current user: public

If you have questions about the server, please let us know.

Query: PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217], from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# E-value Template Links and tools%idFirst MNTETLTYLLEHPDKITSEETTQLRTVVEEFPFFQAARALHLKGLKNEDSFLYNTYLKKTAAHTQDRTVLFDFITSEIFNQTAISAQIKAQEDHLRNMPVHEFVDVSSEMEAEELQKANRVLDPEFFVRKEASEETQPEEQLQLGKPLDFNKAETHSFSEWLKLTAFNKIDRSKEVKETISASASDKTEASSENTIIEETASETPLELETTIPSIEVDQDPERARRLELIDKFIESNPKIKVSTPDSNFKKPNLEDRFQPSDSLMTETLARVYVEQKNFSKAKQAYRILSLKYPEKSGFFADQIRAIEKLQENLast
1 7.000e-42UniRef50_A0A2W7NVI7 Uncharacterized protein n=1 Tax=Cytophaga xylanolytica TaxID=990 RepID=A0A2W7NVI7_9BACT  ali  22  1MNRQQFYHYLSNPEGLNDESLSNLTAVIAEYPYFQAARMLLVKNMAVLDHIRYNHELKSAAAYIPDRKKLYFLIHAPTQSKAAKPFVEAVVQQRVSQPVVLDEPVKPD-------------VSVEVSASPVDYFDVPDTLESPSGEVITFSFTSELVQEEPEQMVLPSADLLDYELQNLPGYQLAVQEPEDFDPSQSRSFSDWLKALHHHSVQTQRVETPKPVSRQMDIIDSFLKQGDKKIIPKPKVADERDVAENSLRESEDLMTETLANIHIKQKHYDKAITIFEKLSLKYPEKNIYFASRIQELERLINN 300
2 6.000e-41UniRef50_A4CJB4 Uncharacterized protein n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=A4CJB4_ROBBH  ali  34  1MQVPDFTYLLQQPGKLTPVQTRQLEEVLKTYPWFQAARALHLKGLRNLNSYKYNQALKVTAACTADREVLFDFITSEAFLQNEIADAISDREIESEEVAPEPGRDAGMVDEGEDGALPRSTAEAEQILDPKLFRSKDPEVDRELEADRVAAREKLGMGRPLDFHKGERYSFSEWLQITSLGPGKRKEPTTPAAGDEDAASKAPGGDAASPANPDPKPAEDASRKQKFDRIDRFIRDNPKIVPQAAAEAEKVNISQSVKIDKEELMTETLARVYLEQGKHKKAIQAYRILSLKYPEKSGFFADQIKAVEKLRKD 320
3 8.000e-41UniRef50_A0A1A7QSM3 Uncharacterized protein n=40 Tax=Bacteroidetes TaxID=976 RepID=A0A1A7QSM3_9FLAO  ali  35  1MNKQEFTHLLTHPEELNTVHTANMGDIVARYPYFQPARALHLKGLRTKESFKYNQELRITAAYTTDRSILFDFITSDAFNQNEISNLIKQNTELLKGIEIKDANDISVGKSVTIDDVLKQQIEDSAGVLDPNLFEEKPVSTTNPSEESHINPNVDVKNIQSSPEEQLNIGKPLDFDKNETHSFTQWLKITSFKPIERETEEANNDMETQPEASLQEPKLESALERKFDLIDKFITSNPKIAPVKDVKPTI-NLAQTQLVQNDSLMTETLARIYLEQKNYDKAIQSYRILILKYPEKSGFFADQIKAVKQLQAN 314
4 6.000e-39UniRef50_A0A2T0XLK6 Uncharacterized protein n=2 Tax=Marinilabilia salmonicolor TaxID=989 RepID=A0A2T0XLK6_9BACT  ali  23  1MSRIRLIDYLSHPDKLDEKSLDTLREALDAYPFFQAGRMLWVKNLYQLDHIRYNNELKLSAAFIPDRSKLFFLINDAFSSLSTPEDEDEEVQDAAVSPDVTASGGNTADEELVLPDKPEETDDSETSSGNLVDFSLSRSEDNESLTEQPEEAAGENQSPAEADFLDLEKEVISSAYSLETVVPPDEPDFSTPHSFSEWLDLMKYQSAESSSPVKEQDTSGIKKPGKMDLIDNFLNSQKRIVPKESGESSNEDFSARSVVESDDLMTETLANIHIKQKRYQKAVEIFERLRLKYPEKSVYFARRIKEMEDLINN 337
5 9.000e-39UniRef50_A0A2E4HE45 Uncharacterized protein n=1 Tax=Cytophagaceae bacterium TaxID=2026729 RepID=A0A2E4HE45_9BACT  ali  51  1MNTKTLTYLLEHPEHITTAQTSQLRSVIDQFPYFQSAYALYLKGLKNQESFSYNKALKRVAAATADRSVLFDFITSALFNQNDISEQIKSQEQRLRGMTIQDIHDVSEQLKTEELAKADQILDPALFVAKENSEMTAITPEETLKIGSPLTFDARETHSFSEWLRFASFKPIDRSKQQANDQQAST---------------------KKVLPAVGATPSALSRKQKRQIIDSFIETNPKINVSPSVTTPKKNIAKERLIPSDALMTETLARVYIEQKNFKKAKQAFRILSLKYPEKSGFFADQIRAIEQLEEN 292
6 1.000e-38UniRef50_F4B2Q4 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=F4B2Q4_DOKS4  ali  48  1MTTEQYTYLLEHPDQINTEQTSHLRTIIDAFPFFQSAHALYLKGLKNQESFAYNKALKRTASHTADRAVLFDYITSEHFLQTAVSTQIKDQEKQLRSLEVTDAQDVSILVEQEEQAKASQILDPDLFVEKKDSIMTRAKAEHTLQVGKPLPFTKSEAHSFSEWLQLSSFQPID--------RSSTSDDKEVPAPTSTKEVVIKKETTTASKSDNEETTTKVSRKRKQQIIDSFIETNPKIGNIKSIPADKKKTKKEFLFSSDALMTETLARVYVEQKNFPKAKQAYRILSLKYPEKSGFFADQIRAVEQLEE. 304
7 2.000e-38UniRef50_A0A1F3D6F8 Uncharacterized protein n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3D6F8_9BACT  ali  21  1MNRNDFLNMIGSRVRMNRSMLGEVYELVDLFPYFQSAHMLLLKGLRDNEDVKFEKQLRSSAIHIANREVLYYLLKNDTSAITAGNAIKSEPESDSLSESSPETQQTVIESAGNSELLISAIEMDSEKPKDENHNIDSEALSQGHSLLMPATSDNDDSEGVVLFIEENDQAEEYKIFYMDPGFSVSENADLLELDTEDSDNEKLTGEFERGDDKKEDDKIVIKKQLQAELIDKFIITNPRIEPVRDKNHSVEDLSKPHIEEKEGFVTETLARIYINQGYYSKAIEIYEKLSLKFPEKSSYFAAQIEKVKDYIK. 313
8 3.000e-38UniRef50_A0A1I1K8Z5 Uncharacterized protein n=2 Tax=Flexibacter flexilis TaxID=998 RepID=A0A1I1K8Z5_9BACT  ali  22  1MNKQEFLHIITHPSDISPKEAEALEEMTVNFPYCQLAHVLLAKNAHDKNNMMALQRLKTAAVYSASRTALKNLIYSENQWHSSPSRVLESMFALVPENNEEAAAEPMPLPYTEPNDSFTPLSLEQEISEVASKWSSNIAENEPVVPVANTTEAVPET---NKPVENSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQETPTPSTDDTAGKGVAFSEKPDRKAQIELIDKFIVSNPRMPQANDMVSSLGDLASDSSRIDETLVSENFAVILTRQGKINKAIEIYRKLILKYPEKSSYFASRIESLEKM... 310
9 2.000e-37UniRef50_A0A1H3WCH7 Uncharacterized protein n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H3WCH7_9FLAO  ali  35  1MNTSEFTYLLQNPAKVNAPQTDALKGIINTFPYFQSARALYLKGLKNADSFKYNQVLKTTAAYTTDRSILFDFITSDDFEQNKISEFIKHHKLDISDVFVATNTATKKTDSKGFSDEELQEEISNTTQVLDADFFQPVSKSEKEASAVEGNETATTDNVTAKKEPLKFNKNETHSFNEWLSLSKFSPIDRENEAVSQEKTSNKVEEAPIETEKKEENSESLDKAKKFELIEQFIAKKPKLKAPATGTS-HHNIAQAQMIQPEALMTETLARIYVEQGNYKKAIQSYKILILKYPEKSGFFADQIKAIKQLQE. 325
10 1.000e-36UniRef50_UPI000780DE37 hypothetical protein n=1 Tax=Aquimarina longa TaxID=1080221 RepID=UPI000780DE37  ali  33  1MNTKELSYLLQNPAILNKEQATALEKIILTFPYFQSVRALLLKSLKDQESFRYNQELKTTAAYTTDRSVLFDFITSDLFKKNVNSKEEKKHTSDIKVIDPEEIRALPRMDMDDAVRMKITEAEDVLDPYLFSTKKEDNTLKQSEIKKTKTPEEILKIDRPLDFNKKETHSFTEWM------------------KLTSLTPVDRNIDQERTENNEGNLNKLLDKKDKFNLIDEFIANNPKIQPAAKNAPT-RNIAKENPITEDELMTETLARVYLAQKNYKKAIQAYNILILKNPKKSGFFADQIRAIKKLQEN 294
11 2.000e-36UniRef50_A0A2P8CI96 Uncharacterized protein n=1 Tax=Prolixibacter denitrificans TaxID=1541063 RepID=A0A2P8CI96_9BACT  ali  23  3MNREQMMRYLDEPTQLNEKSLGELKEILDEFPFFQTAHMLYARNLLNEKSFRFTNQLKVAAANVTDRSMLYFLLHPKARHEA------------------EVYEPKQETADIEMPPQSVATSPEEEKTGTATEEDEGFFELAEDVTHAHPEKESPVDDHSNTTDDEEGVAQKPPQKSFDLLDFDVMEPSFYQLDEDVTSIKGLSDLSKSINRNAKKDNKPEKEEAKDNLIDKFLETKPTISPAKKGDGQQEDISERSAEETDEFMTETLAHIYVKQGYYEKAIKAFQKLSLKYPEKSIYFARQIEDVRKLLN. 296
12 3.000e-36UniRef50_A0A1G5I3R5 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1G5I3R5_9FLAO  ali  35  1MNLTEYIYLINKPEAIHEKQTAVLEKIVQEFPYFQSARALYLKGLYNQNSFKYNYVLKVTAAHTCDRSVLFDFITSDTFTSEKAGQEPEPSDIPAEIASEIEPMVLSKAADEEDDWKDPTAIEVVETLEIEAPKEFVFEPVADVPVVSSPEEEIVIHAPEIDQPAQNLELGKPLAFARDERHSFQEWLQLSQFKPIDRNQPEPTPDSEPSADESTFSDSDLEKQKKNELIDRFIETSPRIPPVKHDAPLTASMIEPSMDDKTFLMTETLARVYLEQKKYNKAIQAYEILILKYPEKSSFFADRILDIKNLQQN 357
13 3.000e-36UniRef50_A0A257JZ64 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A257JZ64_9FLAO  ali  34  1MNVSDYTYILNKPDAVSDRQTMVLERIVHEFPYFQSARALHLKGLYNQDSFRYNQQLKVTAAYTTDRSVLFDFITSGNFKALQQQFFDEK-------------------------------EAAINEIMVNEMEVVPYAAVPEIKIDTLEQSILDSIKEASPTTGDEEKPSEAEAVAQKLEIGKPLEFSGAEKHSFGEWLQLAACKPIERENQPAETGLEEEKKKKIEIIDRFIEANPKISPVKDHVPTPA-VSTFENSDTSALMTETLAKVYLEQRKYSKAIQAYEILILKYPEKSSLFADRISDIRILQQN 281
14 3.000e-36UniRef50_A0A1V6JBB3 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6JBB3_9BACT  ali  20  1MTRTEFIEFLRNPEKISLSSIHELSELTILYPYCQTAQMLLIASLKAKNDIRYFDRLKVSAAYAGDRSVLRKLISIIETFIPLTCETKSSENQPAKTFSENINPNLPFIPLRPIETFVPYDAAXXXXXXXXXXXXXXXXXXXXXKIQADKLAREALTYDEKFHSSSSGSPSHTSAISEITSNSSEEL----VNEPLENNSLSSNLETSSREENWTAPTINEGLQSKMDLIDRFIRDEPRIERKRTSFFNPDDLSEKSNTFTEDIVSETLAKIYAQQGKKEKAIEIYKKLSLLNPEKSAYFAGQIQNLEK.... 305
15 3.000e-36UniRef50_A3U4Q9 Uncharacterized protein n=1 Tax=Croceibacter atlanticus (strain ATCC BAA-628 / HTCC2559 / KCTC 12090) TaxID=216432 RepID=A3U4Q9_CROAH  ali  39  1MNTTEFIALLQQPSKLTASQTRALEAIVEEFPYMQSARAMQLKGLKDSESFSYNKELKTTAAHTVDRSVLFEYITSEEFSQNEIANTLQSRDDYLRNITVFEPEEVITQKSVAIDDAIKMKLKEAHQVFDEDLFELPAKPLKKAPKEEDLSADEAVKVNQASEEEIKDKLQIGKPLEFDKSESHSFSEWLQLTAVKPIDRSSETLENPVSDSKIGNRAESDEKAKKFELIDNFIASNPKIVPKK--TPLNANFLKDNEVPQESLMTATLARVYLEQKNYKKAIQAYKILILKNPEKSSFFADQIREIETLIE. 310
