSYQVVGSEK-----VIDSISGSKFVFPLKADAESVKYSITYNGTVTTNTDIFEVKYSRTETFVSRACGYKTTFTLLPSTPENPWIRRVEEITNNIDNEDEVHIKFY... 176
198 2.000e-24UniRef50_A0A1K1SDC2 Uncharacterized protein n=5 Tax=Chitinophaga TaxID=79328 RepID=A0A1K1SDC2_9BACT  ali  18  1MKYFSGIIALLLLVV-----FAACEDETTCDQTLLANLGINFKKDSLNGFINKDTIWPKVSLCALGKDTLI--RREARSSIYFALDPQHDTCRFFLKLDSAA--VADTLTFRYTRTPHFISPGCGFTTFSTLDTVICTYHTINALHINNREVTSGNIQNITLYF.. 156
199 2.000e-24UniRef50_A0A1G6CHY3 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium MAR_2010_188 TaxID=1250295 RepID=A0A1G6CHY3_9FLAO  ali  17  14.KFPLKRLVALMSACFLVIVTTNCERDDICPTSTTPNVLFQFFDINNQT---ASKVVNGLSVRAIGVDDYVLFN-SDVSTASVPLNVTKDSEFFADDQNDETNPNTDIIKLTYTPEFVYVSRACGYKAIYNDVQLTIENNWIFNYDILINNIENEDEPHITLYH.. 190
200 2.000e-24UniRef50_A0A1V6H652 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin057 TaxID=1852802 RepID=A0A1V6H652_9BACT  ali  25  6........LYSIIALCIAVMLGACSNNDGCHKDLTVRMGVALYQMANTGNFVKQPYSTKLTVYGVDNDSILY-KEKEMNSFEVPLHKTESISQFVLKTDQA----TDTLTIFHTNTQDFVSLECGCKVIHSINTAATTIHAIDSVGVRAPNITKTGETNLYVYYH. 161
201 2.000e-24UniRef50_A0A2D5DB50 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2D5DB50_9RHIZ  ali  14  9.............LILILFFLVACEPDDICLESNTPNLILKFVDSFSGET----KSVDNLRIKGINNNEDFFLG--TIDSVSIPLNNYENTSSFSFTKEDSNQSNEDLIYFNYSRNNVYISRSCGYKMEYKIDNIIIENNWIEDSVIEIRNVNDEISHHVKIYH.. 159
202 2.000e-24UniRef50_A0A1M5BZ22 Uncharacterized protein n=1 Tax=Flavobacterium fontis TaxID=1124188 RepID=A0A1M5BZ22_9FLAO  ali  18  5..........VFLFLPLLMVFSGCEKDDICSDSTTPRLVIEFYDVTNLTQT---KNVSNLVLKTNGVSETILFNA--VSKIYVPFDTTTDTVQFQLIQNDTTNDNIDNITMNYTRTTQYVSRACGYKLNFVLDATPNDGLWIQTMGISETTITNENEVHVKLYY.. 168
203 3.000e-24UniRef50_D5B994 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=D5B994_ZUNPS  ali  15  4.KKIMKFIIQFILGFLSLLIFAGCQRDDICPEDTTPMLVINFYANNAQNEPRTSVNLTVREVGRDTLDMLLY--RVNSQSIRIPLKTGQNSTKYEFIYNNNLETNTDIIEFTYDPEEEYINRACSFKVNYLNIDYIIDGRWISRMRFLTNNITTDNTAHLNIFF.. 206
204 3.000e-24UniRef50_A4C0T7 Uncharacterized protein n=16 Tax=Flavobacteriales TaxID=200644 RepID=A4C0T7_9FLAO  ali  16  1MKKE------ALILLFGCFVFAGCEKDDFCVKNVTSKLIIDFYDDTNRETLKK---VERFSIIGAGKTDSLFTNQ-SLNSISIPLNSLTSETVYTFKKNTTNGASENVFSILYDTEEAYVSRSCGFKVIFKNVAFSDTNSWITAFTPTTTNLDDQSTAHVQIFH.. 161
205 3.000e-24UniRef50_H1H7M5 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=H1H7M5_9FLAO  ali  18  1MKKL---ILAAVFLSLGSFIFSACEKDDICDEPTTPNFLIEFYNFEDQGIAKND--LVEAFVAGREKDVI----KSKANKLLIPLRLDNQESEWILKTQNQTDTLYDTLTFKYKINTKYLNKACGYVSTFSLNSQQTSGNWIKYYTTETNEIQDSKQAHFKIYY.. 172
206 3.000e-24UniRef50_C7M5G4 Uncharacterized protein n=25 Tax=Capnocytophaga TaxID=1016 RepID=C7M5G4_CAPOD  ali  17  1MKRTIFISFLIL----SLSMLISCESDDLCDHSNTPRLVVRFYNQNN---TRTPFSVTNLTVYGEGNTTPLV-SSATLDSLALPLRLESPTTYLFQTVVSGTTTSTATLTLTYTPEQSFVSKACGVKITYNTLSATTNTSWLKGLNIKNTTVDNEKRAHIHLYH.. 160
207 3.000e-24UniRef50_A0A2K8XMP0 Uncharacterized protein n=6 Tax=Polaribacter TaxID=52959 RepID=A0A2K8XMP0_9FLAO  ali  17  1MKKIILFL------LLFLVLFSACEKDDFCVQNVTSKLIIDFYDATNRET---PKKVQLLSVWSGTKDTISQYTSVSENSISIPLNSLTSETVYSFKKNTSGGATITTFTIKYDTEEEFVSRSCGYKVVFNNVAFSASTSWIKDFTPTTINLDNQTTAHVQIFH.. 164
208 4.000e-24UniRef50_A0A1M3DKW1 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 36-12 TaxID=1895718 RepID=A0A1M3DKW1_9BACT  ali  24  1MKYTIAFLFFISVL------YSSCTQDTTCRENKDVKLHADFINQSNNSKL----TVDSVTVFGVGQDSLIYNNKKSVDKILIPLNNAAEDCSFVIIFD----EIADTINVKYTNIEYFMSYSCGVIMAHEIDTVTFTDNYIKEIIIQNRIINPTDVKHIQILH.. 150
209 4.000e-24UniRef50_A0A2E6M846 Uncharacterized protein n=7 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E6M846_9FLAO  ali  16  6.KKEFKSFMKRILFLVLILILPACEPDDICSESTTSPLVIAFFNIESISDAKTVPGLFAIGLDTEGNEVIVDGEIVSRDKITLPLDVSQSQTQFKLYIDGVIQGNPDTIIITYTTESVYVSRACGFKNVFTIQSFEIQDPWMIVSSISINEVVNQNETNVEILH.. 179
210 4.000e-24UniRef50_A0A1Y4A9L3 Uncharacterized protein n=7 Tax=Bacteroides TaxID=816 RepID=A0A1Y4A9L3_9BACE  ali  28  16..................VLIPSCE-VENCPPNALSYLHFSLVDQNGRTFQTSDTITIVGQTLANDSSDTLINQETAANSFTLPLSYDA-YTQFIFVYHALNAGYRDTIRIDHRNIPYFTNLDCGTMMFYEITNVGHTHHRLDSIAITNPNIDNNEKENIRIYF.. 163
211 5.000e-24UniRef50_A0A1H3WUD1 Uncharacterized protein n=1 Tax=Prevotella sp. tc2-28 TaxID=1761888 RepID=A0A1H3WUD1_9BACT  ali  22  1.............MLSLLAILAACSSID-CPLNHRVYTKYGLYQPDGKPDTLDNDTLWIWARRGNRVDTLVLNNGSTATSFELPISYMQPEDTFFVLLDETRHYYPDSIYVRKESFQHFESIDCQASYFHHVTSVRCMGNIIDSIVIINSDINYDKKEHFRIY... 153
212 5.000e-24UniRef50_A0A2G5L463 Uncharacterized protein n=1 Tax=Reichenbachiella sp. 5M10 TaxID=1889772 RepID=A0A2G5L463_9BACT  ali  25  1MKKMKWLVVWMFL---CSAVMSSCKDDPDCSLEQ-PYFVIGFYD----ERSLELDTLRFDFVSAEGSDTILYNSEDTLSYFSFKLNPAADSVTYYFL----TGVSVDTLQLTYDRDLEWLSERCGPFFNYAKLKVAF--HTFDSVSVEQSAIDITVDENIKIY... 151
213 5.000e-24UniRef50_A0A1M3MF69 Uncharacterized protein n=1 Tax=Paludibacter sp. 47-17 TaxID=1895899 RepID=A0A1M3MF69_9BACT  ali  23  2......KLSTFVYLIATCTLLTACQEEETCRESTEVNLRIGLYKAG----ATAVSTVDSVTVRDIDTDSTFYANRKTISRIELPLDRQTNIARLAVRLNED----WDTLTVIYNSEAFFISYACGMVFTHQIDTVLTTRHAVDSLKIPVKLINTANEQHIQLY... 151
214 6.000e-24UniRef50_A0A1M6WZ18 Uncharacterized protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1M6WZ18_9BACT  ali  25  1....MKTIYQLLIAGLFLIGMAACENETVCDQTLRADAHVEFRRDSAG--FVWDSTFRAVTTLALDKDTLL--NNVRTNNVYFNLDPVNDTCRFMLRIDS--LVGKDTLTFRYKRTPMFISPGCGFGTTFMLDTVIATRHLIDSVIITQKSVVNSNDTHLQLFFY. 156
215 6.000e-24UniRef50_A0A1B1Y4C9 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1B1Y4C9_9FLAO  ali  21  1MKKILP---FLFLAILTAALTSSCQ-DEFCLDPTTPNLIIRFYDKDVVTEKKSIE----LKVWVENKDTI--YNGVSTDSIYLPIDTKNSSVVYHIKSDDITED----ITLSYTVEDKFVSKACGFKSIFNITVNTTNNGWLNSFTTTTSDITNQNQAHVKIFH.. 151
216 6.000e-24UniRef50_UPI0004816DD5 hypothetical protein n=2 Tax=Prevotella brevis TaxID=83231 RepID=UPI0004816DD5  ali  23  4..........VALWMMAAVGLVACSSID-CPIQTTVEVNYVLND-------TLKDTLTVLTKRADRQDTILLNRGVGLTKFALPMSSGQPVDTLVFQINKQKAMTIDTVWIKKDDIPHFESVDCATHFFHHITQVSATHVAIDTLFILNPSVTYDISAHIEIHFKN 153
217 6.000e-24UniRef50_A0A1M4UNE7 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1M4UNE7_9FLAO  ali  20  5.........WILLMFAVLLISLSCERDDICSTPTTPALTIGFLSNENINE---NKPMNITVYKPDYSDSLVF---SNASSIQVPLRTDTTATVLVFTKNTEDPDNSDTLTFIYTTQEEFISSACGYRVIFTNLSILSDGRWIDDINFTTRTISDEDTTQVSISH.. 165
218 6.000e-24UniRef50_A0A1I1MC38 Uncharacterized protein n=1 Tax=Zunongwangia mangrovi TaxID=1334022 RepID=A0A1I1MC38_9FLAO  ali  15  2..KFTNYKSHLILSIFILVIFAGCQRDDICPEDTTPMLVINFFDATTREPRTSV----NLTVREAGRDPLLVLYRENSQSIQLPLRTGENSTQYEFVYNDNLETNTDIIEFNYDPEEEYINRACSFKVNYLNIDYITDDRWITRMEFLVDDVVSDNTAHLNIYFE. 194
219 8.000e-24UniRef50_A0A1B2YVE4 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1B2YVE4_9BACT  ali  24  15.....................SSCEPDDVCSEANTPQLVFRLYDSSQPNEFKAVDTLRVMGLNGEATLEFI-----NTDSIAFPLQVNASKINADLTI---SNGVTDRIEIDYLSKDVYLSRACGFQTTFQIHTIEVDQNWVNSIEIVTNEVIIDTLAHVKIYH.. 153
220 8.000e-24UniRef50_A0A2D4YEG5 Uncharacterized protein n=9 Tax=Flavobacteriales TaxID=200644 RepID=A0A2D4YEG5_9FLAO  ali  15  13..................VALISCERDDICAEPTTPRLMVEFYDATETEELKPVTRLTAYGEGTNDNTEGTLVYNTNATAIELPLLIGNTTSRFILEKDTDTDSNIDIIEISYETEFVYVSRACGYKSIFKNLQVSFETSWISGIEVVDTIVENENTVHVRILH.. 183
221 9.000e-24UniRef50_R7CXS4 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=R7CXS4_9BACE  ali  26  1MKGMKASALHGLTFGLLLLLAGAC-NDTDCTVSNTAYVNYGLYNGNG----VAVAFTEPVTVTTTGVDSVLINQESNMQLMQLPLSYTNTEDTFIVHL---SETLFDTIYVTHQNIPHFISMECGTGMYHHIDAVRCAHRIFDSITIVNPDVTYDTNEHIKVYLPN 158
222 1.000e-23UniRef50_B5D229 Uncharacterized protein n=7 Tax=Bacteroides TaxID=816 RepID=B5D229_BACPM  ali  26  1MKKLP--IVLGILLVAVVSFFPACE-VENCPPNALAYAQFAFVDQYGRSVQYTDTLTVIGQLETADTTDTLINKSTNTSTLSLPLSYGE-QTRFILQY---ANRQRDILTITHRNIPYFINLDCGTMMFYEVTNAETTTRMLDSLVITNPNIDNYEKENFKIYF.. 159