16 3.000e-36UniRef50_A0A0M8MDA3 Uncharacterized protein n=11 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0M8MDA3_9FLAO  ali  34  1MTTKDYTYLLNKPYSLHDRQASDLESILAEFPYLQSARAIYLKGLYNKDSFRYNTELKKTAAYTADRSVLFDFITSEGFRSIDRDVLEEQEKAISEITVDVEETTVEPTPALSPVEKLEQSIKSLIKESETEAAEPQIEAEPIQEQEITKAETVTQPEPEPVKHEAEEQTAEETIGKPLAFDAAETHSFAEWLQLSRL---------KPIERQPEPTDEKNPLDEKLNLIDKFLEATPKIVPVKNDPSPWENLSRTTTEAPG-LMTETLARVYLEQKKYAKAIQAYEILILKYPEKSVFFANRISEIKDLQQN 303
17 4.000e-36UniRef50_A0A1P8RV33 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1P8RV33_9FLAO  ali  38  1MQINELTYLLQHPEAVTAAQTDALMAKINEHPYFQPLRALYLKGLKQKESYKYNNALKVTAAHTADRSVLFDYITSEVFNQNEISNQIKQNLEYIKSIDVNEVDDISVNKSVTIDDALKEHIKATEGVLDPNLFEAKPTKILKVETPKIEDSIIAVDVKNITPEEKLNIGKPLEFDKNESHSFTEWLKITSFKP--------IERTTKAKILNTQKEDTTQPLANKLDLIDKFISENPKIKPVTSNTPKP-KLVNNDNDVSDSLMTETLARIYLEQKNYDKAIQSYKILSLKYPEKSSFFADQIKLVEELKDN 304
18 4.000e-36UniRef50_A0A239DHM2 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A239DHM2_9FLAO  ali  47  1MNTQAFTYLLEHPENISSVHTSDIRSLIDDFPYFQSAHALYIKGLKNQESFTYNKALKVTAAHTTDRSVLFEYITSDVFIQNEISTQIKQQETHLRALQVENLQDVSLQVQEEEQEKASKILDPNLFVEKKDSEITKRSPKEILSVGKPLDFDQNEVHS----------------------FQEWLQLSRFSPIKREKPSSEIIKKDTLPKPTETQNTDTNSKKRKQDIVDSFIESNPKIEFSPTTAPPKKNLAKESLIPSEALMTETLARVYVEQKNFKKAKQAYRILSLKYPEKSGFFADQIRAVEQLEE. 290
19 5.000e-36UniRef50_I0WIC0 Uncharacterized protein n=21 Tax=Flavobacteriaceae TaxID=49546 RepID=I0WIC0_9FLAO  ali  35  1MNVSQFTYLLQKPETISAEQTRELEIIIREYPYFQAARALQLKGLRLQDSFQYNQTLKTTAAYTSDRSVLFDFITSKNFEQHEISKKIAEQQLQLKEIEVDSEEIRAIHFDTSEDRIKEAEAILDPDIFQPVLSKATEELQNLKDEENMGVASSENNIGSTPESILQLGKPLTFTSEERHSFTEWLQLTRIQPIERETETTTNNVQSGSDE-----------KEKKFGLIDKFLKTNPKIEP-KVDNSPTINLAKEFLVEKSQLMTETLAKVYLEQKKYKKAIQAYQILILKYPEKSGFFADQIKAIKKIQQN 301
20 1.000e-35UniRef50_A0A1F3MBN9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_49_14 TaxID=1797354 RepID=A0A1F3MBN9_9BACT  ali  21  1MNPEQFIECLDHPEKLDDTSIVRFSEIVREYPFCQPAQLMYLKSLQNEGNIRFNRQLKITAAYAPERRSLFELLHVTKRDETEPEARPEPIPTQAYQAKPTDYVSYAPTPPQPDAEEEFLPLNDLDLLLFDFPISRDNDHPDPESQRKTPPYQPGSFGETGESSDDVTSRDLISEFLLLDPLSQPRITEPVVFPPVRIKIPAQSEAQPLEETVARDPKTARPQKKGSDLIDTFIQAGSRVLRPDNEPLSGEDRSLDSLREDEEILTDTLAKIFVQQGYFLKAIHSYEKLSLKFPEKSVYFASQIEMVRELIKN 333
21 1.000e-35UniRef50_UPI0006469CB5 hypothetical protein n=1 Tax=Alistipes sp. ZOR0009 TaxID=1339253 RepID=UPI0006469CB5  ali  20  12MDAREFVDLLDNPQNITPKLLEDLSRVVKQYPYFSTGVLAYLKGLKDADDPRFSSFLPYAATHAQSGEWLYLFLNSSSDYFGEEIVSTAVETVISENRFTEELAPELTSDAVVEEQNEVETSPEPDQVLEHESLTEETELEVQLQNEGMPQEEEAVLVEDANVAPVPEPVAIAEPDVVEEEEILELIDDDIDESRLNEDPIFEILDQKLYTLDE----TANTLEVQNSLIDQFLTTNPRITPKGELPPVIEDISVKSLVDDGEIVTEMLAKIYAGQGLIAKAINVYEKLILKYPEKRAYFVAELEKLKE.... 316
22 1.000e-35UniRef50_C2M5K7 Uncharacterized protein n=6 Tax=Capnocytophaga TaxID=1016 RepID=C2M5K7_CAPGI  ali  27  1MTAAELSLIMKQPNHITLSQVYELENIIHEYPYFQVVKAVYLKILYAQESYRYNKELKITAAHIGNRTLLFDFITSSSFKEKKDFFKKSSMPKTYADEAIPSEFTTYVTGDAFERKEYYPIENRNASSVRTEQGEQTEQNDIKGSFVPTSEQTRGEEEALQMGKPIEFQKADKHSFAQWLEVTRYKPIDRRVHATASVDLPFVD---------KNIFEEGDARAKKFDLIDKFLESNPKIEVNKDYDTPNAVEIVEKKDIGRQFMTETLAKVYLEQGKYSEAIQAYQILMLKNPAKSGYFAEQIAIIRKLQQN 304
23 2.000e-35UniRef50_W7XZC1 Uncharacterized protein n=3 Tax=Marinilabiliaceae TaxID=558415 RepID=W7XZC1_9BACT  ali  21  1MNKTQFGDILKQPESLNKDTLRGIKEIIDEYPFFQIGRMLWLKNLHKLDNIKYNSELKNSAAYIPDRSKLFQLINAIGQTVS------ETKQAETVENKMIPEVVEHDSSKEAEEHSKDKQSSLTLTDNYLNASDDFSDDDGTIYNFAAKQKVPAEEKNEVQDIVLPAADLLDYEMSSSSGYTLPSIEEVKDVHSEDNRSFSDWLHIMHYSSPPKKTEEPERKNKGMELIDNFLNSNPQIVPDPAKKPKEVDLAEKSTHTQDDILTETLAKIHIKQGHKNKAIAIFEKLRLKYPEKSVYFARRIKELKE.... 303
24 2.000e-35UniRef50_A0A163D2Y6 Uncharacterized protein n=18 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A163D2Y6_9FLAO  ali  34  1MNTKELTYLLKNPAQLSKEQAYSLEKISREFPYFQSIKPLLLKTLKDNESFRYNQELKTTAAYTIDRTVLFDFITSDLFKKNNDQNVTPKKTKSDIDVVDPTEVKVLQRMAMDDAVRMKIKEAEDVLDPALFAARNEESLLNQISKTEEIASEANEEKKSKQESKTTEQILGINKPLDFDKKETHSFAEWLKLSSL----NPIAPEPKNSETEKKEDKKLLDQKDKFDLIDEFIASNPKIKPAIKNAPT-RNLAKQNVVPTDELMTETLARVYLAQKNYKKAIQAYNILILKNPEKSGFFADQIRAIKKLQEN 308
25 2.000e-35UniRef50_A0A2N3A8C2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-1 TaxID=2013677 RepID=A0A2N3A8C2_9BACT  ali  22  1MNKTAFIKLMRDPELLGKETITDLMDMATQFPYCSSIHALLAMNLFKENHILYDSQLKMAASIIADRNILRFHITKIGRLKIKISLPDEYSKSNDNAKDQKEKASSTAKPEANTEAEAVPSAAESTLKKTTEDETEATPSMAVPEGKVKDDKNIEKIHSDNGDQTKSMFAVETDSEEIHQTIVSESFIDEIDEDEILRRKSIEELKIEEEKKNAINEKLDDSNANKIDLIEKFIRENPSISRPKPEFFNPVSVAQQSIVDQENIVSETLATIFVNQGHFDKAIKIFEKLSLKYPEKSSYFAALIEETKMKKNN 322
26 2.000e-35UniRef50_A0A2G6F615 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G6F615_9FLAO  ali  35  1MNTSEFTSLLINPDMVTVAQTNQLEDIIESYPYFQAARMLHLNALKKQHSFKYNLFLKKTAAHTCNRTVLFDFITANSLHVSNPIKDQKRFIASKDVVDAEVIDQSTRLHENIGTHQEVLKTKKADTLE---------------------------------EVKEKLEIGKPLAFDRDELHSFNDWLQVVNLKPISRSAEEKQTVHKQKEHQKTTETTWAKKKKNFELIENFIKTNPKIRPQKDVA--KGNIAGESSQENKDLMTETLARVYLEQKKYDKAIQAFKILSLKYPEKSSFFADRIKAIKFLQKN 278
27 4.000e-35UniRef50_A0A1M6A6P3 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6A6P3_9FLAO  ali  34  1MNISTYTYLLANPQKITPEDLTELDILVQKYPYFQSARAIQLKGLKNQDSYRYNEALKLAAAHTTDRDILFEYITSEKFIQNEISQTILQHDTSVMEIDVVSEDVSEEIRVEQNKEWQVEREKADAILNPNLFQRKIESLVNFGANDDSASKKSNELSEKPLEIDKPLEFTKKDTHSFSEWLKLTKAKPIERSVEAPKQQDAENESSTNSNKEAVLAEEE--KERKFELIDKFIQERPKITPIPAPGNTPEPSQKQTVKDSDSLMTETLARVYLQQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKSIN. 322
28 5.000e-35UniRef50_UPI00055CC64C hypothetical protein n=1 Tax=Prolixibacter bellariivorans TaxID=314319 RepID=UPI00055CC64C  ali  24  3MNREQMMRYLDDPTQLNEKSLGELKEILDEFPFFQTAHMLYARNLLNEKSFRFTNQLKIAAASVTDRSMLYFLLH--------------------PKAREEAETRKKVAEEIPQMTISPEPDIADKDTQDEGFFELADESSHTPPVKESAVEDTTDATTEKDHIPSKRPQKSFDLLDFDVMEPSFYQLGEEVKSIEGLSELSKSINLNAKKNNPTQEEQPEKGGLKDNLIDKFLETKPKIAPAKKGDAQHEDISERSAEETDEFMTETLAHIYVKQGYYEKAIKAFQKLSLKYPEKSVYFARQIEEVRKLLN. 294
29 6.000e-35UniRef50_A0A2T1NEF4 Uncharacterized protein n=1 Tax=Mesoflavibacter aestuarii TaxID=1266046 RepID=A0A2T1NEF4_9FLAO  ali  33  1MNSETFHYILQNPNRLLEEHVVDLKQIIDDYPYFQSARALYLKALKLSNSFKYNHNLKVTAAYTSDRSVLFDFITTKEFNQNSISENIKLNNLRLHDITVDFEDVSAKTKTDETEFLNHLTASKAVLNSDLFEEKSDKEDNTTKQELSSIESIDNNSSSNEPKDAEAKLKIGSPLEFDKNETHSFSEWLSLSKAEPIKRITKNKVEETQGLPEKKPSRIERSIAKKNKLIEAFIAKNHKLEP-KKNAENTVNLAKAQMIPREELMTETLARIYVEQKNYKKAIQSYNILSLKYPEKSGFFADQIKAVKQIQE. 313
30 6.000e-35UniRef50_A0A0E9LRW3 Uncharacterized protein n=3 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A0E9LRW3_9BACT  ali  22  1MNKQQITTALGQPHGLNEQTLDQMREVLDEYPFFQAGRMLWIKNLHLLGHIRYNNELKLAAAHIADRSRLFELLHAPEIEAITEKADSADVVVLPSDDQTSEPDQNKTLEDFIETEDDYFGADEDFKTESGDSLRFTRSFEEEQEDDEEEIRYAFPDETENIVLPSADLLGYEMPETSPYRLSDNESANWDEAHSFSGWLSVLKNQPAPMPPSEVNPEVEENGGKKRSLIDHFLESGMKKRRTPDKKDEIVDISAKSLQENEDLMTETLANIYIKQEHFFKAIDIFERLRLKYPEKNLYFARRIKELEEHINN 323
31 6.000e-35UniRef50_H2BZ10 Uncharacterized protein n=13 Tax=Flavobacteriaceae TaxID=49546 RepID=H2BZ10_9FLAO  ali  41  1MTAKELTYLFENSASISSEDTERLESVLHKHPYFQAVHAIHLKGLYTQNSLNYNSALKKTAAYTIDRSVLFEFITSRDFIQDKVALQIKKQEENLRDITVFEPQEVFGNKSILIDDAIKMKKNESERVMDPNLFERPAQKPLEEDIPKENILEEIPEAGSPLDFNASETHSFSEWLAITRAQPIE-------------------------RENENTQSISDSKSRKFDLIDDFISKSPKIKPNNPSTSN--NLAADRGVPAEALMTETLARVYLEQKNYKKALQAYKILILKNPEKSGFFADQIRAIKKLQEN 286
32 6.000e-35UniRef50_A0A2G6F0Q3 Uncharacterized protein n=1 Tax=Flavobacteriia bacterium TaxID=2044941 RepID=A0A2G6F0Q3_9BACT  ali  35  31MTINNFTYLLEKPSSINYQHTNDLESLVQKYPYFQAAKALYLKGLKNQNSFRYNQNLKLTAAYTTDRAILFDFITSGVFNNYSQFQEEKETIETISHIDQKVEEQLLVEPDHNSPIIENKEEEPEEEVNSETGVSDDDVSDEALNFELSDNDVVSTTEAHSPKHFNKGE--------------------------LHTFNEWLQLTSFKPVDRSLGSEQDSKLKEKMELIDEFIVKNPKIEPVKNPVTPPKQVAEK--FDNEDIMTETLARVYVLQNKYNDAINAYEILSLKYPEKSGLFANQIKHIQILKK. 314
33 1.000e-34UniRef50_UPI000248FC9E hypothetical protein n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248FC9E  ali  32  1MKADTLIAILKNPQQLQLSDLSMLTEVIDNYPYFQSARAVQLKGLKDQGSYLYNQKLKETAAYTTDREVLFNFITSKSFTITTASTTVEDSTTSNEPSPEEIESSTEAVTTEENELTTKEGVIKMTPEEASQIVDPLLFEAKSNTTSNIASAEEILEPNKPFEFNKKETHSFAEWLR--------------------------LTTTQPINRTEIPTTKTKKKHIESSLIDAFIKNSPKISPINK-SAPIVNLAKRHITPADDLMTETLAKVYVAQKNYKKAIQAYKILILKNPEKSGLFADRIRAIEKM... 283
34 1.000e-34UniRef50_W2UKA4 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=W2UKA4_9FLAO  ali  37  1MNVSDFIQVLQHPEELNTDHFAALEKILDDYPYFQSARALYLKGLKDQDSFKYNSELKKTAAYTTDRRILFDFITSETFQQN------------------------------------------IVAEKLFTHSVSQIDVADHEEIKLRDNETFGFKESDADAVLDPELFKPKDPTSKKKLKIGEPLDFNENEKHSFNEWLKLSSYTPIVREKTSTKKKKNPLKNKLDLIDKFIENNPKISPVKEFGNS-ANLAKENQVEKSELMTETLARVYLEQKKYKKAIQAYKILSLKYPEKSGFFADQINAIKKLQQ. 269
35 2.000e-34UniRef50_A0A2D8LNW8 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2D8LNW8_9FLAO  ali  35  1MNTATFTYLLANPQQLNDQQLADLETVISKYPYFQSARALQLKGLKNNDSFLYNDALKLTAAYTADRDILFQYITSDAFVQDKISEAILQHDASV-NELEVEIEDVTEQTALELDKQLKNELKKAEAILNPQLFERKIASVKEISEEANKTPEPEAQIPNEANDSIEVTTHSEEIEPDAPLAFKKQDTHSFSEWLQLTRAQPIDRSEEKEEAIAQTPSQDEAIEKKFELIEKFIQDKPKLE-VSAQPTKQVDLAEPYTQTPNALMTETLAKVYLQQKNYKKAIKAYEILILKNPEKSGFFADQIRAIKKL... 308
36 4.000e-34UniRef50_A0A142L5Y2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium UKL13-3 TaxID=1690483 RepID=A0A142L5Y2_9BACT  ali  23  1MNKQEFISLIEQPEQLGKSNITALKQVVADFPYFQAAQVLLTKALYNDHHYEFEKQLKHTSLLVPDRTVLFRYIHNLSDQQQPTEIVVPETFLSLPEQPIENAPLPSTEITTPQEIVAEKPEEITISVEDIVAKNNIEEKPQVEEAPVVIEVIEDVTVVEDRVSETISNMENRVAEENVQEVKSSEIHSFTEWLQLQQVQETESSEKTPMETEIAEQVKRSNVNDFESILDKFIRENPRISRGKAEFYNPVNMAKQSVEENDELVTETLANVYYKQGHYKKAIRAYEKLCLIYPHKMTYFASLIQKIK..... 334
37 4.000e-34UniRef50_F6GK31 Uncharacterized protein n=15 Tax=Flavobacteriaceae TaxID=49546 RepID=F6GK31_LACS5  ali  35  1MNKIEFTSILQKPQAISKDQTSALQDIVKTFPYFQSARAMHLKGLKNSGSFQYNQALKKTAAYTTDRSILFDFITSENFTQNEISQQIKQNTANINAIDVVSEDISVNKSQSIDNALKEHIDSTTNILDPELFQPKVQKDKIAHIEKTFTTESNNKISKENKSPETILEIGKPLEFNKTETHSFGEWLSLTKFNPINRNTEIKKTQASKNKPIDNQLENSLSRAKKFELIEKFIEKSPKLE-AKKTKSSNHNIAKAQMIKPEALMTETLARIYLEQKNYKKAIQSYNILILKYPEKSGFFADQIKAIKQLQE. 314
38 6.000e-34UniRef50_A0A1I3KZ70 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I3KZ70_9FLAO  ali  35  1MTSQELTNVLQLPQVVTAEQTAMLGSILEEFPYFQSARAVFLKGLKNKESFKYNQALRVTAAYTADRSILFDFITSDTFNQNEISEYIKQNADYINSLDVFVEDISVNNTTSTDPTLKQQLEETRSILDPDLFQPKTETQP-------VISSNLIKNETTKTENDASLNSSKKEIEDFLNIGKPLQFEKDETHSFNEWLNIAKFKPIQREPEDPLKEEANLERAKKFDLIDQFIIKNPKLEAKKAKVST-HNIAQAQMIQSDELMTETLARIYVEQKNYKKAIQSYKILSLKYPEKSGFFADQIKAIEKLQE. 304
39 7.000e-34UniRef50_A0A0B7I7R0 Uncharacterized protein n=5 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7I7R0_9FLAO  ali  27  1MTVKEFVEILKNPHTINERQAHELDNIVQEYPFFQAARMLQLKLLHTQGDYRYSKALKLASVHVLDRSILYDFIHSTDKNTQIQEFTRQLFERRIEQPQSIVKPSQQEIPLSQPVILPQQPQSMNPPQRQEGFSHVPNFMP-QIPKNEKQDENFANPFGKTEDFNPTFVPKQEAKTTSSQEEQNKQTGKPFESIPKWXXXXXXXXXXXXXXXXXXXXXKEDKIAEKFRLIDKFLENNPKIEPSKDYVSNV-NLADEVKSDPQQLMTETLAQVYVNQRKFKLAIQAYEILILKNPEKSAYFATQIQKIKNLQQN 311
40 9.000e-34UniRef50_A4AUA1 Uncharacterized protein n=36 Tax=root TaxID=1 RepID=A4AUA1_MARSH  ali  36  1MNVQDFTYLLQNPEKVTPIQTKHLEDVLEEYPYFQAARALQLKGLRNLNSFKYNNALKKTAAYTTDRDILFDFITSKDFLQNSIANSISGKMDIVNEPEAEQLDETPLAIPLIEKSKDKPLPQDIDDADNILDPKLFKSKDPEVDKVIKAEKEKAEKELEIGKPLPFTKQEKHSFSEWLQLAS---------LKKIQRDSKVLHSDDTPEEDVDFPLEKEVLKKKKFDLIDRFIENNPKIAPSQK-KSAKIDISDSVKLDKKELMTETLAKVYLEQKKYKKAIQAYKILSLKYPEKSGFFADRIKAAEKIQQ. 303
41 1.000e-33UniRef50_A0A2D9Q983 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2D9Q983_9FLAO  ali  38  1MKISNYTYLLANPQKITSEDLEALDRLVKKFPYFQSARALQLKGLKNSESYRYNEALKITAAHTTDRDILFDYITSEKFIQNQISQSILQQDSSIKNINVIAENVSKQVQDEDDNKFKAEVQKAEDILNPGLFERKVAS----------VSKLVEDSHDEATPKTSEDTDEILQTDKPLNFTKNDTYSFSEWLKLTKAQPIKRANKLEKKNSEEKRETEDDDRSRKFELIDKFIQEKPKIIPNKSAKQEKDILKSANTQAADSLMTETLAKVYLQQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLIN. 306
42 1.000e-33UniRef50_A0A0A2LFM6 Uncharacterized protein n=4 Tax=Flavobacterium TaxID=237 RepID=A0A0A2LFM6_9FLAO  ali  34  1MNTKDFTYLLNKPYSVTDKHTMDLESVLYEFPYLQSARAIHLKGLYNQDSFRYNMELKKTASHTNDRSVLFDFITSENFQSIQKDFLEEKEKAIEEITVKDTETLQTETDETETPTPPXXXXXXXXXXXXXXXXXXXXXXXXXHDIPDETEKKLEIGKPLEFDKAEQHSFQEWLQLSKLTPINRETEPEETTILEPESTVEDENTLTEEPKKEETENPGQTSLDKKLELIDKFIESNPKIVPVRNATQPVANIEKSSSDSSLP-MTETLARVYLEQKKYQKAIQAYEILILKYPEKSVFFADRIADIKILQQ. 334
43 1.000e-33UniRef50_A0A1A7QL49 Uncharacterized protein n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1A7QL49_9FLAO  ali  34  3.TAAEFSKIIQEPKDISLEQTAEIKAIVEQYPYFQAARASYLKGLKSKSSIKYNNELKVTAAYTTDRSILFDFITSEAFLQNEISQHIKQHLDHIKSIEVDSEDMSFDKRSRVDDVLKQQITDTEGTLDPELFQLKTSKPPIAYFQIDDALPIEADSKDNAIETATDDSTSPNHQFDHQEKHSFNEWLMLTRFEPINRETDNIESEKTIESVIENTDDSETERSKKFDLIDEFITKNPKLKPSKKTTV-NTNIADAQMIQPEALMTETLARIYLEQKNYKKAIQSYNILSLKYPEKSGFFADQIKAVKQLQE. 320
44 1.000e-33UniRef50_A6EMW8 Uncharacterized protein n=1 Tax=unidentified eubacterium SCB49 TaxID=50743 RepID=A6EMW8_9BACT  ali  34  1MNKETYTYLLANPQEIDKSHLGDISLMLDMYPYFQSARALQLKAFKNEHSFLYNDALKKTAAYTTDRDVLFSYITSTEFVQDQISQTIIAHKDDWNNIEVEHQDLSQEHDTAKKEEIESELKKANAILNPHLFEKKEEASVTSIENSIETSETTKTTAEEETPQTIEENAPIPFKKEDTHSFTEWLKLSQATPIKKVAQTPVEPISEEPKKAPKAQAKKGDTQAKKFQQIEKFIQEQPKIIP-KAKNEPFSQIAITNNDSPKALMTETLAKVYLQQKKYDKAIQAYKILILKYPEKSGFFADQIRAIKNL... 311
45 2.000e-33UniRef50_A0A2A4PPA0 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A4PPA0_9FLAO  ali  26  1MNATQFIDYLEKPSSISXASTKELAXLVXQFPYFQSAHLLYLKGLHQNKSLEYPRQLKVAAAYASDRKKLYELIIQEDLHKQIRL--------------------VEEYSSEEPVNVKTDVSPLEAQILTEAVSASIKLEVSQQRESPGKKVPAIPSDQFRRTGMTNIDQLREPEKPDLPSIKKPIVKTTDEKSVRIDEKRTFGEWLKVSAEPAQETETAETPTEQVXLIDXFIGTSPRIESXRQPFFSPVDTARLGLVDDPSFVTETLANIYEAQGYLEKARKAYELLSLKYPEKRNTFAARIEGLENRLK. 300
46 2.000e-33UniRef50_A0A0A7K2I5 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0A7K2I5_9FLAO  ali  34  1MNVSDFTYLLQHPEKLSPVQTNQLDDILEEFPYFQAARALQLKGLKNLNSFKYNSALKTTAAYTTDREVLFDFITSKEFLQNGIADSISGRQTPIEEKEIEFETITPEAVKKPLLDETVEDKALPQNTKDAEQILDPALFASKDPKIDIAIADAKKKEEELTIGEPLPFTKKEKYSFTEWMQLASKKPIDRSQKILTK----KEEVPKSLKEQPKTGIKKASRKKKFDLIDQFIEKNPKIVP-KEKNAIPVPINDPVKIDTTELMTATLAKVYLEQKKFKKAIQAYKILSLKYPEKSSFFANQIKLVQKIQK. 308
47 2.000e-33UniRef50_H1HBC6 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=H1HBC6_9FLAO  ali  30  1MTLNELDILLRQPQQIQESDSPQLKQLIEKYPYFQSVRSLYLKSLYVQESTEYNLELKKTAAHTLDRDILFDFIVSPEFATYTPIAIEITEPTAAEEAEIPTEEEPQQEAPEPKLTSQSITFHETDDKEEIQDPVEETPTEVVIEPEEVITEDPIVTTLEEKGTVQQEIEKLEEKLEIGKPLNFSENEKLSFQEWLQLSKIKPIDRENDSILTDLEQKSDIEKQKKIELIDKFIETNPKIVPTKKPTVIPANI-DTSVQENSSLMTETLAKIYLEQKKYQKAIQAYEILILKYPEKSSFFANQILDIKALQQH 319