223 1.000e-23UniRef50_A0A238UB01 Uncharacterized protein n=20 Tax=Bacteria TaxID=2 RepID=A0A238UB01_9FLAO  ali  13  1....MRFLKYAIILFVATICFLSCEKDDFCTQNVTPNLVLRFYNNKSLTEFKAVERFT------MSTGGVTLFSNISTDSIAIPLNTIAEETVFTLIRNDNTGDESATLTVKYIPENEYVSRSCGFRVIFNDVTFE-TSGWIERLSTTQESIKNQTNAHVNIFH.. 160
224 2.000e-23UniRef50_R5Y931 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=R5Y931_9BACE  ali  19  18....MRAFGVLFTCMLPMLFSVACNTE-ACLESKTSIFSAAFYAYGDSAAKVVIDSVSVYGV-GQFKDSLLVDT-ANISSFRATLRSDRDTTQYVIQYNLNPRYKRDTLTFVYHTYIEFESAECGAMYNYVIDDFRYTTWQIVDAELMTSEVDNQDVENVRLYYY. 178
225 2.000e-23UniRef50_A0A1H5KAZ4 Uncharacterized protein n=4 Tax=Tenacibaculum TaxID=104267 RepID=A0A1H5KAZ4_9FLAO  ali  17  1..................MGLSSCEKDDFCTQNVTPSLILRFHDKDD---VTKKKSVERFSIIAVGKTDSLFVDR-NTDSIAIPLNGLDTKTVYTLKMNDVDNIKTNTLTINYTTEEEYISRSCGYRFIFKDITLTSSTSWINSLSTKDSIINNQIKAHVQVFH.. 149
226 2.000e-23UniRef50_A0A2E8R883 Uncharacterized protein n=4 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E8R883_9FLAO  ali  17  1......MFKRISFYSLLIIFIFNCEKDDICLEGTTPRLIIRFFDQN---EKIIPKPLSNVTIKALSKDEDYVVF--SGDSLGIPLKLISNSTIYTFTYLDDNQEKIDTLKFNYKREDYYVNRACGFLSNLIFTTILDXESIFLGFKILNDTIKNENQAHLAIYH.. 161
227 2.000e-23UniRef50_A0A2D7RI77 Uncharacterized protein n=5 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7RI77_9FLAO  ali  18  7............IYIALIITLFSCEPDDICLEDDTPKLIIRFYD----EITNELKPLRNLEIISTETQDTLFFNE--VDSIPIPLNHKENFTSLSIKINSYGNSNIDNILIDYSRKPIYISVGCGFVLNFNINSFKDQNNWIKNYNIYKSIIENEETRHVEVFH.. 158
228 2.000e-23UniRef50_A0A1M6BAI4 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6BAI4_9FLAO  ali  14  1......MFKRIILLLLLVLALKGCTRDDICAEGTTPKLIIIFNNNLNPNNRKAVDSL---SIETDYENSVLVLAKTITDSIAIPLSTTSDTTKYRFIRTRNPEINIDNVMFIYSRQDLYVNRACGFKSQFNSLEAEDSENWIQNITTNTDTIIDEEKAHLTFFH.. 165
229 3.000e-23UniRef50_A0A2E6LJ81 Uncharacterized protein n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6LJ81_9FLAO  ali  14  1..MIKKKFHLIIFSLIFFLFYNSCEKDDICLADTSPKLIIKMVNKDDPASY---KSVNDFLIKVIDNDSI---NIQSSDSTGLNLNPYKNFTQFEFILNGSENENIDTLQINYDLNNIYIDRACGFKTSFIFDSNALTNNWIEGYLILKDTIINEEQAHLAILH.. 164
230 3.000e-23UniRef50_A0A0D7W1V5 Uncharacterized protein n=2 Tax=Tamlana TaxID=393005 RepID=A0A0D7W1V5_9FLAO  ali  20  1MRKTVILLLFLVISSI------SCEKDDICADATTPRLIIDLYNAESPEN---KKNANDLIVSGIDNDFALSGYFVNVNQLVLPLRTDTNITQYELMLDDYYEGNIDTITVNYVPVEVYVSRACGYKTIYTEVTLTDDDNWLLSRQPLTDNVENEDETHFNITH.. 177
231 3.000e-23UniRef50_A0A238VG69 Uncharacterized protein n=1 Tax=Lutibacter agarilyticus TaxID=1109740 RepID=A0A238VG69_9FLAO  ali  20  1MRKLFFLIVITLVAI------SGCEKDDICIEGTTPFLVIRFNDSDDQSEYKSI-LLDSVRVIENE----LYAANTTLDSLYIPLDTNENFTTYEIAAN----GLVDEMKISYTRTAIFVGRACGYKINFEDFELESTTNWIKGIDINNNIIDNDTIAAITIFH.. 150
232 3.000e-23UniRef50_A0A1V5MYS0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin416 TaxID=1852814 RepID=A0A1V5MYS0_9BACT  ali  23  5.........LAWGLLMTTAILTSCQSNG-CYEETDVKVRCSFY----WDDEAAAVSIDSLSVWGVGSDSLLYDN-STVSLLELELNPNATSTRFVVQVVANDYPFLDTLTFLHTNNPWFESMDCDCMVFSTLDTCLTTGRIFQSASLPQRSVTNAKTTHVVLH... 152
233 5.000e-23UniRef50_A0A1F3PAA1 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3PAA1_9BACT  ali  23  1MKRF-PSLLPLLLITAFTAFAISCSPE-ACFEETNSFLKASFYSNSTKKQL-APDSITLTGVNQPAN--KIYDKAKGVQPALFPLNASAGSCTFRIRIN----GVTDTIQFRYTSFPHLISKECGYTFYHSLDTFFYSMNAIDYIYRSSNSITTANEENIRIFY.. 155
234 5.000e-23UniRef50_A0A2W2BJV7 Uncharacterized protein n=1 Tax=Taibaiella soli TaxID=1649169 RepID=A0A2W2BJV7_9BACT  ali  19  1.............MLLLTLGLVACETQDPCLTPTTVYVRAGAYRFADTGTAVLDTFLLNPILGPADSPQKGYSAGQNVNKFYITLNPTVDSCSWYFVPDSAYLDRRDTITFYYYRQLKFISNACGYTYYYSINNVKSTRHAIDSVVLSSGTINNANIENLKIYIH. 163
235 5.000e-23UniRef50_A0A1V6B8G5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin145 TaxID=1852807 RepID=A0A1V6B8G5_9BACT  ali  19  1MRKSFLKIISAFLVIIPVFIF-SCTP-GSCYDETEARVKASMY----QSATEKIVAPDSVSLFGLERDSAIYKKTSNITSMLFPLDPTTETCTFLVKINGES----DTVTFSYSSYAHFISKECGYTYYFTIEQPVTTNNIIDKIVLTKKTIKTLNEENMRIYY.. 154
236 5.000e-23UniRef50_E0NRU8 Uncharacterized protein n=2 Tax=Prevotella marshii TaxID=189722 RepID=E0NRU8_9BACT  ali  25  4......................................VYGFYNTS-GVRASLKDTLTVSTTKVSGVDSVLINKDIKVDSIRVPMSYAQQEDALYFLFKDTGTEVTDTLRIKKTNQAHFVSPDCNPAYFHEIIGITHTRHKIDSIVVNRRNVTYDSKEHLKVYLHS 132
237 5.000e-23UniRef50_R6WQF9 Uncharacterized protein n=5 Tax=Prevotellaceae TaxID=171552 RepID=R6WQF9_9BACT  ali  21  3...FSPFRLSLPAIIAVAAVAASCSSVD-CPLNNKVLTNYALLDADGRTDTMRL-AMTVSTNRTDGSDSVLINKDQDITKFSLPISNAQPRDSFFVELTDGVTASLDTIVVDKEDMMHFESTDCAASYFHKIKGVTTTHHAIDSVAINYHNVDYDTKTHFHIYF.. 162
238 6.000e-23UniRef50_R5CIE1 Uncharacterized protein n=5 Tax=Prevotella TaxID=838 RepID=R5CIE1_9BACT  ali  25  53.....................ASCTTVD-CPLNSLVYTQYKLMTPEGKADTLA-DTLTISTNRTDGSDSILINKNVKTTEFSLPISYSHPQDVFYFETKDTLTGTFDTITVTKEDRPHFESVDCSPLYFHTITAINTTNNAIDSVVIINPDVSYDTKKHIYIYFKH 198
239 1.000e-22UniRef50_UPI000248EA16 hypothetical protein n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248EA16  ali  15  28........................ERDDICDTENTPRLIITFQDFENTEIRKRA---SGLEISLTSDSERIVPEITTFDSIAIPLNINEDTVSYQFKINDESIVRENTIEFSYKRTNEYVSKACGFRTTYDELTFTTTKNWIRNILIENNTVNEETDAHVRIFH.. 177
240 2.000e-22UniRef50_UPI00068ADB97 hypothetical protein n=1 Tax=Leeuwenhoekiella sp. MAR_2009_132 TaxID=1392489 RepID=UPI00068ADB97  ali  15  5.........YILGSLCFLLALSACERDDICSTPTTPLLAIAFFDETNRTLSKDI----NLRVQAVGSNKFIEITGDTI--IRIPLRTDTTSTSFIFTKNEEDPNNADRVTFNYNLNEVYIDRACGFKVTYAALTSQYSSPWITDISINNSTIVNDSIYQVSIIH.. 165
241 2.000e-22UniRef50_A0A1B2YSG3 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1B2YSG3_9BACT  ali  18  5...........LHLLVLTLFFLSCEKDDICIEENTNRVTIGFID----NESKNPTGVNLTFIKGIDNDSIISESFSG-SELKLPLMVNSNETKYILEQNKV----IDTLKIFHQTNHLYLNRSCGFKSNFSNTEILKKSGWIREISIVQDSIYNEEKTNIFIHY.. 153
242 2.000e-22UniRef50_A0A2S7KNS2 Uncharacterized protein n=1 Tax=Aureitalea marina TaxID=930804 RepID=A0A2S7KNS2_9FLAO  ali  12  20.....................AGCTRDDICTQDTTPLLVIVFRDIASPNQSKSVPNLLITS----ASDQSTVVFTGTTDSIAIPLNVNLDVTALDFTTNSNSEENTDLVNINYVRDDIYVNRACAFKTFYDSLGFERVDDWILTANVNLTRVENENEAHITIFH.. 166
243 2.000e-22UniRef50_A0A1Q6EFE1 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 52_46 TaxID=1897040 RepID=A0A1Q6EFE1_9BACT  ali  28  35.............................CTDNRSSIPLAGFYD-ERTGAAIAIDSIDIGGIGAPG-DSLLLASPQQATEVYLPLRSERDKASFFIAYRQDYPELNDTITFGYSSIPYFASEECGAMMRYRLRSVTYTRHLLDSVSVVDSVITNADIENLRLYFK. 173
244 2.000e-22UniRef50_A0A2E0C7S8 Uncharacterized protein n=7 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E0C7S8_9FLAO  ali  13  1......MYKIKSIFLTILIFLFACEPDDICLSDDTPKLLIGFYDKNSGN----LKEVENLKIQGLDNDQIYIF--ETIDSIGIPLINNKNLTTFNLTKNNVDSGNNDKMFVNYNPNWIYISRACGYITNYDIDNLIIENNWIIDSEIITYSIKDEENIHVKIYH.. 161
245 3.000e-22UniRef50_R6XVW3 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=R6XVW3_9BACT  ali  28  15....................MVGCSTLD-CPLNNTVYTK---YKLDGTVTELTGCTMTVSTTKRDGEDSILINKDENVDSFILPMSYANSADTLYFEQDRLERVFKDTVIVAKDNQPHFESIDCSPSYFHTITGVKTTQHLIDSIVINHKDVNFDTKTHFLIYF.. 156
246 3.000e-22UniRef50_K1M5V1 Uncharacterized protein n=2 Tax=Bergeyella zoohelcum TaxID=1015 RepID=K1M5V1_9FLAO  ali  16  5...........WFLILLAFIMTSCGGDDICSSESTPRMKMKFKNEATGK-IRSLDSIFVYADYGQGMEMVVANRYK-TDSILIPLRIDNTFTQLEIALSSGGAKSG--VKIAYLPKDEYVSPACGMKKVYENVNTTLMNQSLKGVEVSKNEIYNEDTTHIFLLF.. 156
247 3.000e-22UniRef50_A0A2K9PVP8 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2K9PVP8_9FLAO  ali  19  15.................TIGYFSCERDDICPTPTTPRIIIKFLDANDEESTKIVSNLVVIGVDEVGNEHILVDNPTRIDSVFLPLRTDLDKTQYILISDDYISGNYDTITLDYSREEVFVSRACGYKTIFKNVILSLEDSWIQSRKTLTDNVEDETASHFALSH.. 200
248 4.000e-22UniRef50_R5AZW4 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=R5AZW4_9BACE  ali  26  25.......................CSTDG-CLNNQNSLPLAGFYSSATGS-AVSIDSVDIGGVGAPD-DSLLHHTGVTVSEIYLPFRSAKKVTSFYFQYNISSDEYNDTITFHYDSEPYFASEECGAMYRFRITDVVYTRHLIDSVGVTDSLITNIDFQRIKIFMR. 166