48 3.000e-33UniRef50_A0A1E5SJB6 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1E5SJB6_9FLAO  ali  34  1MNLTDFTHILQHPQVITHEQTEAVKSIIEEFPYFQPARAIYLKGLKDLNSFKYNQELKTTAAYTTDRSILFEFITSDAFVQNEISQFIKQNDTSLKDIEVDIEDISVQKNFQPKEERPKKTISNIPLDKPKNIINSTNEETKSQEKRQEIPANDVLNLGKPFEFNKKETHSFNEWLKLTHFSPIERPEDEEKEDNKEKEEIKNDNKIIEKEVTKKKTTDTLDKEKKFQLIDQFIIKNPKIRPIKPIT-QKGNLAKAQMIQPESLMTETLARIYVEQKNYKKAIQSYKVLSLKYPEKSGLFANQIKAIEQLQE. 333
49 6.000e-33UniRef50_A0A2A4NZT2 Uncharacterized protein n=3 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4NZT2_9FLAO  ali  33  10MTNLEINSLVNNPQQISVEKTEALEAILKEYPYFQAARALHLKGLQQQKSYKYNQALKITAAHTSDRSVLFDFITTTVINPSLTRVKEITTQEDKDTATVEEKAAPVEEQEPTKTPTIPSSPIRGFNPVFENIEQLADKKQEKSSGNEARFSDIIFPAIGEEESQEKVKELIEKTEEVLQIGSPLEFSKKEEHSFSEWMNLTEFPPLPQEKSVQKTVKKTTRKIDSLSLIDKFIASKPKI-PRIGKSDSKQVKIHKEAPSNDRLMTETLAKVYLEQEKYGSAIKAYRILSLKYPEKSSFFADRIKAIKYLQKN 340
50 7.000e-33UniRef50_F3PS88 Uncharacterized protein n=60 Tax=root TaxID=1 RepID=F3PS88_9BACE  ali  23  1MTSAHLQQWIQHPEMLDRETLYELRTLVTRYPYFQSVRLLYLKNLYLMHDISFGTELRKAVLYVADRRVLFYLIEGDRYALKSQKPSLSSSKVMEDEPSVDRTLSLIDAFLATVPEEHSQNMELDYAMDYTAYLMQEEAAGQPDVHADDRAEAPKLRGHELIDGFLQKRDSADMRLPEVAEGEPARESEDMLEEETGEKGEEEEKTSGT---------------------------------------------ASNEELDDSCFTETLAKIYIKQHRYDKALEIIKKLSLNYPKKNAYFADQIRFLEKLIIN 268
51 8.000e-33UniRef50_A0A1F3KBS0 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3KBS0_9BACT  ali  20  12...NEFLLLINGNYHLSSDELWKLSQLIDQYPYCQTLQLVYARGLQNERSVHMAKQLKIAATYATDRQVLRFLLQSSLKVNSALSDSKSHEDIDTGSISEQESEELVDEELKENNVSTEEPIMPDMEIESRQESDSVIGLDGPSAVRMNKKDALLSLIDHRLAELKAARRLEELNIRKAIEIDSEPGIHTLSPVFSSGGKPFDVNDLLQREDLLAKESVGSERSGKIGLIDKFLEDEPKLSKPRAGFFNQNEFVNQSNIDHDEIVSETLARIYVAQGNLTKALKIFEKLSLNFPEKSSYFAGQIENL...... 328
52 8.000e-33UniRef50_A0M7D6 Uncharacterized protein n=18 Tax=Bacteroidetes TaxID=976 RepID=A0M7D6_GRAFK  ali  41  1MEVNKLTYLLENPGEITSEDTREIEGVLSKAPYFQAARAIRLKGLKEHQEFSYNDALKKTAAYTTDRSILFDFITSPEFNQNQIAKQIREQDEKLKQITVYEAEEVHGKRSLDINEAIKMKQSESERVMDPALFERPATTDVNENERVEPNEPSEEK----------------------LGIGKPLEFDGKESHSFSEWLKLTKAKPVEREEEKIDQETDEGRSRKFELIEEFISKNPKIKPGKKA--NKANLAENSITAPESLMTETLAKVYLEQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLQD. 288
53 1.000e-32UniRef50_A0A1Y0MIZ4 Uncharacterized protein n=1 Tax=Winogradskyella sp. PC-19 TaxID=754417 RepID=A0A1Y0MIZ4_9FLAO  ali  40  1MQLQELTSILQYPETLKTEKIGELKTLVDRYSYFQPVRALYLKALKNKDSYKYNNALKVTAAHTTDRSVLFDFITSEVFNQNEISQQIKQNSEYIKNIEVNAIDDISINRSVTIDDALKRQVEATDGVLDPNLFEEKEVERQNIPSFKISGNITNLDPIEEK-------------------LQIGKPLEFSSSETHSFSEWLKITSFKPIDRSQNQIENEAPISNKLEAIDKFITENPKIKPTANTPKPKLVNNEEST--DDSLMTETLARIYLEQKNYEKAIQSYRILSLKYPEKSSFFADQIKAIKELREH 292
54 1.000e-32UniRef50_A0A086AFH8 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A086AFH8_FLAHY  ali  33  1MNVNDYTYLINRPDAITEKQTEALGNVLNEFPYFQSARALRLKGLYSQNSFKYNYALKVTAAHTTDRAILFDFITSETFSIIQKEYYDKKASALLDIDVVDSEHLLPEVVALEDFIEKIEPKLIDPIERSILTSIKEASIPNVEENLITSEEIIETVEALETIESPEAIETAEENLEIGKPLDFSKNEKHSFQEWLQXXXXXXXXXXEPAEIDSSLIEIDEEKKKKAELIDKFIETSPKISPVKSTTTVAANIIDINKDDNTYLMTETLARVYLEQKKYTKAIQAYEILILKYPEKISFFADRISDIKTLQQN 339
55 2.000e-32UniRef50_A0A1Y1CJH5 Uncharacterized protein n=3 Tax=Marinifilaceae TaxID=1573805 RepID=A0A1Y1CJH5_9BACT  ali  20  1MDGSLLQDWIRNSGKMDRDSHRELKSLIDQYPYFQTAHLLLLKNLHDNQSIRFKEELRNSALYIPDRRHLFLLIQDQIKIQSRSESSEKIVAVSEKPESVLQEKLDDVQVKEVEKITDLPAEEKQLVSEIAHAESDELIDLFDESELVNSDFSQEDRSTDKLEVVQAANDEILEFADTDEPKKEEELSDKRENHTFTDWMTVVDTNTKSEEIDDNLNPEKGKVKKGNNLIDNFIQNEPRINRSIKVVEKQEDISLGSLEDKDGFISETLATIYVKQKLFDKAIAVYDKLVLKNPEKNLYFAGQIERIKKLKN. 354
56 2.000e-32UniRef50_A0A1I5BIH0 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1I5BIH0_9FLAO  ali  30  1MNAQQYIQWLNNPYQLTAENTVALKDVISEYPYLQSARALYLKTLNQERSFLYNSELKKTAVYTTDRDVLFDYIVSEDFIAYKPLQIEEVDVVDENYIEFKKPEPTLDETIEKIENQDKETELIQKIDQXXXXXXXXXXXXXXXXXXXXXQVSTEEVQAEEIHQLEENLEVGKPLDFSENDKFSFTEWLKLTSAQPIQREEEIIDRKIEPKTENIVEETIPVKQKQMDLIDRFIETNPKITPSKSAVVPVINMDRLNEEEP-FYMTETLARIYLEQKKYQKAIQAYEILILKYPEKSSLFANRIFDIKKLQE. 319
57 3.000e-32UniRef50_A0A2M8A6C7 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium CG_4_9_14_3_um_filter_40_17 TaxID=1974005 RepID=A0A2M8A6C7_9FLAO  ali  36  1MNLSDYIYLIQKPEAVTPSQTKELKIILDEFPYFHSARAVYLKGLKNQGSFLFNDTLRTMAAHTTNRSVLFDFISSENFNQHAISKQIKDNEILVKNLDVVDAVEINPVGEHPESVLSIIEADKILDKELFKEKSDLTFHLKEIE----------------------------TLEDSTNEKLPVSFNPNERHSFEEWLKFSIKTKPKQSIELEKTIASTINREKKFDLIEKFIEQNPKITPNKETNFDGNLISENSTAIQE-IMTETLAKVYVSQKKYKKAIRAYKILSLKYPEKSGFFADQIRALSQLEK. 283
58 3.000e-32UniRef50_F9ZB50 Uncharacterized protein n=5 Tax=Odoribacter TaxID=283168 RepID=F9ZB50_ODOSD  ali  23  1MKSEKIIEFIRHPEKINNDDLRELHTLVERYPYFQTARILYLKALYLLGGVRFRSELKASTVHLTDHKQFFRYLNNQIGFEPIPVCQTTEETTTGCEEDIIQFNLRQKGRKRPENDEKEIISNPIRLDDVPGIIDDYSNSTQEDRSEANHSATPYASPIDEAPRPENNFSIDVDLDEEIADAQEEKPSVSLDTPEIISGGYRLTDQPHTEETVITEKESRKSRKKKDDLIERFIQSEPIMPKITSASTDNRDLSKENPYIQEELFSETLAKIYVKQHLYEKAISTYIKLSLKYPEKSVYFADRIEKIKENINN 358
59 3.000e-32UniRef50_A0A0R2RZS8 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium BACL21 MAG-121220-bin10 TaxID=1655592 RepID=A0A0R2RZS8_9FLAO  ali  34  1MNINTFNTLLAHPQDISAGHDHALAQIIKDYPFFQSARALQLKGLKQADSYHYNKALKTTAVYTTDRDVLFDYITATEFSQESLADALVGHQESIKSLEVDHQVVGHQQTLTDTEPTNTSSETPELT-------------------------------------------------HRPLEFQKEERHTFEQWLQLTQLKPIDRQKQNKGDQNNPNAQLDHPLAHKIDRINKFIANRPKLDPNSHYSST-TDLSQPFTNSPEEIMTETLARVYVAQKNYPKAIEAYKILILKYPEKSGFFADQIRGIEQLIN. 262
60 4.000e-32UniRef50_A0A255ZGY1 Uncharacterized protein n=1 Tax=Flavobacterium aurantiibacter TaxID=2023067 RepID=A0A255ZGY1_9FLAO  ali  35  1MNAQELSLFLEKPELVKDQHVAVLRELINRYPYFHAPRAIYLKALYNQNSSAYNLELKKTAAYTQDRGVLFDFITSGTFTGLHQAFQAEKDARINE-------------------------------------------------IEVFAYEIVSHKVDNTVAAHPEVTTIEPTAVTTQAAANLGVGKPLQFSQEEKHSFQEWLQLASFKQVDRSQASVPDSRKRKLDLIDKFIESNPKIIPNREQTSSV-KLVQDDDSQQATLMTETLAQVYLEQKKYQKAIQAYEILILKYPEKSSFFASRISDIRILQ.. 261
61 4.000e-32UniRef50_A0A1G0CIN5 Uncharacterized protein n=1 Tax=Fluviicola sp. RIFCSPHIGHO2_12_FULL_43_24 TaxID=1798019 RepID=A0A1G0CIN5_9FLAO  ali  20  1MNLEQVSQSISNPAVLTLADAPALKALSEKHPYAAVFSLLYLTALANGKSIDLDTALQQHAYRLNDRAQLYQLINSSVTETPETIAETEETEPVIVFQEPVSEVIPEEKEEPADESIEFTPESETKESPEPVVEPTVSSDFETITEAFTLEQHFDISETEAPVVELQKEEQAEEIVPSEPEAEPASETDWTEHHEPGEKRSFTSWLKSTGQKPSEPTAKTPEKRKVDEIIEHFIKEEPTISRGKTEFFSPPKKAKESLDEETIPVSETLAKIYAAQGNYPKAIHVYHQLMLAFPEKKLLFAVRIEELKKKI.. 319
62 4.000e-32UniRef50_UPI0004DF4D31 hypothetical protein n=1 Tax=Leeuwenhoekiella sp. MAR_2009_132 TaxID=1392489 RepID=UPI0004DF4D31  ali  48  1MNLETFTYLLEHPEHITASQTDEMKEVVTRYPFFQPARALYLKVLKNQESYRYNKELKRTAAQTQDRSVLFEFITSSIFNQNVINSQIKQQEERLHNMTVNGALNISKQVEEEELQKAYTILDPDFFEPKASENTAKASPQEILETGKPLDFTTDETHSFSEWLKITSFSPIERKNEPNLG--------------------------ENEAKKEEIPPANPERKRKIKLIDQFIANNPKIKMKAKEEAQIKNIPEVKNVPDEALMTETLARVYVEQKNYGKAKQAYKILSLKYPEKSGFFADQIRAIDELQD. 286
63 5.000e-32UniRef50_A0A2K9PNX9 Uncharacterized protein n=1 Tax=Flavivirga eckloniae TaxID=1803846 RepID=A0A2K9PNX9_9FLAO  ali  36  1MNSKDFVNILQHPQTITRQQTEAVKSVIDEFPYFQSARAVYLKGLKNASSFKYNQELKTTAAYTTDRSILFDFITSEAFIQNEISQFIKQFQPKEERPQKTPSFVLDESEEIENVTEETKPVSEETQPTTEEPQLAAEETKTQETLVSDILNLGRPLEFNKKETHSFNEWLKLTCLKPIDRDQDSDTKAPPAPLSFEPVSSEQVASKTEPPKKEDKSSEELDKAKKFELIDQFITKNPKINPFKA-TITKGNLAKAQMIKPEALMTETLARIYVEQKNYKKAIQSYKILSLKYPEKSGFFADQIKAVEELQE. 353
64 6.000e-32UniRef50_A0A1G5EDA5 Uncharacterized protein n=9 Tax=Nonlabens TaxID=363408 RepID=A0A1G5EDA5_9FLAO  ali  34  3.NTGRLHHILSNPSEVHPDDLPNLEATLREYPYFQSARSVYLKGLHNAQSSVYNKELQVTAAHTADRSVLFDFITSDVFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNDLNADTDFNKVTDADLFEKKNTSTSENVVPNDVLEFKKDDKYSFSEWL----------------------------------QLTNVKPIDRSDETKSVEQIAVEPIEIDEEKLEKMRRIDEFLKAKPRITPRKSGTAE--LPTGYNTDSEKQLMTETLAKVYLAQKNYEKAIKSYEIMILQHPEKSGFFADRIREIKNLQSN 278
65 7.000e-32UniRef50_A0A2E2IXJ9 Uncharacterized protein n=9 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E2IXJ9_9FLAO  ali  38  1MNTQKYTSLLARPQDISAEEVKELDAILEAYPYFQSARALQLKGLKIQNSFKYNDALKVTAAHTIDRDILFEYITSPTFTQHEISGLILQNSEAIKEMEVVSENVSEQVSLEIDQQLKAEMKKAEAILDPTLFERKGSASE--------------------EGTLQKDKKEATPEDTLKLNEPLAFQKGEKHSFTEWLKLSQAKPIKREVVSEENSAKDQEDKERKFELIEKFIQNPPKIQPT-ENSEKKKNLAKPFTKPSDSLMTETLAKVYLQQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLIN. 291
66 8.000e-32UniRef50_UPI0006D08E25 hypothetical protein n=1 Tax=Marinifilum fragile TaxID=570161 RepID=UPI0006D08E25  ali  20  3MEQSRIQDWVKDSKTMDKNSHRELKYLVEKYPFFEVAHLLLLKKLNDSQSIRFKEELRNSSLYISDRRQLYLLLNDRLKLVPFEKTVSVEKAKDAETNLETESINQQDFAADTIVEEPVIEELFELSAEVSIVENEEKDILTDTDHLTNDEILELNEPGIDLIEVESKPEEEKAKEKSDSDLLVAATEVYHKDKNHTFTDWMEVVDKSEETSKSEPEKPAKPKKKNLDLIDNFIQNEPSIQRNIKVADKQEDISVDSVRENDSFMSETLASIYVKQRLFDKAIAVYRKLELKNPEKNVYFASQIKKIEKLKN. 335
67 8.000e-32UniRef50_A0A2N2X2N6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-4 TaxID=2013694 RepID=A0A2N2X2N6_9BACT  ali  25  1MNKETFYSYLSHPELLDDRSLSDLQAIVDEYPYFQSARMLLLKNLNNQGTISYERELRTNAVWITNRSRLFYLLDKRVLLPINEEANVNRPAAYNESATIDFTQLSELTDFDIFSPSNNKRDSYD------------------------------------------KNDELEFLIMSGAAQSGTFFNVGDQVDLEDFKNTFKRKKTNEPESEKQDDTAKPEQNRRNALIDSFILEQPKIVPPEKKVEEQTPTPESEPQLNPDMITDTLAKIYIKQGFYDKAIHAYEKLSLKYPEKNSYFAGQIYKIKQIINN 272
68 1.000e-31UniRef50_A0A1L7I4D2 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1L7I4D2_9FLAO  ali  41  1MDQEQLTYLLDHPKEISAEQTRELEKIIAKYPYFQAARAIRLKGLKEFQEFSYNPALKKTAAYTADRSVLFDFITSEEFSQNSIAKQIREQEERLKEITVYEAEEIHGRRSIDIDEAIKMKQSESERVMDPGLFERAPKQEVSKEEISEKDQLGIGKPLEFSKSES-------------------------HSFSEWLKLTRAKPIEREEEQVSETDSDSEERSRKFELIEEFISKNPKIQPVK--SAPKANLAEQSLATPEALMTETLAKVYLEQKNYKKAIQAYKILILKNPEKSGFFADQIRAIQKLQD. 285
69 1.000e-31UniRef50_A0A2G2KK23 Uncharacterized protein n=1 Tax=Kordia sp. TaxID=1965332 RepID=A0A2G2KK23_9FLAO  ali  42  1MNNIEFSNILKQPQGINEQQTMGLKGVLNDFPYFQSARALYLKGLKKEESYSYNHELKLTAAYTIDRSVLFDYITSDSFNQNIISKVQQKLQKQANDIEVVAAEEISIFDSGTSFYDEQVLNPDLFEEKTVENTTAIAEDNLAIGTPLEFNTNETHSFQEWLKLSAIPTI----------------------------------------ERMEVKEEKKTKNLRNVDLINKFITSKPKIKPVRKTVSLK-NLAKENSFSSNELMTETLAKVYLEQKNYKKAIQAYRILSLKYPEKNSFFADRIADLEQIEIN 272
70 1.000e-31UniRef50_D5BAD3 Protein containing tetratricopeptide repeat n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=D5BAD3_ZUNPS  ali  39  1MDLKNFTYLLEHPEEVSPQETRELEDILMNAPYFQAARAIRLKGLKDADSPSYNSALRKTAAYTTDREILFEYISSANFNQNRIAHQIKKQDEKLNNLEVYEPIEVLGRKSMAMGEAIQMKQDESEKVM-----------------------DPELFERFKNKNKEEEKELPENQLKIGQPLQFNNAESHSFSEWLRLTSAKPLKQPGQQKPAEKEKEAPEDIQKKFDIIDRFISKNPKIKPAKSSPRASTP--DLSNPAPEALMTETLARVYLEQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLQEN 288
71 2.000e-31UniRef50_A0A2N3A6J1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-11 TaxID=2013679 RepID=A0A2N3A6J1_9BACT  ali  20  1MNTTRLEKYMSNPALLDNATLPEIEHLAHEFPYCQIAHILLALNSRNVNHIRYSSRLKIAAAYAGDRGLLRRHIERAEAEEEIIAEIPETKPHAPEIEETEQNVEPIEVITSEIPEVHPEKFSGEISAADDRLPDSRDEEAHLLHLRDIVNRRLAEIASESVEKLQHDSHEDHSEIVAGEKNSTENELQIQIEKHPGPVVSHFEEDTSSDEKDTDNRKTSGIEVSNKAIIDRFIETEPRISKPKKEFFNPVDKAHKSAVDLEDIVTETLAKIYLSQGNHEKAIKIYQRLSLNNPEKSTYFAAQIAKIQDDLLN 367
72 2.000e-31UniRef50_H1DKB6 Uncharacterized protein n=2 Tax=Odoribacter TaxID=283168 RepID=H1DKB6_9BACT  ali  21  1MKMDKWIEFFSHPEKIKEEDLTELEALLNRYPYFQAAQILFLKVLYLSKKNRFSPELKHRSIYIPNHKQFYKYLNNWS----------------------EFKEVFEASPEGTEENTTDTISPVEVPLSAVSLKNVTSTFTQPIELFGEEENHATAQVSQPSVPVPEIHPLPPHPVESEDIFRTYRLEDIFPEEEALSLGELAGELKKKKKTEEAPLPSPQDKTSKTALIDKFILEQPTIPKGQLDMVDNRDLSEESDQENDDLFSETLAKIYIKQKLYEKAITTYIKLSLKYPEKSVYFANRIEKIKDQINN 291
73 2.000e-31UniRef50_A0A066WPJ6 Uncharacterized protein n=58 Tax=Flavobacteriia TaxID=117743 RepID=A0A066WPJ6_9FLAO  ali  35  1MNVTDYTYLINKPNTITEKQTLALDKVLDEFPYFQSARALRLKGLYNENSFKYNSALKVTAAHTTDRAILFDFISSEEFNAIQKALFEKKANELLSINVVDSIEVIQEKAV----------------------------------EIIEDFSLSEINQDNETETSSTINTAEEKLELGKPLEFSKNETHSFQEWLQLSRIQPIDRTSEANSNSKNANQEEELKKKKESIINRFIENNPKISPIKPGTTSIT--IDINKEDTSSLMTETLAKVYLEQKKYQKAIQAYEILILKYPEKSSFFADRISDIKILQQN 277
74 2.000e-31UniRef50_A0A0Q9Z438 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0Q9Z438_9FLAO  ali  41  1MEATEFIKLLKQPAGITASQTTALEKIIQEAPYFQAARAVRLKGLKEHQEFSYNSALKKTAAYTTNRSVLFDFITSEEFNQNKIARQIQDQEEQLRNITVFEPEEVFAKRSMAIDEAIKMQQSESEQVMDPELFSEKQKEAEVQKEPGTEKDDLKL-------------------------GEPLEFDASESHSFSEWLRLTSAQPIKRENQEEKESQKDELQHKKFELIDKFISKSPKIKPGK--PSNKSNLAEVSTTPPESLMTETLARVYLEQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLQEN 286
75 3.000e-31UniRef50_A3J4N3 Uncharacterized protein n=13 Tax=Flavobacteriia TaxID=117743 RepID=A3J4N3_9FLAO  ali  40  1MNISDLTYLLNKPETINEKQTIALENVVLQFPYFQAARALHLKGLYNQDSFRYNYELKKTAAYTTDRTILFDFITSDNFTAIQQEKIDEIQKSLLDIEVHYIEEVIVSPQIETIFTEGEKAEIEAIEKTSEEKLDIGKPLPFTPSEKHSFQE----------------------------------------------WLQLTKFSPIEREIEEKNTQNDPEKEKKLALIDKFIETNPKISPVKEMTKPPANISK-STEEPTHLMTETLAKVYLEQKKYTKAIQAYEILILKYPEKSSFFADRINEIKNLQQN 266
76 3.000e-31UniRef50_A0A1I0VK44 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I0VK44_9FLAO  ali  33  1MNVTEYTYLINKPDAVNDRQIIALEKILHDFPYFQSARSLHLKGLYKQDSFKYNSELKNTAAFTTDRTILFDLITSENFIGIQKGYFEEKEAQILDITVVDSTIIEIIETEIKPEINNLEKSIISSIKEANQDIEEEIIFEKVEVLAIEEKLEIGKPL-------------------------------TFNNSETHSFQEWLQLSKIKPIIREENPILENNLSSKLDIIDKFIEANPKISPVKKDASTP--VIAVKTEDNSYLMTETLAKVYLEQKKYSKAIQAYEILILKYPEKITFFADRISDIKTLQQN 280
77 5.000e-31UniRef50_A0A2V3ZV94 Uncharacterized protein n=2 Tax=Bacteroidia TaxID=200643 RepID=A0A2V3ZV94_9BACT  ali  22  1MEQSRIQDWVKDSKTMDKFSHRELKYLVEKYPFFEVAHLLLLKNLNDSQSIRFKEELRNSSLYISDRRQLYLLLNDRLKLVPFEKTESNEEETSLEVESENLQEPVTETRLEKPVREELFELSSEVSIVENVEKDILVDTDHMSNDEILELSEPGIEPIEIEPKTEEANKQEKSDSDYTLKEDEDPKEETSKEEDRSFTDWMEVVDKGEETSKSEPEKTAEPKKKNLDLIDNFIQNEPSIQRNIKVADKQEDISADSVRENDSFMSETLASIYVKQRLFDKAIAVYRKLELKNPEKNVYFASQIEKIEKLKN. 329
78 5.000e-31UniRef50_A0A2U2B844 Uncharacterized protein n=1 Tax=Marinilabilia sp. WTE TaxID=2162893 RepID=A0A2U2B844_9BACT  ali  23  1MSRMRLIDLLSHPQELDEKTLEMLKEALDAYPFFQAGRMLWIQNLHKLDHIRYNNELKLGAAFIPDRSKLFFLINDVFSSLSVPEDLSYEDDSEAASEPQKEKDANVAAIKDVKDVEENQIEDLSEHSEVEKESANRSLDEGEEQHFSGENDESVSTPSELLDYEKETFSSAYSVEEEVPPTPLDFNENHSFSEWLNLLKKQPAQVANEEEDSSAEKSEKQPKKSGMDLIESFLNSEKRILPREEKEVTNEDFSANSITESEDLMTETLANIHIKQERYQKAIEIFEGLSLKYPEKSVYFARRIKEMEDLINN 363