249 4.000e-22UniRef50_D8DTC3 Putative lipoprotein n=9 Tax=Prevotella TaxID=838 RepID=D8DTC3_PREBR  ali  24  1MRKIIPVLFVLLL------TMVACSSSIDYPLNNTVYTNYKL----AGYVDTLKDTLTIWTVDQNNQRDTVFQSKANVDSCLVAMSYTRDQDILIFEVKSDHQTYLDTVTISKTNQPHFETVDCPPAYFHTITKVDYTTNALDSIRINKKEVNYDATTHFYIYFKD 158
250 5.000e-22UniRef50_A0A2E4BDR2 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E4BDR2_9FLAO  ali  19  6............VLLIYFFILFSCEPDDLCLEPDTPKLIVKFFDSASQESIV----INNLKVEDIDRNLVLFTG--STDSISIPLNYTKQQTLLNFIFND----NNDKVYVNYNTNEVFVSKGCGYRMQYLLENIIVENNWINSVEIFNKNVVEESNHNVKIFF.. 152
251 6.000e-22UniRef50_A0A1B7XF04 Uncharacterized protein n=17 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1B7XF04_9FLAO  ali  13  26..........................DDICPEGTTPRLIIDFHDILNPDNKKNVFDLIAFGVGNDNVLSDYYF--TDTDEVFLPLKTDVNTTQYTLITDDYIEGNPDTITINYSREEVYVSRACGYKTIYKNVTLTIEDNWMLSRQPMNENVENEDETHFIISH.. 182
252 7.000e-22UniRef50_A0A1H0FD53 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A1H0FD53_9BACT  ali  23  3..........YFCLSAFLLFLAACSTID-CPVQNKVAVNYAVKTIVGGVEVTLKDTLYVWSTRSDGDDTLIFNSGIDISSFSLPVSYTHPEDKLVFCLVDTNKVKIDTVWIKKADTPHFESVDCSAHFFHTLTAVRSTHEAIDTIFINNPKVNYDPSDHIHIHFK. 160
253 8.000e-22UniRef50_A0A1E5UB65 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1E5UB65_9FLAO  ali  17  1MKKLIFPFLIL------GFLLTSCENDDDCVSEATPRLKIKFKSADNKVLTLDSLYLD---VDYGNNNILTVVRAAKVDSALIPIRVDAGFTELYVRKTKKGSVSK--IKLNYNTTSEYVSPACGFKRLYQNLSGTLTANPVTKVELNQNQIINENKTHLYLVF.. 157
254 8.000e-22UniRef50_D7JE76 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=D7JE76_9BACT  ali  22  13.........LIAAAICITFLFAACQAEGDCTQDTRTSVGTAFFQPGANQQYTAQTLTDTIRIKGVGSDS-FINDTLSISAARLPLKSFEKNTSFVIQKDNLK---ADTITFIHDNTEQLLSLECGVKVIHDIKDIRFTQNRIDSVKIAISRIADNKTANVKIYFK. 167
255 9.000e-22UniRef50_A0A1B1S8J4 Uncharacterized protein n=2 Tax=Muribaculaceae TaxID=2005473 RepID=A0A1B1S8J4_9BACT  ali  22  1...MKYKAIVIFAACSGISLLSGCNSSG-CTDNKSSIPLAGFYSY----TTLSPISVNKISLGGVDPDDSLIINNASASEVYLPFRAEHDETQFYIHYHSDDSAFNDTLTFRYNRLPYFASEECGAMYKYEVKEFSSTYHLIDSIALLDVNITNTDRETIRIFFR. 161
256 1.000e-21UniRef50_A0A1M5V5J3 Uncharacterized protein n=1 Tax=Wenyingzhuangia marina TaxID=1195760 RepID=A0A1M5V5J3_9FLAO  ali  22  9MKKLLSLLLLVTFSATIF----SCQ-DEFCLDATTPNLIIRFYDKDTITKTKSIK----LIVRANSKDT--LYNGINTDSLSIPLDTQNNNVTYHISILDNPNSQED-ININYTTEDVFVSKACGFKSIFKDVSITTTNNWLSSATPTSTNITDQTQAHVKIFH.. 162
257 1.000e-21UniRef50_A0A1N6K2E7 Uncharacterized protein n=1 Tax=Chitinophaga niabensis TaxID=536979 RepID=A0A1N6K2E7_9BACT  ali  22  3.........YILLIACILTLFVACSDDTVCDVDTRTEVRVRFR-VKRPGFQEKDTVATNLILLAVGKDSI-YARQKGLSGMQFSLDRLSDQASYYFQPDADSVGKAATITFYYKRQPKFVSAGCGIIMTYAIDSVKYDRVAIKALVVNQHIVTTGNETNLSI.... 157
258 1.000e-21UniRef50_UPI0008E571E9 hypothetical protein n=1 Tax=Myroides guanonis TaxID=1150112 RepID=UPI0008E571E9  ali  18  18.....................TACEKDDICPEDTTPLIYVKFYRVDDQNQNNTTGNVYA---KALGFNDTIFRKG---NEIKLPLQISKEETTWVLTLESLNDENQDTLKFLYRPRTEYLNKACGYRTTFVILNNNKQGNWISIYELQTSFIENEKEEHLKIFY.. 169
259 1.000e-21UniRef50_A0A1F3N838 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RBG_13_43_22 TaxID=1797356 RepID=A0A1F3N838_9BACT  ali  24  2..KSFRTNFLAVVFIVTILKVVSCTPE-SCLEETVAEMKIPFYLSSTQKNI-APDSLTIYGIH--NESNKLYNSTKNANRADLPLNPSAESCSFVIRIN----GVSDTILLTYDSYAHFISKECGYTYYHTIDSLAFTKNMIDTIIIKNRFVTTVNEENFRILY.. 155
260 1.000e-21UniRef50_R7IZ67 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:873 TaxID=1262936 RepID=R7IZ67_9BACT  ali  26  22......................GCNSDG-CTEMRSAMPIAQLRNSATGEVATL-DSLDIHGIGVAG-DSLLVSAGTAVSKQYLPLRYSASSVRWCIAYRYAGLDNNDTLTLTYTSSPWLADDDCGAMYRYTITRATSTTHLIDSVSVAQAEVTNLEDVNLNIYFR. 164
261 1.000e-21UniRef50_A0A1V5F6V5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA395 TaxID=1852820 RepID=A0A1V5F6V5_9BACT  ali  21  21....FTKSTVFIWITAVLFFSTSCNSDEVCRKEKNSRLKVGFYTAVFNSSTLAIDSLTVNGVDSLGNDSILYNNSKNLSVIKLPLNKFSNESKFIIRFNDS---IQDTLTVFHTNYDQYLSFECGMIRNHLIDTVLITNHFVDSVKIEEHNVSTIDAEHLQIFHN. 188
262 2.000e-21UniRef50_UPI00041B7C16 hypothetical protein n=1 Tax=Prevotella albensis TaxID=77768 RepID=UPI00041B7C16  ali  24  1MRKILGFII-------AVLVLVGCSTLD-CPLNNSVYTYYKVMSDST------VDTLSVISFRHTDNEGVQLNKLANPDSLQLPISYTGDKDILYFVSKKSGTETIDTVVITKSNFDHFESVDCSPSVFHKLLDVTTTHHAIDSIVINHRDVDYDSKKHFSIYFRH 154
263 3.000e-21UniRef50_A0A0D5BP37 Uncharacterized protein n=22 Tax=Elizabethkingia TaxID=308865 RepID=A0A0D5BP37_ELIMR  ali  18  1....MKYIKFIFCFVPLLLAVVACQEDDICTEGGSPKMKVKFKRAADGK-LARMDSLTVRILWGTDTL-MVANNSKAVDSVMIPLKVTGDFTDILVQTNPKSKTEISKIKVKYTESSEYVSPGCGIRKLYDNLTVSPVENPVKSVDINSNQIHNEVKT--VLYFN. 161
264 3.000e-21UniRef50_A0A1M6RH85 Uncharacterized protein n=1 Tax=Reichenbachiella agariperforans TaxID=156994 RepID=A0A1M6RH85_9BACT  ali  23  1MKNF---VLFSVVILGSLFFLMACQNEPECDLE-RPYINMGFYDFE----TLEIDTLRYDLIGTAGTDSLLYTSADTLSVFTFPLNPSADTLAYYFV----TGVSIDTIQLKYDRKLEWLSERCGPFFKYQNLKIVY--HTFDSVSVIQSTIDSSIDENIQVY... 151
265 4.000e-21UniRef50_E4TA71 Uncharacterized protein n=10 Tax=Riemerella TaxID=34084 RepID=E4TA71_RIEAD  ali  14  2......KLFKLVFVLGMLLSLASCSDDDICESGSSPRMKLKFKDSSNK--LYQPDTLIIGVKLTGEENIKTVVSALKPDSVLVPLRVDTNFTDLYISTSAKGMPSK--VRVLYTPVSEYVSPACGMRRLYNDLSAVLENTPVKNIELNEKNVHDENKTHLYLIF.. 159
266 4.000e-21UniRef50_A0A0F9CFF4 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9CFF4_9ZZZZ  ali  21  25.KKQTLKRVPLLVILVFVYFCHSCEKEGACTDDLISRLKAGFYVRDSIEDRDTVLN-NVTFYGELRSDSLIYDAALGLQGLEFPLHSTEEYTGYVLEID----TMVDIINIWHTPKITLFSYACGFTTTHDIYWLSHTNTIIDSIAIVRPHVNFNSEENFKIYIK. 185
267 5.000e-21UniRef50_A0A1P8RNC1 Uncharacterized protein n=5 Tax=Lacinutrix TaxID=291183 RepID=A0A1P8RNC1_9FLAO  ali  11  18.......................CERDDLCPEDTTPKLFVEFRDNTLTDNAKNVALLRV-EDFDDSERVLEGYNAVTASQMLLPLKTNTTETKYRVIVNDEIEGNADVITITYETEEIYVSRACSYKTIYKNVVLTIEDNWMQFAEPENENVINEDEIHYTIRH.. 172
268 5.000e-21UniRef50_A0A2V1ITV6 Uncharacterized protein n=2 Tax=unclassified Muribaculaceae TaxID=2006847 RepID=A0A2V1ITV6_9BACT  ali  27  2...............................ENQSSIPLAGFYSA-GTEERVVIDSIKVYGLGAPG--DSALTSSVRASQVYLPLRSSAESTAFCFRYDLDTPQLIDTLTLDYDSEPRFVSEECGAMYFYHVRRLTHTRHLIDSVAMPDSLIDNVDIERLKIYF.. 134
269 6.000e-21UniRef50_A0A1Y0MEZ8 Uncharacterized protein n=1 Tax=Winogradskyella sp. PC-19 TaxID=754417 RepID=A0A1Y0MEZ8_9FLAO  ali  13  1MRFYKFSILFLAIL------FLGCERDDICAEPTTPRLLVDFFDATDTDIPKTAVRLSVYAVNLVTDENTGVISNSNTDAIELPLIIGNETTRYFFETDTNTNSNIDILEIKYTHDFIYVSRACGFKSIFNMLTATDSIDWIQNTVLANTTVENEEATHVQIFH.. 194
270 7.000e-21UniRef50_A0A1J5L8B9 Uncharacterized protein n=11 Tax=Bacteroidetes TaxID=976 RepID=A0A1J5L8B9_9BACT  ali  12  19........................EKDDVCPASTTPHVILIFNDASNIDNSKSVRRLSVIG----EDNTVEIISESTTDSIVLPLRFQDTTTRFILTKDADYDSNQDIIEFSYKPEFVYVSRACGYKSIFNQLEITLEDNWMLYSQILNETVENENEAHVVIYH.. 171
271 9.000e-21UniRef50_A0A1I2JTY6 Uncharacterized protein n=1 Tax=Sunxiuqinia elliptica TaxID=655355 RepID=A0A1I2JTY6_9BACT  ali  17  2MKKILFGLFWAL-------ALVACKEVFDPPPQALLQVKVKYVDEEATGSPK-------VSVYGVDMDDTIWIYQEITSDFRLPMS-AKTETSFVILLDS----IADTLTITHDKELIFESAESGFYNEYKILDVKHTFNRIEDYEVTDSAVTKNWHENIQLYINS 148
272 1.000e-20UniRef50_E4T0Z3 Uncharacterized protein n=1 Tax=Paludibacter propionicigenes (strain DSM 17365 / JCM 13257 / WB4) TaxID=694427 RepID=E4T0Z3_PALPW  ali  25  1MKKTQYIIFILCLFVGF-----SCAVDESCRTNRTVLMNVGMYHVTKNTLTRTSTSLDSLTVRGVYVDSVLYNNAKGLSKINLPLQSFESNSVYEIVFNATITTKKDTFTVAHQNMDKYLSLECGSIKIHSVDTVLTTNNFIDSLRITKRQVNNINVENIQIY... 185
273 1.000e-20UniRef50_E1GVH9 Uncharacterized protein n=8 Tax=Prevotella TaxID=838 RepID=E1GVH9_9BACT  ali  26  1MWKKKFTLATSSFLLLSYIILTSCSEAD-CSMLDGVR------SKYVAKGEPTTDTLTVLAVREGLADTTILYKLQDIKTFSLPLSYNNEQDKLKFVFNTSGKKITDIVKITKTNVSYFENISCPAYFLHKITKVENTTNRIDHIDINNANVNLDGKENLYIYFKS 160
274 1.000e-20UniRef50_A0A1I2ELC1 Uncharacterized protein n=6 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A1I2ELC1_9BACT  ali  27  1....MNLVKYTFLISILLLTAIACSDDEACLSNQHS-VQAQLLSAWWDTD--VDTTLTEVTVIGLGQEDSVYNN-ESVSELFLPLNFHTDTTVFVI----SAKTLKDTLRLVAKRELDFISRECGYIFSFDLDTVIHTKTFIDSVSIIYPKIKYETTENIQLYIY. 154
275 2.000e-20UniRef50_L8JX50 Uncharacterized protein n=2 Tax=Fulvivirga TaxID=396811 RepID=L8JX50_9BACT  ali  28  3.......IIIAILFIMAVMLMSAC-NEPDCQSKTTNFVNVKFYKIENNE----LDTLTILSITAIAADDTVFVENLEVSSVRLPLRPDTTATVFAFDSNFG----RDTLILTYRKKARLISENCGVEVIFSDLG--YSRNDFDSIKVVNQTLIEDITEDVKIY... 147
276 2.000e-20UniRef50_A0A2E1P5V7 Uncharacterized protein n=3 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E1P5V7_9FLAO  ali  17  17.......................CEKDDICLEGTTPXMIILFKNFENP---XAKKXVNDLLVRGLGADSLTTYSG---DSISIPLRNXFEFTQYEFTLSTSSPTLSDSLQINHTQFDTXMXRACGYKSTFVLENLTQGXGWXKNIEKIRDTLSDESSSHLAIYH.. 160
277 2.000e-20UniRef50_UPI0006841020 hypothetical protein n=1 Tax=Mesonia mobilis TaxID=369791 RepID=UPI0006841020  ali  17  1.....................................MVIEFFDIDFPEQ---SKSVPRLNVIAEGESEFYFETTENRSTISIPLRTTENFTNFSFVRNSNLTSNADEIQFSYTVNLEYVSRSCGYKAEFINFNAVLVNNWIQGIQVIQPNILNEQDTHLYIFH.. 136
278 4.000e-20UniRef50_A0A255TIM6 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A255TIM6_9BACT  ali  28  1.........................................MLTKADGTKDTLSDTLTVLTRQLSGNDTILLNKSVSTTEFQLPISYTNDVDTLTFIRKGDGYEISDTVWLEKTNLPQFESVDCNLVYFHDVVSVNHTRHGIDSITINKRRIDYDSTEHFHIHFK. 125
279 4.000e-20UniRef50_G8R5K9 Uncharacterized protein n=1 Tax=Owenweeksia hongkongensis (strain DSM 17368 / CIP 108786 / JCM 12287 / NRRL B-23963 / UST20020801) Ta  ali  15  1..MKLGKSTLLLVVLSITLGLLSCEEQQ-CAQAFSSEVQGTFYLRDSLGTQIVTKLPVFTLYGLDKEDEKLNNRSTQVDIFTMPLSPDFSERSFILINDS----IIDTLTFTYTSKLQLINTVCGFVPNYTLSKVENTTNFIEAVNITDNDVNTDDKENIKVYIK. 158
280 5.000e-20UniRef50_A0A1Q3XBP2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 46-16 TaxID=1895925 RepID=A0A1Q3XBP2_9BACT  ali  21  8.........IVSCACLLAVVLLSCQQQDPCLQPKIMTLQVGAYQK--PDTAIIDTALPAPFIAAIDFTDSIVNGTNNLNKFSLYLSPQADSCRWVWPDTAAAITTADTLTFYYDKSLQFLSNACGYTYFYNLHSLHTTNHSIDSVVINSYNVNNDSKEHVKIYY.. 166
281 6.000e-20UniRef50_A0A2M9R4U1 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium UR159 TaxID=2008672 RepID=A0A2M9R4U1_9FLAO  ali  18  8..........IIPFLITIFFVTACEKNDLCGGVNTPQVNITLYNRLNNEEQKTAQMINCYALDYIHQDTIPVIQFLNRASFTLPLKVYEENTVWYVELKE--WIGNDTITFRYETSSEYVSKACGYRSVFQRVRVNSVNDTIQSTLDYTNEITTNDTTHVQIYF.. 173
282 6.000e-20UniRef50_A0A1Y1T029 Uncharacterized protein n=1 Tax=Zunongwangia atlantica 22II14-10F7 TaxID=1185767 RepID=A0A1Y1T029_9FLAO  ali  13  21.....................AGCQRDDICPEDTTPMLVINFFDATTREPRTSV-NLTVREVGRDPLDMLLY--RENSQSISIPLKTGENSTQYEFIYNNSLETNIDIIEFNYEPEEEYINRACSFKVNYLNIDYITDDRWITRMEFLVDDIVSYNTAHLNIYFE. 194
283 6.000e-20UniRef50_U2LHW5 Uncharacterized protein n=1 Tax=Prevotella pleuritidis F0068 TaxID=1081904 RepID=U2LHW5_9BACT  ali  28  1........................................................MTIYTTTALGKDSILINKDVKKDSFLLPMSYRREEDVFFFEMKDTNRVIRDTVRVRKEDHPHFEAVDCNPAIFHTIKGVRYTRHRIDSIVLNNSTVNYDTTTHFLIFFK. 111
284 7.000e-20UniRef50_A0A171ALR1 Uncharacterized protein n=1 Tax=Paludibacter jiangxiensis TaxID=681398 RepID=A0A171ALR1_9BACT  ali  25  14.................AVAYIACTNDNSCHENRYVVMTSNFYTIKNDTTKTF--TVDSIWVKGLGNDSLLYSNSKSVTSISMPLQKMNDTSRFVIRFNTIY----DTLTVIHANIQKYLSLECGCLVTHKLDSLSYTQHKVKRIKVKYDNVSTTKRENLQIYF.. 156
285 9.000e-20UniRef50_A0A172XWF9 Uncharacterized protein n=37 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A172XWF9_9FLAO  ali  16  1MKYFK-----LLILTCFLGMLFSCGDDDICESEGTPRMKIGFKSFETGKP-GTIDTLYVAVDYGSGT-KVELGKTAAVASRLIPLRVDAPYTDIYVKTRLKGTESK--VRINYTTKAVYVSPGCGIKKTYENLTTELTPTVVKKVEVDLNQIENEDKTNIFLLF.. 159
286 1.000e-19UniRef50_H1Q0I6 Uncharacterized protein n=5 Tax=Prevotella TaxID=838 RepID=H1Q0I6_9BACT  ali  26  16.....................SACS-DINCPLNSTV------FSSYTMKGDTLKDTLSIIAIRPDSSDAVLLNRFVGKTTFKIQMSYVKDVDSLLFLYSDTGNSQLDTVVVRKTNIPHFESVDCPANYFHTIIGTNHTRHRIDSIVINNPNVDYDNKKHFFIYFNS 155
287 1.000e-19UniRef50_UPI0009D764F4 alpha amylase n=2 Tax=Prevotella TaxID=838 RepID=UPI0009D764F4  ali  25  5...................................................TLRDTLTVITMRPDSNDAVVLNRLVNTYTFYLPMSYQKPTDELLFLYTDTGKQALDTVRVNKTDKSHFESVDCPPSFFHTITSVECTKHRIDSIVIHDPNVDDETKQHLYIYFNS 121
288 1.000e-19UniRef50_A0A0X3AQH2 Uncharacterized protein n=4 Tax=Apibacter TaxID=1778601 RepID=A0A0X3AQH2_9FLAO  ali  15  1..MFQKKINILFTLFFLCILIFSCVDDDVCDKVTTPRLTIEL------DSLGSKYKKNRLYVDRKNPDGTIQSEGVKKDSIQLPLNSLSDETIFYLYDTHTPDSCKNIITIKYLTEQHFVSKACGFKVIFNNVTYEATALTIKTITGKSNHIYNESSTNLHI.... 158
289 1.000e-19UniRef50_S0F594 Uncharacterized protein n=10 Tax=Bacteroides TaxID=816 RepID=S0F594_9BACE  ali  23  20......................ACE-VENCPPNALSYAHFTLVDQYGREDTLPDGSIQERVVHDSLISDTLINSESNASSFKLPLSYNS-QTRFVIAYQGR---RPDTVILEHRNIPYFINLDCGTMMFHEVEHVTYTHHQLDSLTITNPNIDNNEKENFRIYF.. 176
290 1.000e-19UniRef50_A0A2G6UP30 Uncharacterized protein n=3 Tax=Chryseobacterium TaxID=59732 RepID=A0A2G6UP30_9FLAO  ali  15  1.............MICFMGMLFSCGDDDICESEGTPRLKVAFKSQESGKER-PLDSLYVAVDYGSGK--VQLGKLTKIDSRLIPLRVDEPYTDVYFRLENKGVES--HVRISYTTKTEYVSPGCGIRKFYENLDSTTTPTPVKGIEAGQNFIENENKTNLFLLF.. 152
291 2.000e-19UniRef50_A0A2G6GXS7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GXS7_9BACT  ali  25  1..MNTKTISLLCLAAFSLLLPRACNSSESCPDNTSAYLVAGFRQL--PVESEQDSTLEGLSVSAINGNPVSLYSNTNAARISLPLDPKASSIRFVFELGASS----DTLLLNYEANAYLLSYDCGFASRFGIVGFSCSGSLFKEILLDDNTVDPENVLHLRLF... 160
292 3.000e-19UniRef50_A0A2A4P210 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4P210_9FLAO  ali  19  2.......................................ITFYDIDAPDTRKEVIDFSAKII-----DNQVVIETITTDSIHIPLDIFNGKTSYQFLQK----EIVDKLKFTYTSNQIFMSQSCGYRTQFKQLAAETSTHWIQKISIEETTINDQKTEHVKIYH.. 117
293 3.000e-19UniRef50_G6AFV7 Uncharacterized protein n=24 Tax=Prevotella TaxID=838 RepID=G6AFV7_9BACT  ali  25  42..................FFFSSCSDID-CPVTNGVSAKYVLK------GDSLHDTLTISAIRDGLTDTVLVNRLVGSKSFQLPMSYAGASDKLRFVFTDTGHTTVDTLTIAKTSVSHFESVDCQPVFFHTITGATTTGRIVNRIEINNPNVDYDSKENFHLY... 181
294 3.000e-19UniRef50_A0A2T1N9P0 Uncharacterized protein n=2 Tax=Mesoflavibacter aestuarii TaxID=1266046 RepID=A0A2T1N9P0_9FLAO  ali  16  1....MRVLKSILLILCSLFIVTNCEKDDICANTTTPRMVVNFKDIVVQENL---KTVNNLLVQGVGNEAVLTYNSVDVAEVLLPLKIDVPTTQYELIKDDIELANSDIITIKYVVKEIYVSPACGYKVQYENVSIMVEDNWITEPSIDNLIIRDETITHYNLFH.. 184
295 4.000e-19UniRef50_R6APV4 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=R6APV4_9BACT  ali  26  1.....................................MQCNLYAAETKSPMTLYDEL---SVTPAGRDTVLLNKATEISSFLLPLKESGTRDTLLLHFNLSGQDAVDTLFVDHIPQPHFESLDCPSSVFHTITGVRATSHTIDSVALVRSIVNYDDVENIRIYLRS 134
296 6.000e-19UniRef50_A0A2E1Z3M5 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E1Z3M5_9FLAO  ali  16  18.......................CEKDDICIEENTNRITIGFLDYE----TKNPTGISLVNLKSIGNDSIIHETFSG-QSIKLPLKVSSTKTQFLLDNND----LIDTLTIYHQSIHQYLNRSCGYKSNFIINSITKQTGWIREISVIKDSIFNEEETNIFIHY.. 154
297 8.000e-19UniRef50_A0A1Q6GZS3 Uncharacterized protein n=1 Tax=Bacteroides sp. 43_108 TaxID=1896974 RepID=A0A1Q6GZS3_9BACE  ali  23  16..KISKKNIFRIAPLVVLVASAACSSN-NCPLNNVVTCNCYFYDSEGTSDEITVKALYVETIGTSRKDTVLVNKAAGKSYLNLPMSYFTQCDTIMFSY--AGISGTDTLYISHDNYPYVGLPECGSYMFHTITNVRNANNSIDHVEIANPKVDYEGKENIKIYFY. 211
298 9.000e-19UniRef50_A0A1J0LHZ7 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium UJ101 TaxID=1150389 RepID=A0A1J0LHZ7_9FLAO  ali  14  1MKKISFIISATLL---SVFFFVSCEDDEICGEDTTARLIIKFYDEATNEVASKSGVIS--------TTEFTDYTFSSQDSIQLPLSLNNSVDTL-FYRTSTNATDVDTIALSFTRTEEYVSKGCGFKINYTNVSATTSSKTLKKLEWNQISITNETEAQMFIYF.. 163