79 5.000e-31UniRef50_A0A1Y0MRD1 Uncharacterized protein n=1 Tax=Gilvibacter sp. SZ-19 TaxID=754429 RepID=A0A1Y0MRD1_9FLAO  ali  38  1MNTQEFTYLAQNPGTVNAEHQQQLQEILSTFPYFQAAHALQLKALKNSRSFKYNDALKRTAAHTTDRAILFDFITSEVFLQDEIAHKIKHQHTDLNEIELVDVQEVSATPLELEQKLKSELQKAKAVLDPDLFLKIGEPEPLESIENAPLEFKKED-------------------------------------KHSFAIWLQLAQVNPVERTQEETAPKPDAKEERFKLIDAFLSNSPKIDPEEEVSSTK-NLAKPFTKTSDSLMTETLAKVYLQQKNYKKAIQAYKILSLKNPEKSGFFADQIRAIKKIM.. 273
80 6.000e-31UniRef50_A0A1I2FPV8 Uncharacterized protein n=3 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A1I2FPV8_9BACT  ali  24  1MARMRLIDLLSDPNKLSDQTLDMLKEVLETYPFFQAGRMLWVKNLHLLDHIRFNSELKLAAAFIPDRSKLFFLINNTELVAKPQVTDSTNKKDSDLSNNQESKLTSDLPLEDDGDVLTKKKDKDSPIKELQNSNQEKVLDEKSSKIGSDANYFNVEDAIITSTGERLSFSELSKKQAENGAEEDLQSEPQEHSNNLIRHQPYNKDKENKPEEEAAKIKENPLRKNKMSLIDNFLESQKRIVPKNDNSLPGEDFSLRSVQESDDLMTETLANIHIKQGRYQKAIEIFERLRLKYPEKSVYFANRIKEMEDLINN 361
81 1.000e-30UniRef50_A0A1F3M7M7 Uncharacterized protein n=5 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3M7M7_9BACT  ali  22  1MNKDEFIGFMQQPTKLDSQTLSGLTALVNEFPYCSTVRILLSVNQYKEKDVRYETELRTTAVYSGDRSILKKHIDRAGQSNVRIVLPDEEKAEEVKKAETSSPLEDSVVPEKAEKIASVDPEGPKAFTLQREEPEMPAENIPYIDMEIQELKEIINRHIDELEQETHLKSP------------------------------------SHVAVEPEKKVDVVKEKSKEELLDEFIKNQPSITRPKAAFFNPLEVAKESIVDQENIISETLATIYYDQGHLQKAIKIYQKLSLKYPEKSTYFAALIQKAEKELN. 276
82 1.000e-30UniRef50_C7M600 Uncharacterized protein n=32 Tax=Capnocytophaga TaxID=1016 RepID=C7M600_CAPOD  ali  30  1MTVKQFIEIIRHPYTINDDQVYELDEIVKEYPYFQAARVLQLKILHSEGNYKYNKALKLAAVHVTDRSVLFDFINSKSIIPDFSALRRDFERIRKARERKEAEETENTPPKVSYIDHEPRLYRPNVPESIFEEPIFPEDLVNHQELADAFEPKKEE-------------------------------------KPKTDTDNISQWLENISDDHTEVSYKDDKVAEKFKLIDKFLENNPKIEASKDYVSNV-NLADDVNSDPKQLMTETLAQVYVNQRKFKQAIQAYEILILKNPEKSAYFAAQIENIKKLQQN 275
83 1.000e-30UniRef50_W8VR10 Uncharacterized protein n=3 Tax=Flavobacteriia TaxID=117743 RepID=W8VR10_9FLAO  ali  34  3.DQNRLHTILANPGQLNADDLELIGDVIKKYPYFQAARSVYLKGLYNIQSPQYNKELQITAAHTADRSVLFDFITSEVFIXXXXXXXXXXXXXXXXXXXXXAEEVVVRTTDLNADKNFDQVTDQD-----------------------------------------LFEKKKESQPKVLDFTQNEKHSFQEWLKLTTINPIDRSTEDQKEHTASGDVPEDEERQEKMRRIDEFLASKPKITPRKTGPIDT--PAIEPIDSGSHLMTETLAKVYLAQKNYDKAIKSYQVLKLQHPEKSGFFADRIREIENLQSN 271
84 1.000e-30UniRef50_A0A2E9YBK3 Uncharacterized protein n=4 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E9YBK3_9FLAO  ali  20  1MQIQRIQHLIEHPNDVVAEDREGLERWSRKYPYAGVFAMLLARCSSVDGHMNEEKDLLRAASTMSFRQPLFDLIVQAKLVEEARNVHDALSD---------------AAKTPSATSENSPDANMIPKKSSGTGLNPNEPVEREALISAIERTIETDVNRWEDGKENSVVSPVEPADFALIQDAVSSPFSDWLLQRASEVGFGEGVHSRSSEPDNGLISMDAPQGDKMALIDRFIANNPRIGPIRD-PEEPSPWSSESILEDPSLVTETMARVYAKQGLFDKSRKAYRILALKYPAKSTYFAVQLKKLDDIQ.. 295
85 1.000e-30UniRef50_A0A1V5P2P2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin397 TaxID=1852812 RepID=A0A1V5P2P2_9BACT  ali  21  1MTKEQFIQLLRTPATINLNLVSELEDITERFPYYQNAHLLLAKQYQGHENIRFESYLRKASAYAPDRTVLYRLIKEEIPEVIHLEAVQEKVQEPVAEMESVHVQQIENTAADTTEKEAIETPSKAEDQKEQLISAEPPAPETVVQTPEVTGPINIETLYQQRQEKAESTSGNEPKPVKKEPGTHSFSEWLQLKRVPVVPVEKINELKPEEVQPTIEPVVPKKEKVTDHIIERFIQSEPRIVPAKSEFYSPGNMARKSLVEHEDLISETLARIYAQQGNLRKAIETYERLKLKIPEKSTYFAALIKELEQK... 352
86 1.000e-30UniRef50_A0A2E5RNQ7 Uncharacterized protein n=4 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E5RNQ7_9FLAO  ali  23  1MNKEVFNHLLKNPAHVDPKHKSDLKKLVDNFPYSANIRLLYLSSLLNDADVLFEQELKKTAAYISDRSVLKKIISKPLSKDAYIIEESKMKVLSGEDKSNENLECNQENNQKEIEGENTXXXXXXXXXXXXXXXXXXXXXEFNRSEKSKNQSLKELDDLIISSAIGASISLDIDKISTEIKEEVQEEVQEEGTKSFLEWIKASETKEIRSNLSPKEKERKEFREKAEVLIDQFILNQPKIKP-KTEFYSPENMAKKSIEDSQAMVTETLARVYAEQGNMAKAKSIYEQLILKNPEKKSYFASLIKDLR..... 311
87 2.000e-30UniRef50_A0A238WMK9 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A238WMK9_9FLAO  ali  36  1MNREDITFLLQNPTSIDTSKTALLNEVVEMYPYFQAARVIQLKALKSTNSVKYNQSLKKTAAYTIDRQVLFEFITSQNFTKNNYKENPVLEEIEIIDPEIVQAPDNAIDNTFKSEVEPVPKEIKVE----------------------------------------DSQIETATNETILEIGKPLQFNSTEPHSFNEWMQLISTKPIIREEISNNSIEKITKNEDKFNLIDQFIELNPKIKPIDKNAMFQDVITEQST-ESESLMTETLAKVYLEQKKYESAIKAYRILSLKYPEKSGFFADRIKAIKNLQKN 272
88 2.000e-30UniRef50_A0A095SU97 Uncharacterized protein n=6 Tax=Flavobacteriales TaxID=200644 RepID=A0A095SU97_9FLAO  ali  35  1MNLTDYTYLINKPDAINERHSTELEKIMEEFPYFQSARVLRLKHLYNQDSFKYNYALKVAAAFTTDRSILFDFITSDTFVTVQNGLYDQKIAELLNIDVIGSEIVEVQKPIQDINSVEQSILSSISQANPHDLIFEKK-------------------------------------------LDLGKPLEFTKNEKHSFQEWLQLSRLSPIERKETASEEELAKRKKLEIIDKFIENNPKIPPIKK--ENSAYTIQPVIEDKSYLMTETLARVYLEQKKYTKAIQAYEILILKYPEKSSFFADRILDIKKLQQN 268
89 2.000e-30UniRef50_A0A2A5H0N9 Uncharacterized protein n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2A5H0N9_9FLAO  ali  37  1MNVSDFTYLLQKPNKVDSVQTKQLEDILTEYPYFQAARAVHLKGLKNLNSYKYNNALKITAAHTADRDVLFDFITSEEFLQNNVANSIAGR---------DSYLNDMETISEEVSQIEKTKMLHDAYSKDKPLPQSIKDAEEILDPKLFKSKDPKIDKAILREKELAEKELELGKPLEFTKKEKHSFAEWLQLTSIKQKNESTIEFKTKIKEIEIPLKQDALKRKKFDLIDKFIENNPKIVP-KGNSTQKINIKESSKFDKNELMTETLAKVYLEQKKYKKAIQAYKILSLKYPEKSSFFADRIKATTKIQQ. 303
90 3.000e-30UniRef50_A0A0S7BYX1 Uncharacterized protein n=1 Tax=Lentimicrobium saccharophilum TaxID=1678841 RepID=A0A0S7BYX1_9BACT  ali  21  1MRPSLFESFLADPALLDHESLPAMEQLAREMPYFQIAQMMLVANMRKTESIRYNSQLKIAAAYAGDRGILRKLMHENASSIPHIESAHAEKTVETEVAEMPVQAEVIPESFMEIPLEDIHASDAESPDVEMPDEGKVQFSVESKSLPTPDDEEAHLRHLQQIVARRLAEIALGARDKPSEESSPADEDSPKDIVDSALAATAEIEDHGAQLHEDAERRPQDEEKFPDDLIDKFIRNQPRISQPKKDFFNPVDKAKQSSVDHEEIVSETLARIQLQQGNPEKAIKIYRKLSLNNPEKSAYFAAQIEKIQENLSN 366
91 3.000e-30UniRef50_A0A2D8FU88 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2D8FU88_9FLAO  ali  38  1MNTQKYISLLAKPQNISKEDLSSLGTIISKYPYFQSARALQLKGLKNENSFLYNDALKKTAAFTTDRDVLFDYITSEAFIQNEISEHILQHSEAIQAMEVVSENISEQVSLEIDRQLKAEIKKAEAILSPKLFERKEEEKEVEKMINEPLTFTKEETHSFTEWLKLTKATPIDR---------------------------------SDEEAIAKESSSTNDVERKFELIEKFIQEKKKKSKSDRTTEENINLAEPFTKTSESLMTETLAKVYLQQKNYTKAIQAYKILILKNPEKSGFFADQIRAIQKLIK. 284
92 3.000e-30UniRef50_A0A1I6R4X5 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I6R4X5_9FLAO  ali  32  1MNSIEFNNLLTNPEKANTTSPEVLESIIHEFPYFQAVKALQLKNFKNNNSFKYNEALKKTAAYTIDRKVLFEYITSLNFDKKTVNEIEILEEIEVIEPETVKVLHSKITSLFKSKKQKEEPILPEEKVDTNPPAISETNNREEIEIVLTNSEETKEANEVLELGKPLQFSSAEPHSF------------------NEWMQLISQKPIEREEKASKTDKISSKIEDKFSLIDKFIETNPKIKPVDKQAVNV-DISAESNYQSESLMTETLAKVYLEQKKYDNALQAYRILSLKYPEKSSFFANRIKAIKILQKN 294
93 3.000e-30UniRef50_A0A0Q1BPQ7 Uncharacterized protein n=9 Tax=Nonlabens TaxID=363408 RepID=A0A0Q1BPQ7_9FLAO  ali  36  3.NTDRLHHVLSNPGEVHADDLPILETVIKEYPYFQAPRSVYLKALHNAQSPSYNKELQVTAAHTADRAVLFDFITSDVFLQNRISEQXXXXXXXXXXXXXXXXXXXXXTNDLNADTDFQKVTDVDLFEKKQPETTVDKEVLEFKKDEKYSFNQWL-------------------------------------QLTSLKPIDRSNDLEPPTTPPAPPIEIDEEKLEKMRRIDEFLKAKPRITPRKSG--IAELPQAYSTDGEKQLMTETLAKVYLAQKNYEKAIKSYEILILQHPEKSGFFADRIREIKNLQSN 275
94 3.000e-30UniRef50_A0A2G6GZS6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GZS6_9BACT  ali  23  3MEAAEFIRLLES-DKYSREDLVQVNALCREYPMFSLAHMLRVRILEAHGEEEKAEALRIAAIYAGSRKRLYDFVHHLPDPVPPGEIEFSLNPEQDEVDVVISQEESALGTESDHDLLDFEAAADDESAENLVSEEPGLPAESAVAPETAEVSESPEVPDAEASDASETAEVSESPESPDAEAPDAPETAEVTEAVDAPESGESSPTEQETRPHGANAATELEARRDRQLIQAFIRSEPGPIRADSETNLKGDVSMGSGQEHDGFITDTLAEIYVKQKRFAKAIYAYEKLSLKYPEKSAYFAAQIEKIRNL... 327