299 1.000e-18UniRef50_S8FJ72 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=S8FJ72_9BACT  ali  22  1MKKIIP-ILIVLWSVAAIGGLNSCSED-NCPTTTTSVAYFDFLNSDTHSPLSLTSTVTVTAVKDSIVNDTVYNAESKLSNLSLPLSY-STKTTYTIQYTDL---MRDVIELTHRPIPFVSDIACGVLMFYEIEDLKYTTNALDSIALVNPNINNEKTTNFHIYY.. 179
300 1.000e-18UniRef50_A0A255R8Z0 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=A0A255R8Z0_9BACT  ali  24  1.........................................MKKANGTADTLKVDTLSICSRRADGRDTILQNRITGVTTFDLDISYINPVDTLHMTLDTMGNTYRDTIWVEKSNQPHFESVDCQISYFHTILSVKSTHHIIDSLSINNSQVNYDSKEHFHLYLKD 127
301 1.000e-18UniRef50_UPI0009FB46FA hypothetical protein n=1 Tax=Labilibacter marinus TaxID=1477105 RepID=UPI0009FB46FA  ali  21  60..KFMKIFSWTLILLSV-LGVYACSNQDFCLSNQQA-VQGGFYSASATSD--KDTSVIGIDLYGVGGPGLLYDS-ASVSKIFMPLNMETDTTQFVLEINK----LRDTISFIHQKELNFVSGECGYIFSFYIDSVYYTDRSFIDTVIVDKVIYNENLENVKIYLYN 218
302 2.000e-18UniRef50_A0A2S7SWC3 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium RB1R16 TaxID=2077091 RepID=A0A2S7SWC3_9BACT  ali  20  3..........LLGILLIGSAFMACTQEQPCLTPKIASLNLRFVHFAADSDTGLPKAV-FTAITDSGNRSVIYTSPSA--YFTISLSPVADSCKWLVLADSATAASFDTMSFYYKRKLQFLSNACGYTDFYAIDSVHTTKNHVDSVIITNTSVTNDNTKHLKIYMH. 167
303 2.000e-18UniRef50_W7Y5M0 Uncharacterized protein n=1 Tax=Saccharicrinis fermentans DSM 9555 = JCM 21142 TaxID=869213 RepID=W7Y5M0_9BACT  ali  22  2......KIFTYVFLLLFMFLTYACGDDDFCLSNQQS-VQVGFYSSYQSSDT--DSSVSNVLIYSTGVDSILYD-EATVSDVYLPLSMENDSSQFIIEIND----LKDTISFVHQKELNFVSGECGFIFSFYLDTVMYSDSFIDSVAIDYDEVYNENLENVKIYLY. 156
304 2.000e-18UniRef50_A0A1M6PBQ2 Uncharacterized protein n=6 Tax=Chryseobacterium TaxID=59732 RepID=A0A1M6PBQ2_9FLAO  ali  19  1MKKIIFFLSFLII-------LASCSDDDICLSESTPRLQIRFKNGAG--QITRVENLIVDVDYGNGKPKNIITQ-TNVELVLVPLRIDDNYTDIYFKTAKDGDSSK--VRISYEKKAIYVSPACGFKVNYDDLKADLKSDPVKNIESNETSLTDEGKINFYLHF.. 156
305 3.000e-18UniRef50_H6RHQ2 Uncharacterized protein n=1 Tax=uncultured Flavobacteriia bacterium TaxID=212695 RepID=H6RHQ2_9BACT  ali  13  2...........................................NFIDETLEKAPERLLIVGKDKTTPITTISPGSSSITEALIPLVPNTNQTEYYLVTNASIDGNIDALILSYTPNPKYISKACGYIVSYDNLITPDTDNWIKKITVLSPSITNENEVHLKIYH.. 131
306 3.000e-18UniRef50_A0A0G3LZT5 Uncharacterized protein n=85 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0G3LZT5_9FLAO  ali  18  1MKYLKFLITICFLGILF-----SCGDDDICESEGTPRMKVAFISIKSGKPMT-VDSLNVAVDYGSGK--VDLGWQTKIDSRLIPLRVDSPYTDVYFKVSTKGTESK--VRINYTTRSTYVSPGCGIKKNYDNLSSQLTPNPVQNLEEGLNQIENEDKTNLYLLF.. 158
307 4.000e-18UniRef50_A0A2W6XR97 Uncharacterized protein n=1 Tax=Chryseobacterium sp. TaxID=1871047 RepID=A0A2W6XR97_9FLAO  ali  16  15.....................TSCSDDDICLSDSTPRLKFKFRNAVNPDNLITIDTLYVDVDYGKTELTSIIRAQANVDSVFVPIRVDDTYTDIYFRRRKDGPRSK--LRINYSTKAIYVSPACGFKINYENLNAELEANPVLNVESNHTSLTDESKINFYLRF.. 161
308 5.000e-18UniRef50_A0A1M5TE07 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M5TE07_9FLAO  ali  14  18.......................CERDDICADPTTPRLLIEFFDAVDTEVSKTVTRLTIYADDANITIPDNENSSRNSNSAGLPLKIDTTITRYFFEKDNSTNSNIDVIEITYETEFIYISRACGFKSIFKNDIIDDGDNWIQNTRFANTTVENEDTTHVQIFH.. 195
309 5.000e-18UniRef50_A0A1V5S993 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin302 TaxID=1852811 RepID=A0A1V5S993_9BACT  ali  26  1....................MVSCSGD--CYVPTKARMGVAFMD----STTLKPYTINGLTVQGVGSDSILYNK-VNTSVIYLPLHDNAEQTDFKITIASTVEGEQDIMHIDHTPRPQLISPECGCVMFQTVISADVSPVMSDTIEIYNAEVKNENDIHLKIFF.. 142
310 6.000e-18UniRef50_A0A2L2WN43 Uncharacterized protein n=2 Tax=Prevotella sp. MGM1 TaxID=2033405 RepID=A0A2L2WN43_9BACT  ali  28  3................................................................NGIDSVLLNRKTNATVFELPISYTDAEDTLFFELADEAKNLFDTVYVAKNNTPHFESVDCNISFFHDITAVKWTNNAIDSVVINKSSVNYDSTEHFHIYFK. 104
311 6.000e-18UniRef50_A0A1Q3Z7G7 Uncharacterized protein n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A1Q3Z7G7_9FLAO  ali  16  15.....................TSCSDDDICLSDSTPRLKLKFRSAANTSNQLIIDTLYVDVDYGKTSLTNIITAQPNVDSIFVPMRVDNAVTDIYFRTRKNGPRSK--MRVSYITKPIYVSPACGYKINYENLNAELESNPVQNVESNHTSLTDESRINFYLRF.. 160
312 8.000e-18UniRef50_A0A1Z3W548 Uncharacterized protein n=6 Tax=Chryseobacterium TaxID=59732 RepID=A0A1Z3W548_9FLAO  ali  16  1MKYFKF-----FLLICFLGTLSSCGDDDICESEGTPRLRIAFKNADGKEMT--VDSLYVTADYGTGAL-VDLGKTANNTFRLIPLRVDEPYTDLYFKTRIKGPQSK--VRVSYTTKSAYVSPGCGIKKTYENVSSELTPTPVTKLENGLNQIENENKTNLFLFF.. 158
313 9.000e-18UniRef50_A0A2T5C255 Uncharacterized protein n=1 Tax=Mangrovibacterium marinum TaxID=1639118 RepID=A0A2T5C255_9BACT  ali  22  1MKQFFFSIILIV-------ATVACKEVYDTPPESRVQLGLYYTNEDNSDT-------PLLTTYGLGQDSIWYD-AENTDSFLLPLS-DAGVSTFVVLIDSV----ADTLQIQYTPQVTYESMESGFYYTFWIQTVMSTANKIDKIFLTDTLVNENWHENIQLYLND 146
314 1.000e-17UniRef50_A0A2W7NCN5 Uncharacterized protein n=2 Tax=Cytophaga xylanolytica TaxID=990 RepID=A0A2W7NCN5_9BACT  ali  18  31............LMVLLPLMIGGCNESGICLSNQHA-VQVSLISAHTGKDTTLTT-----SVFGAGRSDSVYASQA-LSKLFLPLEFDHDPDTTFFVIKTKTT--ADTLAFLYRKELDFISGECGYVFSFTIDGVAHTTNKIDYSTIVYPTVKYEDLTNVQVYIY. 175
315 1.000e-17UniRef50_A0A1M6A9V3 Uncharacterized protein n=2 Tax=Cruoricaptor ignavus TaxID=1118202 RepID=A0A1M6A9V3_9FLAO  ali  14  1..........MFFVLMLGIFAASCGDDDICLSEGTPRLKMKFKDSAGR--LATLDSLYISADYGGGTQAVV--QAARVDSVLVPLRIDGSGSTL-LEIRRRKAEMPARLQLEYAEQAEYVSPACGIRKLYRD--VRYQLHPARAAEPAQNEITDEIRTHLYITF.. 152
316 1.000e-17UniRef50_A0A1F3F6W6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWB2_41_8 TaxID=1797322 RepID=A0A1F3F6W6_9BACT  ali  23  1MKRLFYLILLLTIV-------TACKEVFEAPPQ--ALLQASFYHS-----TTKRTMSPIVTVMGIGSDSLLYNEEI-ASSVLLPL-AKTDTSHFMIWIDSKS----DSISFIYTTTQKYASMESGFYYEYKLRSVGFSQNRIDSVEIKDSLVTTKWNENIKIYIH. 145
317 1.000e-17UniRef50_A0A1G8WXE3 Uncharacterized protein n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G8WXE3_9BACT  ali  20  1MRYQPFVVLLLFLA-----GLVACEP-GECELGGQPKPGIDFRDDVGDSLVDTQVSVRLLRIESPGVDSLASNDTLTTSLLSLPLPPRGDQVTYYLEFVGQPSSVLDTLVLHYRARPVLVSYECGFLTNFDSLRVL--SHTFDSVQVLLDTVDTQNETNLRIYF.. 164
318 2.000e-17UniRef50_F0IGV4 Uncharacterized protein n=6 Tax=Capnocytophaga TaxID=1016 RepID=F0IGV4_9FLAO  ali  16  16.......................CESDDICDDPVTPRLIVRVYDKDTPRRTKPINNLVIL-----GKDKAQAIQPATTDSLALPLKLTSGESSFVLIKDAVVDNNGNILKINAIASEVFSGKGCGYKVIYDQITATSNTPWIARVQVMFRKIEDEKQASVRIFY.. 165
319 2.000e-17UniRef50_A0A2T4WNH3 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WNH3_9BACT  ali  18  1MKKIIALVIVLSVFI-------SCEKDDICSSETTPMLVLRFYDIAAEDETKQVPNLLVYGLN-DSSEIVLFDRASNTDSIAIPLRTDGNLTRFVFEGDDFQTGNFDIITANYEREDLYVSR............................................ 124
320 3.000e-17UniRef50_A0A0L8V385 Uncharacterized protein n=1 Tax=Sunxiuqinia dokdonensis TaxID=1409788 RepID=A0A0L8V385_9BACT  ali  22  1MRKILYSLFL-------VAAIVACQDLYDAPPQ--SLLEVKLTNVDTLSNR-----IPKVSVYGVDQDSIWIYQ-VQTNAFRLPLS-LEETTSFVLLLDS----IADTLTIRHSNELIFESAESGFYHEFKILDVGHSFNQIDDYEVTDSMVTKNWHENIELY... 143
321 4.000e-17UniRef50_A0A1F3IX13 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_33_16 TaxID=1797341 RepID=A0A1F3IX13_9BACT  ali  20  1MKFIFRIVGILLFAFMIFNC-----SDNRCNEEVDVLLKAEI--IVNDPILTNAGFLETLSIYSPAWTDSVHYSSAN---FMLELSPFADTTVFVF----TSQAWKDTVKIFYERDLVYLSQECGFVTYYKIDSTRYTS-TIDSLVWVNKKLTTLTDGHVKIYF.. 149
322 7.000e-17UniRef50_A0A1M6Y6Z3 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6Y6Z3_9FLAO  ali  18  1MKKIQSILSFAIVAMLFSFVLYSCEDDDICTDDGEPRMVANMY--YNGTDVALEDTIYYWAYVLDESDTVQIENGVNASTFGISVRQNLQKKVFYTIAQGPDRVVRDTITILAQRDKLYTSKACGFGLTFKDVNVTLRTNWIRSIETVNTEITNGSTTIIKLF... 193
323 8.000e-17UniRef50_A0A0D3LF96 Uncharacterized protein n=2 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A0D3LF96_9BACT  ali  13  3.........YLLLLIVFPALFWACQPEEACISSATNRFVVEFLSEDNPDITTDDRYFRRIYSLVKTSENTLTGRARIENTFLLVMNPDSDTTTFVFEHTAAEEGVADTLIFTYQRRYRLISPDCPLEVTFRDLRLVRTT--FDSAQVVNTEIEPSDATDVQVF... 167
324 1.000e-16UniRef50_A0A0C1XP77 Uncharacterized protein n=1 Tax=Hassallia byssoidea VB512170 TaxID=1304833 RepID=A0A0C1XP77_9CYAN  ali  17  1MQRACWVLIIFLLVLGG-----SCLDNDICLRGSDNALVIEFKKFVEGEAVT--DTVTFLNIEAAGTNAVFYLQDPDVDETVVTINPYEEETLFTF---NDFRGQTKTLRVGYKTEVRFVSEECGSERLQYNLKILETT--FDSVRVVRTSLNKGRSTNIEIYH.. 157
325 1.000e-16UniRef50_UPI000DCB50F2 hypothetical protein n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCB50F2  ali  23  1MKKATWFIFLLIII-------ASCLNDPDCFRINSNVIGISFRVMGTG----KSDTLRMYGVTTQNTDSTFYRNTAAT-GIGIPLDFTTTESEYLFQTTRGDYS----IALKYDVNVQFVSEDCGSK--YVLENLETTGHTFDSIRLVSRTPGTTAGGNIEIF... 145
326 2.000e-16UniRef50_A0A1M3II76 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 43-93 TaxID=1895924 RepID=A0A1M3II76_9BACT  ali  22  1.....................................MIIGTYKPADTGTAGVDSTLPKALITIPDSNFALY-KGANQSKFVLLLSPKSDSIRYYFSTDSTFLG-SDTVTFYYQRNLTFLSTSCGYTFHYVLQSVKNTSYNIDSVKIVNGNIDTANIEHVKIFY.. 126
327 2.000e-16UniRef50_A0A1Q3MZX4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 47-18 TaxID=1895926 RepID=A0A1Q3MZX4_9BACT  ali  18  1................MLVFAASCNKEQVCFIPTNVTGKMAFSVKEVRDTLILTDSNVIDTTIISFRDTYVIYGIRGQSIISFSLDPDLQTIQYKVVPDNNEPEMNDTLTVKYDSYLYFISNDCGFTYNYKITSVHITNHYLDSSAVITPEVTTESKQHIRLYF.. 164
328 5.000e-16UniRef50_A0A2N2WVD7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-4 TaxID=2013694 RepID=A0A2N2WVD7_9BACT  ali  18  3...............GVIGWLSSCSENTICPGEKISQFRIGFTKTIDSTTIHYLIYQTLPSDTGLINDT-LYNRSIKPGYVYLPVDITSDSTWFMVEVDSNYYIVTDTITYTYTKEPILTDLECGFTMEFRLDTFYYTTNHIDTALLISKQINTEKINHVEIQF.. 155
329 1.000e-15UniRef50_A0A2N3ICH1 Uncharacterized protein n=1 Tax=Raineya orbicola TaxID=2016530 RepID=A0A2N3ICH1_9BACT  ali  20  1MKMYAWIFVMLLIGTTACIQLTICADAVEVPVSVNFKQKIKFKDRFNRDSVVVRDTFIFLDIQPVGFDTLLFTPQKPSDSFRLPYNPLQDTIRYVFRYRRGNVSRKDTLFLGYSRRILLTSPRCGVRNDYENTRIL--HHTFDSLTLKNT----QNNVSLEIFY.. 163
330 2.000e-15UniRef50_A0A1W2G934 Uncharacterized protein n=1 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2G934_9BACT  ali  20  4..........VVIICLGILVLWACGEEPDCDLEVENNITVNFFNREDSTQQ----FMEFISVTERSTDHVFYNSMDSLTSFELNLNPTVDEVTYVFV----SSTSVDTLTVSYTTQLEWLSEECGPYFFYSKLDVVGSSFTYD---LVSTFIDVTIDENIKIY... 146
331 3.000e-15UniRef50_A0A1I2HN85 Uncharacterized protein n=2 Tax=Thermoflexibacter ruber TaxID=1003 RepID=A0A1I2HN85_9BACT  ali  16  3.KNLCIKSFFFLLLGTIFFMLSSCEDCTFTSKNST-LIKVRFYPEAERINRRFRKASFTIDSVRTERGTVFRRRGANIDTLSLPINPTDRDNAYYVFFRTSTEQIIDTLQVSYNRQFSVISPNCGYDQKIDNLQIMLNKTTLKTATVFKDNLSVTDTLNIRIFF.. 168
332 3.000e-15UniRef50_A0A2N5Z2N9 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z2N9_9BACT  ali  18  2......KFSVYILIITLFALIYSCS-DDTCNADTDTLLNIEF--TVNDTNLTNIDFMDNLSLYSTQWSDSIHYSEEGSNEISLMLSPNSDTSE--IIITSVNAGLKDTLTIISQRELIFYSPECGFITNYFIDTLFYSINYIDSIAITSYQISTSKDGQVQIYF.. 155
333 4.000e-15UniRef50_A0A2P8CIE6 Uncharacterized protein n=4 Tax=Prolixibacter TaxID=314318 RepID=A0A2P8CIE6_9BACT  ali  23  1MKKYILPLL-----VVLLAIVVSCSEADRCYDSTDTYLMAKFIDSDS-------TTIDSLMIWGVAKNDTGWVRDTLPSRYPLPLSLEHDSTAFVLFVNGE----ADTLFIYHTMQMKLVSEACGFAPYYNLKGFSYTSR-IDSVNISDPSVKPNNEQNITVYFN. 157
334 5.000e-15UniRef50_A0A1G7L1D6 Uncharacterized protein n=2 Tax=Bacteroidales bacterium KHT7 TaxID=1855373 RepID=A0A1G7L1D6_9BACT  ali  25  1MHKVRKYSLRLILAMALTALWQSCSEID-YQLYHTSYCMMRFYNENGDSIAIS----DSLQITAEGTDSVLYAQGYGRKTISLPLSYSKNKDVFKFSFKNGSKVDEVSVTVTHDNWLHFENMDCAYHMI-TDIEVEPLDKQIRKASITKGEVTFDRTENIHFEYED 167
335 8.000e-15UniRef50_A0A1F3BSV4 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3BSV4_9BACT  ali  20  22.........................SDDQCNQTTESILKTRMFVSD--PSLISGKFLDSMSVYAPETDSIHHVGTSSTDSFSLYLSPYSDTTTFIL----ASKSMLDTVHLFYTRKLILLSQECGFVTHFNIKSFNYTTNNIDSVFLIENEITTDNDGYLQIYF.. 157
336 8.000e-15UniRef50_R7PA56 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:617 TaxID=1262933 RepID=R7PA56_9BACT  ali  28  11...........FCCFCILIFTIGCRNID-CPLENTVLVGSKLYYSDTD---VSNVTLDTLLVTALGTDSLMSCQKANLQ-MSFPLRYSLNNDTLLLSFMRNGQITTDTLYLEHTNTIHFENIDCPPAVFSELKTISWGNQQVDSASISSPIVNYNGTENIKIFHYN 167
337 2.000e-14UniRef50_C6X1V0 Uncharacterized protein n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=C6X1V0_FLAB3  ali  15  23........................SDDDICLSEATPRMKLKFKTQSSGK-LKTLDSLFVNVDYGNGQVPVIAARQK-TDSVFIPLRVDDPVTRIFVGLSRTSVPSE--IQLNYTTKSEYVSPACGIRKVYENVIGTVEVNEVTGLEQNQTQITDESKTHFFLLF.. 161
338 2.000e-14UniRef50_A0A0P0M2U5 Uncharacterized protein n=21 Tax=root TaxID=1 RepID=A0A0P0M2U5_BACVU  ali  27  1MKKLPAIILLL--LITVSTLMQSCGESD-CPLTTNSFAHFDFLDAETTTDVIVRDTLEDGTIKETVVKDSLMNDTKAESSMSLPLSYTS-KTTYVLHYTEK---MRDTITLIHQNIPYLQNIECGTMMFYKVEDIKYTTYNLKSIEIVNSDINNEEKKNFNIYY.. 176
339 5.000e-14UniRef50_C9PYN4 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=C9PYN4_9BACT  ali  28  1....................................................................................MSYTRDQDALFFLLKDTGHVVRDTIRVSKTNTPHFESVDCAMSYFHTITAVSTSHHAIDSVVLINPNVTYDTSSHFRIYFKS 84
340 7.000e-14UniRef50_UPI00094F62FA hypothetical protein n=1 Tax=Labilibacter aurantiacus TaxID=1849719 RepID=UPI00094F62FA  ali  17  18.....................VGCTSDDICLSGQMSATT-GFYLDSTSTQTTI-----NMRVEGRYPRIDSSRAETSTNSIFLPLSMETDSTVFELFKDGIGE----TVTFHHTKELAYVSEECGFIFHFTIESVDFTNTYIAEVEVADKEVSYNKTENVKIY... 152
341 1.000e-13UniRef50_UPI00047CCF9E hypothetical protein n=1 Tax=Eisenibacter elegans TaxID=997 RepID=UPI00047CCF9E  ali  20  3...............CIALCLSACREACPPVVTQEEQVRLLFFRKSAPTDTVASGLGSVLAIIADEPRSLPVQSVQGR--WLLPVHPTQTVVSYLISRNDI--ARTDTLTIDYNRTVYL---DCDFRNSVSIRSAKST---FDSLAIISTNISNDAQVHLHLYF.. 142
342 3.000e-13UniRef50_UPI000D6E611B hypothetical protein n=1 Tax=Reichenbachiella versicolor TaxID=1821036 RepID=UPI000D6E611B  ali  22  4.RMIPKSRFLFGLVLLSFSLVWACTQEPDC-DNERPYVSIGLYQAETETLTQIDTSMPIRWVKVFYEDSAYYSQDSGYFNFKVQLNPNSPEILVAIR------ELVDTLHLKYEKQLEWLSEECGPMHRYEELELTEST-TLDSVVINDPLVNFQVDENIRIFY.. 166
343 3.000e-13UniRef50_A0A136LL13 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium OLB12 TaxID=1619897 RepID=A0A136LL13_9BACT  ali  18  15.....................WGCLTEPDCFDTSTNLVTFAFYDADDELVEVEIDSLTISGVEG-----ILIPEDTIVSAISLPVNPTETQVAFTFYFGAVAE----TISFNYRLQTEVVSKNCGALAYITDLILVDTS--FENVTLLNNKLATNAGTNVKI.... 144
344 3.000e-13UniRef50_A0A256WKS7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_77 TaxID=1972459 RepID=A0A256WKS7_9BACT  ali  30  2.........................KNEICKPANN-LLISKLYTLDNTSELVEA-SIDSLTIYYVGADSLVYDNQKSVGEINLPLSDTATFLQVVVKMN----EFTDTISIDYKAIEVFRSVECGVINRYTINNIEHTKNKLWELYLYNNQVDESKEANIFLVFR. 136
345 1.000e-12UniRef50_UPI0008383AE0 hypothetical protein n=1 Tax=Vaginella massiliensis TaxID=1816680 RepID=UPI0008383AE0  ali  19  1MKFGIPRFALFL----GCAFAVSCLDEDICTPSAAPELTLELRNVE--TDEVFTDTLYYNQILGVDENGNTVYQYANHRKFNLPFVKDSANHPIVFEIYRRSDTQRDILTMRYELGQAFENTSCGGKIIFDNVNYQLADGWIKNVKPITKDISDNATVNLHL.... 190
346 1.000e-12UniRef50_F0NYG2 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=F0NYG2_WEEVC  ali  21  1MRKVVLPVIITILFWA-----SSCLDQDICTPSSVPMLNIELLNIEQPEEIFTDTLYYNLGKTENGEDTFVYPSYKKVYGKNLPLSFHQTDTKYLVYARDANRTTRDTLIFRYDIGQAFENSSCGAKVIFDNVEYSTSNYWMKELQP................... 174
347 2.000e-12UniRef50_A0A1B2Z961 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1B2Z961_9BACT  ali  17  1........................................................MQGFSVIAEGKTDSLFTNQ-SFNSISIPLNSLTTETSYIFKKNTTGNNNMATFSIVYDTEEAFVSRSCGYKIIFKNVAFSTDTNWITAFTPSTINLDDQSAAHVQIFH.. 113
348 2.000e-12UniRef50_A0A286G855 Uncharacterized protein n=1 Tax=Spirosoma fluviale TaxID=1597977 RepID=A0A286G855_9BACT  ali  18  1MR---PVFTLLLMAFGLSFALMSCEN---CGPSREPFLNLSL---------QLTTPAKIDTIYALDARNPLPKQPVSTSIVELPLNLNANQSRYVFQLN----GRRDTVTVFYRRSFAFRNQRCGYVFEPDGIPAKTTQGTVSSVSYWQN................ 140