95 4.000e-30UniRef50_A0A2N2ZGS3 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2ZGS3_9BACT  ali  21  1MQQSHFIESIKNPALLVGK-VDELLLVTKEFPYCQTTYLMMALLLKNNNDIQFDEYLKKAAVYCTDRYQLFTQL----------------------HQPSAAPTEIVSTPNLTQEEKKIENLLPITEAVVDEIPIEAVNKNNPIAEFEHEYIAQAINSSILIETTNQAVDEKEVSELTEELTEIEKNAFNLETAHTFTDWISFFNQGNVEKLPPKNEEKTLEKTNKFDLIDKFIQEDPKIQPKKTEFYSPMNMARLSVVDNLDVVSETLALVHVDQGNYQKAILMYEKLSLKFPKKRSYFATQIKNLKQKLK. 289
96 4.000e-30UniRef50_A0A1H5H0B2 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H5H0B2_9FLAO  ali  44  1MKQEEITYLLQNPAAVTLDQTAALKEVLQEYPYFQAARAVRLKGLKNSNSLHYNKALKITAAYTTDRGVFFDLITSEEFNQNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKMKIRESEQV---------------------------------------FDPDLFRKQEKTEKEEARLQIGRPLDFSKEENHSFSEWLKLSTATPVKRDEEPSEEKDDDFKSRKFDLINKFIAKNPKIAPVK--SSKKANIAEENLISPEALMTETLARVYLEQKNYKKAIQAYKILILKNPEKSGFFADQIRAIEKLQEN 272
97 4.000e-30UniRef50_A0A1G7QBH0 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1G7QBH0_9BACT  ali  21  2...TDLTEYISHPERLDRNSLFELRGLLARYPYYQTARLLLLKNLYILHDSSFGDELRKAALYVNDRRQLFMLVEGANYIIPKFKSEETSVADGGLSVDRTMSLIDVFLDSLPEEKEERREEKNDTKPVDLATDYVSYLKQLDDIKPEEGEGNANKMQGQSLIDDFIKKGDERLMLDIGAPRRKPKHVLPKFSSNADSEDDALAAEDEVVSPSVQKEMPMVAEEPKKKTI-SFIQS--------DDDAQQNAPEGVNESADDKFFTETLAKIYIKQQRYDKALKIIQQLSLKYPKKNRYFADQIRFLEKLIIN 302
98 4.000e-30UniRef50_UPI0008386846 hypothetical protein n=1 Tax=Vaginella massiliensis TaxID=1816680 RepID=UPI0008386846  ali  25  3...NRIEYLLQNPLEVISSDLSMLKKAIEQQPYFYHLRALYLFGLKNENHPSFDDVLHSTAAYSYDRENLYHYIHHSEKAQNKSSSQANERILKPIISEKAIASEPIDLVEEEFEKQASTENEELEIAVLEEVFDADLAEPFRTVEKIESEVEQQNILPVNEHVENPEAFLEETTTELTAQDTTDSETVHTTASNEATVNLSFGEWLKKSTPKQENTKVDPAKLDKQRVIDTFLANTPKISPLTKETTATPENTQHHQAEFTELMTETLAQIYLEQNKYEKAIRAYKILSLKYPKKNSYFADRISEIEKLIN. 318
99 9.000e-30UniRef50_UPI00042A798D hypothetical protein n=1 Tax=Flavobacterium filum TaxID=370974 RepID=UPI00042A798D  ali  33  1MNLSEYTFLLNNPNAFNEKQAQELEKVVENFPYFQSARALYLKGLYNQDSYKYNFALKKTAAFTTDRSVLFDFITSSEFVVLEKDHYEQKLAQLLEMEVIEMEHVEGEKTEKIEEICAISVKPTVEFETIDVDFVKIEKDIEETTSSNEVEPITNIEEVISEYNEEEKLEIGKPISFAVNEKHSFQEWLQLTSFKPINRIEETNDFETTTEKVQNEIKAAPEKLKKLAIIDKFIETNPKITPAKDLVETPSKP--FEIGDTSHLMTETLARVYLEQKKYSKAIQAYEILILKYPEKSIFFADRIKDIKILQQN 358
100 1.000e-29UniRef50_A0A0D3LAL9 Uncharacterized protein n=1 Tax=Flammeovirgaceae bacterium 311 TaxID=1257021 RepID=A0A0D3LAL9_9BACT  ali  19  1MNRQKLTELIQYPERINTRDISMLTEMAEQYPYATAIQILLAKSKQQQPDAR--QSLATAALYSPNRGVLRQVMENTLPPLSSSSPAISPAAATTDQEDPPALPADTTSQDPQQSVPAEQADNRDKEPDEMPAEEISAADRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKPHSTTQSPGGEGTKGDQNPQAVAGTAINHVPTTLQQIIEDHQEQPLENPRIQAQRSLIDSFLENGGNLQRRQPPSEEITDLTQNTSYTPQDLATETLAKIMERQGKIDKALDIYQKLSLKYPQKSAYFANCIERLKK.... 312
101 1.000e-29UniRef50_A0A1M6P7S4 Uncharacterized protein n=13 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M6P7S4_9FLAO  ali  36  1MNVTDFIHILQNSNTISPKQTRELEDIIEEYPYFQAARALHLKGLKNLDSYKYNNALKTTAAYTTDRDVLFDYITSKEFIQNNIADTIAGRGSKLEDQKAISEEIEPNPNTESMMGEADEPALPQNIKDAEQILNPELFKSKMPEEPSIPAQEKPKAETDLQLGKPIPFTKKEKHS---------------------FTQWLQXXXXXXXXXXXXXXXXXXXXXKKFELLDRFIQKNPKIVPQENIK-PKVNIKESTKFDKNELMTETLAKVYLEQKKYKKAIQAFKILSLKYPEKSGFFADQIQAVKNLQN. 291
102 3.000e-29UniRef50_A0A2M7VV26 Uncharacterized protein n=3 Tax=unclassified Flavobacteriales (miscellaneous) TaxID=403978 RepID=A0A2M7VV26_9FLAO  ali  20  1MQVNNFIQYLNQSELISTISENEILPLVKEFPYCQTGHLMYAIQLNSNNSILFEAQLKKAASYCTDRVKLFQHLHQEVVAEKSTEKEIVHQIEQNNSIVDEKLIIVNGKEEIDVLEKEYLSQAISSSILLEADEIIINPKVAVEKVAEQEISLFDGTTE---------------------------------HTFLDWLKHFSGEESRKFSGNKNNPPTVNKREINQDIITRFIQEDPRIEPKKTKFYSPTNMARLSVT-DSGFVSETLALIHVDQGNFQEAINTYEKLSLKNPKKRSYFADQIKILKLKLK. 278
103 3.000e-29UniRef50_A0A2A5B492 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5B492_9FLAO  ali  23  1MQVNNFIQYLNDSEQLKTVSEGEIMTIVKEFPYCQTGQLMYAINLKSNNSILFEEQLKKAASICPDRTRLFEYIRQNSEISSEGESTITKVKSTSDKVLVDEKLVSTAGKDELATLEKEYLTTAISSTILLESEEVFVEKIDEVKEINLFNEDVSHSF------------------------------------------------SSWLKHYNGEEQIESKKERNHDIINKFIQEDPRIKPKEVKFYSPTNMARISVT-DSGVVSETLAIIHVDQGNYHEAIMTYEKLSLKNPKKSSYFASQIKILKQKLK. 263
104 3.000e-29UniRef50_A0A1F3JW68 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_40_13 TaxID=1797346 RepID=A0A1F3JW68_9BACT  ali  25  1MNKEEFYRFLYHPELLDDRSLPVLQQILEEYPYFQSARLLHIKNLSNQGNIQYEKELKKTAVWITDRNKLFFLLDKRVLLPVSDTEIKISRSNIHENQNETLDFEALLKITEFPEAEPESYQTSEKENDELDLLIMTGSAQSSTFFEVDDKINLEE---------------------------------------------FKNTFKKKKPETQQGENPEYPEDRRKKLIDTFIFEQPKIVPREEKEPIIPSFGANKTDESPEMITDTLAKIYVKQGFYEKAVSAYEKLSLKYPEKNSYFATQIGKIKQIINN 268
105 4.000e-29UniRef50_J2J9Y1 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=J2J9Y1_FLASC  ali  35  1MNVDDYIYLINKPDAIKEKHADALGTVLNEFPYFQSARALRLKGLYNQKSFKYNYALKVTAAHTTDRAVLFDFITSDTFTPIQKEYYDEEPEKVIKEPKIIENPVKVVEVEEITDIRINPVEQSILTSIKEATAVVFEEPEKVIEEPKIIEEPVKITEVEEVKEDLEINKPLDFLINEKHSFQEWLQLSRTQPIDRTNEIPAEEIKQIKNIAEPIKEIVEEEKKKKAEIIDKFIENNPKISPVKSGSPVVSIQSDINKEDNSYLMTETLAKVYLEQKKYTKAIQAYEILILKYPEKISFFADRISDIKILQQN 362
106 5.000e-29UniRef50_B0NVF3 Uncharacterized protein n=27 Tax=root TaxID=1 RepID=B0NVF3_BACSE  ali  22  1MTSAYLQQWIQHPEMLNKDTLYELRTLLVRYPYFQSLRLLYLKNLYLLHDVTFGAELRKAVLYVADRRVLFYLIEGDRYRLKSQKSPLLSSKVPEEEPNVDRTLSLIDAFLATVPEEHSQVTELDYAMDYTTYLLQDDGQNDSEPTGGKEVPKL-------------------------RGHELIDGFIRKSESSESSVFERSVCPEKVLVSPEEKEASLEDEEVISEQKEAFSASLSKNEYSTSEDDENDDGQIRQEDVDDSCFTETLAKIYIKQHRYDKALEIIKKLSLNYPKKNAYFADQIRFLEKLIIN 288
107 6.000e-29UniRef50_A0A2E8X022 Uncharacterized protein n=2 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E8X022_9FLAO  ali  17  1MNAAQFQTWVKQGP--TASDVPALRALVARYPYSGILRLWLAKASHMAEDLNRNEDLLAAGAHVPSRRALFQALMGPALVEAAQHIHQEVLAAPEVSEEELVKLVWHDVDAVPEPAADIAAEPVLEEEAPEELEGHARDAMVAAIASTLEHEVSKWTAEE--------------------TEEVPEGIPVPEVTRQAAPTSLFGRWLQQRARETGFGQDDLAERGAAALIDAFLAKGDKMGPVRDALESTEDWAKQGLVEDPSLVTETMAKLYAQQGQMGRARKAYKLLALKYPEKSVYFAAQLKKLRN.... 288
108 1.000e-28UniRef50_A0A1F3N972 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3N972_9BACT  ali  20  1MNKNDFLSLIGSNNPIDRQILAEINDLVNIFPYFQTAHLLLLRGMQDNSDIRFENQLKNSAIHIADREVLYNLLKVSPVPFEQAIVQETAEKEPEEPAMEEPVKEEPVMQEPVKEEPLAEEIKQEASGSGDIGQTVIESAKNSEDLIVEIEKSSNEISEKEEIEDEPTEAEERVFYMDPGFSAPESEPEVTPVSELQLEQQPADEPVPAAPEVSEEDLSYRNKKVQADLIDKFISTSPRIEPKRERTDQPEDLAQQYIEEKGAFVTETLARIYVNQGYYSKAIDIYEKLCLKFPEKSGYFAAQIEKIKAIIK. 369
109 1.000e-28UniRef50_A0A2E4TDN7 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E4TDN7_9FLAO  ali  18  1MNPGQLQDILERGPR--AEDLDVLRACVEXHPYSGPLRMMXAKASEEAQDLGRREALXQAGAHVPSRRALFAYLMGSELXAEARAIXEEEDVPEEEMVSMVWHDQGXPAXXXDXXAVAPEXXAPEETSEQETEXEAPGQREAMISAIASVIEQDVSAWNEEXETDKTAPXXVPTETTDXPELXXEEGVAIPTVGQIAXPRSLFSQWLQQRARETGFGTPQLAEQGAAALIDAFLAKGDRIGPIRDSLETTEEWAKQGLVEDPSLVTETMAKLYAQQGQMGRARKAYKXLALKYPEKSVYFAAQLKKLRN.... 312
110 1.000e-28UniRef50_H8XPV5 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=H8XPV5_FLAIG  ali  37  1MNISDYIFLLNNSKGINDKQTLVLETIVQEFPFFQSARALYLKGLYNQESFRYNYELKKAAAHTTDRSVLFDFITSDEFKIFKKENYDKIQAEL-------------------------------------------------QNIEVNEFEFVQAISDHNKLDASVEKQNTIEKVEERLEIGKPLSFEKSETHSFSEWLQLSKFAPIVRENEKIAGENSTDIEKKFELIEKFIELSPKIAPTKESVPVPVNIAK-SNEMPSSIMTETLAKIYLEQKKYTKAIQAYEILILKYPEKSSFFADRINDIKILQQN 263