349 4.000e-12UniRef50_A0A2T4WUD3 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WUD3_9BACT  ali  15  3..................................................................................................DDFQTGNFDIITANYEREDLYVSRACGYKDIFNDLTLTDTDNWIINSEILNTTIKNEITAHVKIFH.. 71
350 1.000e-11UniRef50_A0A1F3LVR7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_42_66 TaxID=1797351 RepID=A0A1F3LVR7_9BACT  ali  18  12MKKIVNLIVLLFL-------LAACEDVFNPPPKAFLNATLRYTDNDKNELIKNIE----VSVTGVAMEEPWIEQDTTR-SILIPLN-DTPATDYIFVLN----GVTDTIQIIADSKLIYESMETGFYPEFKILDILYTTRRIDFIEVKDSAVTKEW.......... 150
351 1.000e-11UniRef50_D2QTZ3 Uncharacterized protein n=1 Tax=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896) TaxID=504472 RepID=D2QTZ3_SPILD  ali  16  17...................VLMSCEN---CGPSREPFLNLSL---------QLPTPAKVDTIYALDARNPLPKQDLSTSAVELPLNLNANQSRYVFQLN----GRRDTVTVFYRRSFAYRNQRCGYVYQPDGTPARTTRGTISNVSYWQNRDGSSQQTHIELFIR. 159
352 2.000e-11UniRef50_A0A1Q3W7F3 Uncharacterized protein n=1 Tax=Candidatus Amoebophilus sp. 36-38 TaxID=1895716 RepID=A0A1Q3W7F3_9BACT  ali  16  1MRFLKIYYLFTAISLVLLLNFNGCRDLQDCRSIYTNEVWIEFKTKLEINKLKYHKPANKHSAYKKDKPGNEILNNLKDEKLRIYLHPKNNIVSLLFYKATAPKPAPDTLTIFYKRIFSLLSPYCGLQEEYIIGKVETTGNKIIKPALRNKKYETDQEENIEIYY.. 180
353 2.000e-11UniRef50_A0A2W5VCU0 Uncharacterized protein n=1 Tax=Azospira oryzae TaxID=146939 RepID=A0A2W5VCU0_9RHOO  ali  19  3.......ILFIACLAIITLICGSCFEKGDCVINNSNLLRIKFTNTKDKTAHPIK-----FTSIKVDSTSIVLYSGQEVSAIELPVNPSKTHTSFTISRADVPDV---TLNVTYTNKTIITSAECGAFIYQQ--GVKLENNPFEGTIVKEVNVQRNAAVNFEIFF.. 151
354 3.000e-11UniRef50_A0A1M3EB29 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 43-16 TaxID=1895923 RepID=A0A1M3EB29_9BACT  ali  17  14..............................................TRKIDIRDTALNRPSLTSLGMDTTIIFQGEGITNMFLFLNSDSSQIRYAFKR-SEDATLIDTLTISYDHYPQFISNACGYTYSYNLQSISSTQLNIKEAQIIDPNVNLSAQKNIVIY... 131
355 3.000e-11UniRef50_E4TT85 Uncharacterized protein n=2 Tax=Marivirga TaxID=869806 RepID=E4TT85_MARTH  ali  22  1MESIIKKSVVLLLITVIF----ACDVDSNCGSINVDYVTFSTVTLNANLEER-PKEVRFDSIFSPQTDSIILNDTVTISNFRLPLSPVENQTDFYFYYSINNAGDTDTIQFTYEKRNRVDSPECGIDMEF--FGMDTAFQTFDSLVIVNDTLKTVNAPNIKLF... 162
356 3.000e-11UniRef50_A0A090WLW2 Uncharacterized protein n=1 Tax=Algibacter lectus TaxID=221126 RepID=A0A090WLW2_9FLAO  ali  23  13....................................................................................................SDESNIDIITINYSRTEVFVSRACGYKTIYENVTVSDEDNWIESIQPSNQSVEDETETHFNLFH.. 82
357 4.000e-11UniRef50_A0A0M9DTD8 Uncharacterized protein n=1 Tax=bacterium 336/3 TaxID=1664068 RepID=A0A0M9DTD8_9BACT  ali  19  5.........LFFCGLLIIAFLSTCVKEQICADAVETPLTVNFKTRQGDSIVVKDTFVYVKDIRIKENNTIVYEASKTTDSITLKYNPLKDSITYAFSYNKNPTNQKDTFAFSYTRKIALSSPECGVRTDYANLQVKTS............................ 144
358 4.000e-11UniRef50_A0A2A4LWT0 Uncharacterized protein (Fragment) n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4LWT0_9FLAO  ali  18  1MKKYFTIILVFFLTIL------SCEKDDFCVGTTTPNLVIRFYNNDIQTD---VKKILLDSVWAIDKNGIEQYKNISIDSIAIPLNLNENSTTYIIENNSIKD............................................................... 94
359 1.000e-10UniRef50_A0A2E8N1R1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8N1R1_9RICK  ali  12  5..........LFIVIGVWLAIASCQEIKDCLESSTEYAWINFYEADSLEQYEKTVAFSVVTYSTLDEDTSAYD---TTTFMPLWLNSQSNEVHYLFETDSINYE----LTMLYTPHLRVYYDECEPVYSFKLDTAYSSD--FDSVVIVNKVLDWTVGSNVEVYF.. 158
360 1.000e-10UniRef50_I4AIF5 Uncharacterized protein n=2 Tax=Bernardetia litoralis TaxID=999 RepID=I4AIF5_BERLS  ali  15  14......LRIIYSSVICLPFLLSSCENCT-YISDNVQFAAISFYADDESEVTIDTTFNKIVGVFASTNETSLYDSTNQLKTFELPIFTREDTTMFVFTINAVRDTIQDTLTMKYQVNVEVLPPDCGYDEAISNLEIIY--HTFTDAEVIREELTDNPLPHIRI.... 177
361 1.000e-10UniRef50_UPI00056F28FF hypothetical protein n=1 Tax=Thermonema rossianum TaxID=55505 RepID=UPI00056F28FF  ali  16  3........FRYYLYTFGLLLLSACVELPVCSGAIEQNVQLKFQDLQGRDSLVTQDTALIVRQIAIEQSDSLFYVQDTTSTATLPLHPQRDTLLYSIDIEGMGLRR---LQVHYRRSAELVSPECGVKMNYRELSILQTD--FDSAYVSQD................ 146
362 2.000e-10UniRef50_UPI00029A8DE6 hypothetical protein n=1 Tax=Gillisia marina TaxID=1167637 RepID=UPI00029A8DE6  ali  7..................................................................................................DDTSEENIDVIDFTYARNREYINRACSFRVTYVDLDAKRQNNWIKRIVVEQPTVEDETSTHISIFH.. 78
363 2.000e-10UniRef50_A0A1F3JVK8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_40_13 TaxID=1797346 RepID=A0A1F3JVK8_9BACT  ali  16  15.........ILYFFIGLGLLFMSCSTESSCPGESISQLRIGFTRETDSTT-------NHFIVYHPLLADSIYDSIVAPKYVDVPMDVTSDSIDFIIAQTDSTSEITDVVAITYKSHSYIENLDCGVLMDFEIEEVYYTHNHLDTFYFRNKDINSEIVNHVEISY.. 169
364 2.000e-10UniRef50_I0K4R4 Uncharacterized protein n=1 Tax=Fibrella aestuarina BUZ 2 TaxID=1166018 RepID=I0K4R4_9BACT  ali  19  1MRRGHFYALLVLLADGLPACTPGCGPDAD----QEPRLTI--YVSSSSGQSLTARSV-ATSIRGVGLTQELLDQATSSVSFNVPYSLAADQTRYVL----TSATRRDTLTVNYQRVFSYKDDDCGY........................................ 125
365 7.000e-10UniRef50_UPI0004E26CE2 hypothetical protein n=1 Tax=Bacteroides TaxID=816 RepID=UPI0004E26CE2  ali  26  2.......................................MRFYNENGDSIAIS----DSLQITAEGTDSVLYAQGYGRKTISLPLSYSKNKDVFKFSFKNGSKVDEVNVTVTHDNWLHFENMDCAYHMI-TDIEVEPLDKQIRKATITKGEVTFDRTENIHFEYED 128
366 2.000e-09UniRef50_A0A0D3LLJ0 Uncharacterized protein n=1 Tax=Flammeovirgaceae bacterium 311 TaxID=1257021 RepID=A0A0D3LLJ0_9BACT  ali  19  1MVRKFKRLQWLVILPVIAFLCQGCER---CRSEELPMLNVRMQFQEEGRYILRSDLLETRLILSNEV-------------LQLPFSLTADTTVYDFLKMDGQVWR---LAIAYNRRTGFEDTGCGFFLEFINARVLPET-TFSSVQL................... 127
367 3.000e-09UniRef50_A0A1W6E571 Uncharacterized protein n=1 Tax=Fibrella sp. ES10-3-2-2 TaxID=1834519 RepID=A0A1W6E571_9BACT  ali  20  1MKQLYF-----LLFMGLVYTLTGCRKN--CGPSGEPNLRLRLVS-QGSLPITAIRALDALPNAAAIKLPTVIASPVSGTVYELPVNLTADKSRYELI----NASGRDTITVQYHRVFTYEDVDCGYIVN..................................... 119
368 5.000e-09UniRef50_UPI00047BF7D1 hypothetical protein n=1 Tax=Hugenholtzia roseola TaxID=1002 RepID=UPI00047BF7D1  ali  18  54.............LTLAGLSLTACQDCTF-ISDNLQRVRLEF---ATPLTQTARDTLLQAEIIGLVPGSLVEIGTSGRKTFDLRLFTRYDTTIYRFAA-LVDTIPDDTLMLRYRKQVVILPPDCGYDEAISDLEVLY--HTFDSVKILNTRLQVTNTTDIQIF... 203
369 7.000e-09UniRef50_A0A2B8A3H3 Uncharacterized protein n=1 Tax=Candidatus Nephrothrix sp. EaCA TaxID=2044729 RepID=A0A2B8A3H3_9BACT  ali  15  3............FFFPIVFLCAACLNDPDCLVATTNLASFNFKKADGKTDTLWIDSIRVSGYKTQFTINDQDAARRNVTGVRLPVYPGDAQTTYTYYYKKKKDKTQAVLTFSYYKNIKVISKKCGAFVFYENLSVKTTAGPVK---IVQPQLNTTVTSNAEIVF.. 155
370 7.000e-09UniRef50_A0A150ABD8 Uncharacterized protein n=1 Tax=Flammeovirga sp. SJP92 TaxID=1775430 RepID=A0A150ABD8_9BACT  ali  28  1MKRFLQLIIFTLI-------FTSCN---DCEYGSEPTMNLQFTH-DHTNHEGEYYPPDYDKVILAGSDSVLTFS----HSLKYPLSIVSDTTTLIF----SNNEQIDTLSIKYTRNFDFESKECGYTVTLSDFQ-NLKETTFDSVTIFTST............... 131
371 8.000e-09UniRef50_A0A1M5PBY4 Uncharacterized protein n=1 Tax=Chryseolinea serpens TaxID=947013 RepID=A0A1M5PBY4_9BACT  ali  21  1MKKAVWFTFLAAIAI-------SCLNNPDCFRLNNGEFGINFRVMGFGADNSVVDSATIVG-------TNIYVKSEIPSSIGLPLDPLLDSLKYNFYWEGDS---SDVLSLGYTSQIQFVSADCGERHVFGGLTVL--NYSFDSISVYSTTPTNPSSVNIQVF... 144
372 9.000e-09UniRef50_A0A1H6WKL8 Uncharacterized protein n=2 Tax=Dyadobacter koreensis TaxID=408657 RepID=A0A1H6WKL8_9BACT  ali  22  22MKKFLPLLFIIVVLYGCV----------DCGPQQELTVGINFHREKDSLHLNQVYALGALDQQIFNKQTEDFNNSRLFLTLAFPISLLADSTTYVFEFEN----RTDTLTLFYQRDFYYK-KDCGFVV...................................... 134
373 1.000e-08UniRef50_A0A090WP72 Uncharacterized protein n=2 Tax=Algibacter lectus TaxID=221126 RepID=A0A090WP72_9FLAO  ali  18  2..KYFKILFIPPIMILIVGITISCERDDICPTPTTPNLIIDLLDY---TDEDSSKNVFKLVVIGVDNDEVLSYEIVTSNQLVLPLKTTDNTTQYALINNYVLDDN............................................................. 104
374 1.000e-08UniRef50_A0A136NDW4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium OLB11 TaxID=1617422 RepID=A0A136NDW4_9BACT  ali  25  1....................................................................................MSQSEDYSKFIFQIDSTDFSITDSIRIDYNRELHYISTNCGYETYFEINNIEYSHQYIDTIIIASDKVNNDNTEHLKI.... 81
375 1.000e-08UniRef50_UPI000761C218 hypothetical protein n=1 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI000761C218  ali  15  18.............IALFMFSIAACRDNQECFDENNAFVVGTFLITEAGRETASVDSLFAITESEEGLRKIYYNDISETTGELLPLSPLTTKTTYYLFQKGYGTQ----LDFTYNTTPQFLSENCGVSFIFNNLEMIQDEQS-QQVLPNGQTVNDENQTNI...... 175
376 2.000e-08UniRef50_A0A1T5L7D3 Uncharacterized protein n=1 Tax=Ohtaekwangia koreensis TaxID=688867 RepID=A0A1T5L7D3_9BACT  ali  19  1MKYKLTRGLLSVIFISCLFTYSGC--VDECELDSEPTLFIYF-----------STEKYYRSVYGLHGKEKPVNQPADYQ-YRVPLSIKDDSTIVIFESD----VRNDTLTIHYSRTVEMQSARCGFRIYFDDFEI............................... 117
377 2.000e-08UniRef50_A0A1B1G1B0 Transcriptional regulator, LysR family n=1 Tax=Flammeovirga sp. MY04 TaxID=1191459 RepID=A0A1B1G1B0_9BACT  ali  24  1MKKQ------LFLLLCFSILLPSCEE---CGVSSEPKVSI--YNEDGRHLEDHFNKVEVLRNGK-------YESIEIIDYFSISL--VSDTTSFVFT---DIENNTDTLTISYERNFYFQSKACGYVLDIEDMK-SESQTTFKDVYIEH................. 125
378 2.000e-08UniRef50_A0A239ES40 Uncharacterized protein n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239ES40_9BACT  ali  15  1MKKLS--------IILIGLAVISCQDIENCTDDNLDFMILEFHDLESQSTRK------VGFVVTAEGSPYRFSLSEDSTFVALPLNPEDTITTFLFDSDTSHFE----VEMRYDPELSIFDPSCDPSITFNLDTVRYT---FDSLSIPGTVTNRQISTNVEVYF.. 145
379 4.000e-08UniRef50_UPI0004914A3D hypothetical protein n=1 Tax=Runella zeae TaxID=94255 RepID=UPI0004914A3D  ali  25  4.........ITFLSIILSLVFYSCEE---CGIDGEPTLKV-IYPSQDTLSLKSIKAIGSLS--PIPKEGIASYQQSGV--ITLPFNLTADSTTYIFEQ----QTKTDTLTVFYKKTVVNVSKKCGYI----IDIVRPENN.......................... 118
380 1.000e-07UniRef50_A0A1B1FVM5 Catalase B n=5 Tax=Flammeovirga TaxID=59739 RepID=A0A1B1FVM5_9BACT  ali  19  4.KNNLKRYVLSFLPLFIFLVTPSCRDCDA-FSNPSSYALGAFYDKNNPTTAVNITFESINGIGGANIPQL------SNQKILLPLKVTERQTGFSFI----TSGLADTTYIDYSTSVKVNGPDCGAFEQFTGLGVS.............................. 127
381 2.000e-07UniRef50_A0A1Q3GNQ6 Uncharacterized protein n=1 Tax=marine bacterium AO1-C TaxID=1905359 RepID=A0A1Q3GNQ6_9BACT  ali  16  1MKQFYYLQIILLIWL---FCLSSCR--DTCTGSTEPVLHLSFLDT-TTNRTVNPEYTRVYAVDGNNEIKANIDFDASTRHYTLPFSTLENQVTYIFERDNQP---IDTLIITYERVFRFDDDECGLGMTLNDVILSP............................. 130
382 2.000e-07UniRef50_A0A2E9G7X2 Uncharacterized protein n=1 Tax=Thalassobius sp. TaxID=1979401 RepID=A0A2E9G7X2_9RHOB  ali  21  22...............FVGLIVYSCS---DCEPISDPILVVSFYSKDSEELVLLDLNISSVSTLIEDADSIMSYDSLNEAQFGVPLPVDAESFTFYVNYPDTINRSTDTIAISFSRSFETVSPDCGFVTKYENITLDNTS--FEKAEINFDYTIDNDSTNVRVF... 187
383 6.000e-07UniRef50_A0A0B7IL89 Uncharacterized protein n=1 Tax=Capnocytophaga canimorsus TaxID=28188 RepID=A0A0B7IL89_9FLAO  ali  19  1MKKNWIIRIGASVLLLIFSVLTACEPDDLCEKVTTPRLILRLKDTDKPTKTKAAEKLIGLW......................................................................................................... 62
384 7.000e-07UniRef50_B3ESH3 Uncharacterized protein n=1 Tax=Amoebophilus asiaticus (strain 5a2) TaxID=452471 RepID=B3ESH3_AMOA5  ali  12  5..KFKPQYYSFVVITILLLGIMACRDFEDCRSIYINMAVVEFKGENELKISKIEYDNENPGKVPIKQ------AGSAKNQYIFYLHPRNNKVTLFFYKASDDSVRLGNLTIFYTRVASLISPSCGMQQEYIIDSVETS............................ 137
385 7.000e-07UniRef50_A0A2M7NDQ3 Uncharacterized protein n=1 Tax=Flexibacter sp. CG_4_10_14_3_um_filter_32_15 TaxID=1975530 RepID=A0A2M7NDQ3_9BACT  ali  17  6.......................................ISFYADADSKDTAFNKIVGVFTRTNEVMPTVLYDSTDEKRKIELPIFTRVDTTMFVFTINSVRDTVQDTLIMKYKVNVEVLPPDCGYDEAINNLEILYST--FTDVEVVQTELKEDNTPHIRI.... 136
386 2.000e-06UniRef50_UPI0003663E29 hypothetical protein n=1 Tax=Flexithrix dorotheae TaxID=70993 RepID=UPI0003663E29  ali  16  3.......IILKFGWVYIFLLFAGCNDCEPVADPGN-TLIVSFYEVKNYDDKLVRQKVPFLSIKEKDNDNILYDSLITTDNIALPMPFDKDNSTYEFVYDTLANLSPDFLEVSFLRKVIFESPDCGLIQQLSNIKLNSEYPSFEAGEVFIDALQSNDTTNIRIFF.. 197
387 2.000e-06UniRef50_A0A1W6E544 Uncharacterized protein n=1 Tax=Fibrella sp. ES10-3-2-2 TaxID=1834519 RepID=A0A1W6E544_9BACT  ali  20  4..RLICYFFYLLAGGACLWALIAC-KGSPCLQAD-PVIQVR-------VTSPTSQTLTNLTIIDLVSSAYTIKRRYTLEQFVLPLNLNARQTRYTFTLN----GKSDTLTINYALKLTYGDQECGYTV...................................... 121
388 2.000e-06UniRef50_UPI00030872D8 hypothetical protein n=1 Tax=Fibrella aestuarina TaxID=651143 RepID=UPI00030872D8  ali  21  1.................MLLLSSC--NPPCANEVPSLLV----DVMVPAGRQVQD-WQVLDQTGPARTFTTYGSTTGRQVLEFPLNLSASSTRYTVRID----GQTDTLTVNYAVRLANPSDKCGYSV...................................... 100
389 2.000e-06UniRef50_UPI00034C807B hypothetical protein n=1 Tax=Nafulsella turpanensis TaxID=1265690 RepID=UPI00034C807B  ali  19  159.........................SDNPCETFSTNQLESGFFNLEEGE--LVPARVAFEEISTVETDSVFTIGPDGGLPLLL--NPLGNRTTFIFEGSREND--TDTLQLTYTRTGSILSPECGLDIRYSQLEIAKST--FDSVSILNTELKSTEGLDVQIF... 288
390 3.000e-06UniRef50_UPI0006A981C3 hypothetical protein n=2 Tax=Persicobacter TaxID=59740 RepID=UPI0006A981C3  ali  18  1MKKSIF--FFLLMVGMTFLGLSSCDTCSDCPEQTNPYVVLNFFENQEGTPSVRLMA-TAYGILEDGSLSDEFGIEDSVTTMNLPLDMNTPRAKYRLE..................................................................... 95
391 3.000e-06UniRef50_A0A1M5WGB0 Uncharacterized protein n=1 Tax=Chryseolinea serpens TaxID=947013 RepID=A0A1M5WGB0_9BACT  ali  23  1MRMRIISVLLSVVFLSYLLTFSGCYR--SCFSEDRFVASVHF------ANHGQYTSVYGWDGEQPGKEIQIYDFSTEV-----PLTRKQNKTVLIFQSD----TRKDTLSIQYELTPKLQSKECGFY....................................... 110
392 8.000e-06UniRef50_A0A1Z9N9H7 Uncharacterized protein (Fragment) n=1 Tax=Flavobacteriaceae bacterium TMED208 TaxID=1986711 RepID=A0A1Z9N9H7_9FLAO  ali  22  1MNKLSFKIFLSLLFFVVFF---SCERDDICIVDVSPDLIFLMLDKENTNNRKTP---NGFSIRALGTQDILP--GIIGDSMALPLKINDNSVQ......................................................................... 87
393 2.000e-05UniRef50_A0A1H6YS29 Uncharacterized protein n=3 Tax=Dyadobacter TaxID=120831 RepID=A0A1H6YS29_9BACT  ali  20  1MKHLLPIILIL-----SGIFAQSC---IDCGPQ--AELSARIYFTGDSLKLDSVYALNAVSQEAIRLQTDNF-TPQHYYSISLPISLVSDTTTYVFRF----TERIDTLSIYYQRIFRYKG-GCGFIT...................................... 112
394 3.000e-05UniRef50_UPI0005632652 hypothetical protein n=1 Tax=Runella limosa TaxID=370978 RepID=UPI0005632652  ali  24  3..........FFFICALCYLLCSCGEQ--CGITAEPVAAIQF-------PFNTEASISKVSILGALQD-------VSNERVQFPLNLNADSTTYIFTQSN----RIDTLTVYYKKRIYNASNTCGYV....................................... 99
395 2.000e-04UniRef50_A0A2P8G5E9 Uncharacterized protein n=1 Tax=Dyadobacter jiangsuensis TaxID=1591085 RepID=A0A2P8G5E9_9BACT  ali  23  1..............MFISLLLLGC---VFCGPQQELTVVIR-------STNTLLDSAKVDSVFALNADSIGQLVSKNITGMSFPISLRADSTTYVYKYEGSKKT-ADTLTIFYEREFRYKG-DCGFVVN..................................... 105
396 3.000e-04UniRef50_UPI00029B2AA5 hypothetical protein n=1 Tax=Gillisia marina TaxID=1167637 RepID=UPI00029B2AA5  ali  14  4.KKIKLLRASGIFLLLVLLVNLSCQKDDICAESTTPLLKISFFDAEADSDTI-PKPVANLTIR....................................................................................................... 66
397 3.000e-04UniRef50_A0A2W4P1W0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2W4P1W0_9BACT  ali  18  278.............................CPE--TNLIRIDFRDQ--PGDDGQRVAVELDGITTDYSPEVLYAD-TAVNSVILPLNDQADVTRFTFEFESGSVD----LEVGYTRTPVVLHKACS-RFTISGLNIVSSGFATDPEVIEDETSFPVNTTNLAIFIPD 404
398 1.000e-03UniRef50_A0A1T5LM57 Uncharacterized protein n=1 Tax=Ohtaekwangia koreensis TaxID=688867 RepID=A0A1T5LM57_9BACT  ali  20  292.............................CPETNLTQVVFR------RPGTTTATAVHIKSITTNYS-SDIYYAGDTTSTVKLPLNPSANSTQFIVTYTEADRA-ADTISVSYTTTLDTLFPGCGPQVIYSDLVNLLEGG--DTDVLITNDVKFPAVTNIAV.... 416

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.