111 1.000e-28UniRef50_A0A256WC81 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_114 TaxID=1971631 RepID=A0A256WC81_9BACT  ali  23  1MDQQRFITLINNPDQLQPGNSNEIKGLLDQFPYCQPAQLLYLLSLLQENDVRYPSRLKLAAAYAGNRTVLKDLVDNFNIAPDKGSDAPDATVTNAQAKKNNQPTPETEIIEGRPQEETNQQNEKQADEQKEITKKELKRKWISFSKNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEKSKQVPEKIKPGPEPEKKSSKKASPHTKPKITIIKENEKKPPEKKLKTKSEINQFIENSPRISRSPTDFYNPVDWARNSAIDKEEVVSETLAKIYYNQGNTEKALKIYRKLSLSNPKKSSYFAALIEKIE..... 309
112 2.000e-28UniRef50_A0A2J6I300 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6I300_9BACT  ali  23  1MNKEKFNSLVEQPTGFTNDVMDELTYLNNEFPYCQSAHILLTLSHYVNNNIKFESKLKTTAIHVGSRKILKQHIDRLNESASKVYFYDEGIK---------------ENSEKQSAEETKAENIKAEFKQEKKKEEPKADKKEIIEKTPATNVSSANKKPEKVSEDKKLKVKIKPLEKTPDDIQKSKSIAELKKIVEKRIREIEREKKLKSEGKTEDEIPDNKTLKKDDLIDKFIKDQPSISRPKVSFYNAKDLAASSIVDQENIVSETLAKIYMDQGHFEKAKNIYQKLSLKYPEKSSYFAALIEKAEKEDNN 298
113 2.000e-28UniRef50_A0A132GTV1 Uncharacterized protein n=1 Tax=bacterium P201 TaxID=1768112 RepID=A0A132GTV1_9BACT  ali  23  1MDSKQLIGYMTRPERLKGEAVKEVEQLVAEYPYFSIGQVLLAIAYQNTDDGRYESQLRHTAAIVPNRDKLRLF------------------------------------TLIARHRLESEPEVPTLPDELPQAEKPASSDNVFSSIEAIDAKEEQNTGVIREKVFIIPEIDLSGSXXXXXXXXXXXXXXXXXXXXXKAIIANRLKEIEAEKQRKETEKPAAKKLSRKELIDKFITENPSISRPKAEFYNPISVAQNSIIDQENIVSETLAKIYEKQGYIEKAISIYEKLGLKYPKKSRYFAAQIERLQESKE. 276
114 3.000e-28UniRef50_A0A2A5G8X5 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5G8X5_9FLAO  ali  24  1MNTDIFIDCINSLHSLDNESLPLLENLLVEFPYCQTTHLLYTKNLHNQKHIRYNTQLKVAATYAADRKTLYRLIMQPV----------------------------------------------VSEIIEQIEKETAEFISPSELADKPAKKDGISPLEQEILRAAVSASIAREAGVYYAEKEPSSVEKEELSKTKISQKDKYTFSNWMKVLGSESVKAKPSKPPIDELVEKFLKEEPKIS-SKAEFFSPSNVAKMSIVDDESFVTETLAKIYEQQGNYEKAIRAYQQLALKYPKKKNTFAARILQLEKKLK. 265
115 4.000e-28UniRef50_A0A1V6JFI2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin008 TaxID=1852795 RepID=A0A1V6JFI2_9BACT  ali  20  1MDKNLFFQCLDNRDNLGQEVPGMLDATLEQYPYFLQARVLRLMAQKQHNHQQYSAELKTVSALMPNRLTLFFNLNPVEEVVKTESPTSHSATVDSDSPFALDEVEAVEQADDDTSTFANASEEVDERNGNLLELGDLETIKRMKEEAFLNPTLYTLDIPGEFIDDKEIESL------------------------------YSKSSGSEGEGQSQDQPRQREKSEQSALIDAFIEANPRIVPKDLPNEEGRDISLESVKEHEDNVSETLALIFVSQGKIAKAISIFEKLCLKYPEKRAYFAAQIEKLKNQQ.. 284
116 4.000e-28UniRef50_A0A2E7H844 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E7H844_9FLAO  ali  20  1MQLQRLQELIEFPDRVEPSDRDGLKAWSDKFPYAGAIAMLLARASAVGGHMEQEADLLKAATHVTYRRPLFDLL------------------------------ILXRLKAEAEVVNQMVSEEQDTTEXIVLHGAVDDTAPHLNPEAPMERDALIAAIGRTIEREVSPAGDAPSSQEXQDMDRIRAATVSPFSAWLVQRAAEVGFGESXDALSLSHPSATNEGLGVSDLIDRFIEQQPSIGKLREVGAXVEEWAQXSVMEDPTLVTETMARIFXKQGQIGKARKAYRYLALKYPAKSTYFAXQLKNLXRRQ.. 281
117 6.000e-28UniRef50_A0A1V5MZS4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin416 TaxID=1852814 RepID=A0A1V5MZS4_9BACT  ali  23  1MNPAQLITWLNDPASLDKDSLSPLREMVDDFPCFTAARMLYLKNLSQLNDMRYTSELVKTAIAVPDRRKLYLFM----------EDRPESSLPGLTQAGSAENRDFSLIDRFLHHVSVQEADDDLELSDNYVKPEEQTAETDAPESDAFSLDYLNYQTLYDDASADAAAFSSSQPMQGQDLIDAYLSGDHKKVEAGIPAQTTSDVASSE-----------------------------------ETPTDDATLEAMTSGLPEASFSEALARIYVKQKRYDRALEIIKSLSLKYPEKNRYFADQIRYLEQLIN. 267
118 8.000e-28UniRef50_E6SW73 Uncharacterized protein n=29 Tax=root TaxID=1 RepID=E6SW73_BACT6  ali  21  1MTSAHLQQWIQHPETLDRDSLYELRTLVTRYPYFQSLRLLYLKNLYLLHDINFGAELRKAVLYVADRRMLFYLIEGDRYTLKSQKSSLLFSRVIEDEPSVDRTLSLIDAFLATVPEEHPRNMELDYAMDYTSYLMQEEETDGQLEVCAEAVEIPKLRGHELIDGFLLKSEAADMRLLEMKPDIEEEHPAGTNVGEVRDEETEASEMKEAMEDETPAE------------------------------------SHVVGDSDDSCFTETLAKIYIKQHRYDKALEIIKKLSLNYPKKNAYFADQIRFLEKLIIN 277
119 1.000e-27UniRef50_F2IBF9 Uncharacterized protein n=1 Tax=Fluviicola taffensis (strain DSM 16823 / NCIMB 13979 / RW262) TaxID=755732 RepID=F2IBF9_FLUTR  ali  19  3.NTEQIAEFIVNPDLMRPEDVDVLRTLSEKHPYSSVYSLLYLQGVSRFQSIHLDEVLPKQAYKLSDRTRLFHLLHSAFKGEALIENSTEEVVATEVQSKTEVVTHVTEKTSEVSSDKEEEPTQEPITAITSEVKTVLEDAPEIELIEEQATSPEPIVEKDIFDFETVAATLSQDYLTVEPVLHEINEEPSIESHIQETSIEEPIQEEIPVIKPVQTDEKKEVKASQQEIIDKFIETSPSMPRPKTEFYSPSKKAKESLDDEKIPVSETLAKIYAAQGNFPKAIHVYHQLSLAFPEKKSLFALQIEELKKKI.. 334
120 1.000e-27UniRef50_A0A2E2FF95 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E2FF95_9FLAO  ali  20  1MNPQDFIQVLTHQKAVSSLNEDELRFLLNEYPYYKEAQVALAQLMXEKNHLHFHKQLRIAAIHVNDRKSLYNLIYKPALQQTIETYSKITEEIVPDETEAQSSTGVDEQEIREAFNTPIPITQLGSHSKKGEPVEQPQSEQDKETSDLKVHEQEERDLGLLEKEILSHAFSLETSYDSFVEEEPSSDETKKPTSEKDXQIEAAKNLSEWLHQLDRKRQTPPKEESK-EIIDSFIESQPQIXRERSEFFSPTNAAKMSIVDSEEFVTETLAKIYANQGNKEKAISVYKKLMLKYPEKKTYFAALIEKLK..... 308
121 1.000e-27UniRef50_A0A2M9R5X9 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium UR159 TaxID=2008672 RepID=A0A2M9R5X9_9FLAO  ali  32  4..TQVYKQKIQFPESIGSDDLGWLQQIVATYPYLQSAHALLLKALYQQEDARYNAGLKTTAAYTTDRDLLFDFIISEEFNSYQPIDIDTIDVFDVEEISHHESAVSNNIQPAYIQPEEENKLENEHLEEKLEIGKPLKFDASEKMSFTEWLQLTKTEPLSKLP----------------------------------------------QSTQKETSGEDTGLTKKLDIIDRFIENNPKITPVKTSSNPPS-VEQKSDESPSALMTETLARIYLEQKKYQKAIQAYEILILKYPEKSSFFAERIEDIKKLQQH 267
122 1.000e-27UniRef50_F0RCC2 Uncharacterized protein n=5 Tax=Cellulophaga TaxID=104264 RepID=F0RCC2_CELLC  ali  32  1MKVTDFTHLLQKPESISSVQINQLEEIITDYPYFQAAHAIHLKGLKNTNSFKYNKALKVTAAHTANRDVLFDFITSPEFLNNTTTIKEIRENANLKKLNVVSEEVASPPNMLEESEDKPLPQNIDDAEKILDDTLFETKEVIKEEVVETEKELEISNETQELEIKTQEEALKNNAEETREVIPTEKLGEEKTEAEKLNIGEPLHFTKKEKYSFAQWLELTNPKNKKFDLIDKFIKTNPKITPTKNI-ETKVDISSSVKLNKDELMTETLAKVYLEQKKYKKAIQAYKILSLKYPEKSSFFANRIKSVEKIQK. 344
123 1.000e-27UniRef50_A0A2A5EF09 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A5EF09_9BACT  ali  18  3.NTLNISSYILNPKGIGEEGIKQLTQELKSMPWCAAYRVLLAKGYDNENSFQKNRHLRLAATYVGDREQLFLLTHDQAKQVAQVDFQENVLVTTTVEDVVEQTADEVKRISGVEDATLDLEDVLKLEGVQNISEESLTQESKIDFDEIVKYDPIKELKIIETPIKRKSEKIDFDYVAYNPEKELSKLVAEKEEKESHDFMFWLNHMEDDKEAIIKSSKSAKSPDKVQDLLDQFLATKRSRPIQNRQFYNAQNKAEESETDDMGVLSVTLLELYVKQGHTSKAIKGYQKLSLQNPSKSAYFAARIKELEENKKD 318
124 2.000e-27UniRef50_A0A1F3C796 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3C796_9BACT  ali  23  1MNSSDLIKYINNPDLLNNESISEIRKILSDYPYFQTAHKLILKNLKLVDSDLFQNQLNSSAIHISDRVLLYNYLQNDIAKKPIQYQETKESEKKTVVIEEEKAVESEKKKIKIDETEKEKSPKEIYFIEEERIAKSKKDLKIAADSSESSEVNKDLLFIDDENNGAKLGETNLKVSSNNDDYQSDXXXXXXXXXXXXXXXXXXXXXQGFDISDYAEKDDLLINSDENDLISKFILKNPRIQPADLDEYQILDISEKSAHEDENLLTETLAKVYIAQGYFEKAIHSYEKLCLKYPEKNTYFASQIEMIKELIN. 357
125 3.000e-27UniRef50_A0A1M4T7H4 Uncharacterized protein n=3 Tax=Dysgonomonas TaxID=156973 RepID=A0A1M4T7H4_9BACT  ali  21  1MNIRDFYQLVELEREPDAGMLTQLQFLTKKYPFFQAGIFTYIKCLYLLEDDTFRNELKRLAAFVIDRKALFYYVMNNQFKDFQKQAEKRLTQDRTDFLINAFFDTLSDKVEEERRLEHAIVNSSMASLDYFSYLESESSIQTEINLGKEKKSKTDEILENFDFGSLPEDISISESYTLTEETTDEEPPVSVPEEPITEETSEDSKTPSLKHQDIIDRFISKAENRDDIRIKMERSDSSDEEDMDNMDEDMDGNASEKELDDDIFFTQTLANIYIKQKKYNRAYEIIKRLSLNYPEKNTYFADQLSFLEKLIKN 313
126 2.000e-26UniRef50_A0A1I1JK96 Uncharacterized protein n=5 Tax=Parapedobacter TaxID=416949 RepID=A0A1I1JK96_9SPHI  ali  18  21................TGVDGDMLAMLIEKYPYSQPLHYLRVRKQKEYGTFDSETAL----LYAGSGDWLYGLILSDGSGPAVPEPEGATGDVPLTGTERAVDELAAVDISITSEGQPAESTPASDAETHITDEHEKVSLYHDEHLPYSFLWWLNKTRMEHAHTYQPYAPLNSRPPHASPATLKLDEAQLLDQQIRENIFHLQSPEEKLSDEHRTRTVSFQIPKKTDPVIERFIREEPQIKPPSPDKIDMENKARKSAEDQLTLVTETLAKIYAEQGLYPKAIAIYKKLSLKYPEKSAYFAAQIAELENKLK. 356
127 2.000e-26UniRef50_A0A2E7AZJ7 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2E7AZJ7_9EURY  ali  21  1MNVEKLNELMTLDNSSLAERRDEIAKLVEDYPYSGPFRMLLAKASKESGHLDQRKDLLAAAAHCSSRKALFDLMFSEHFVEQAKAVQQEIENLDEVSEDELIDLVWHPVDDDKQAPSEIIAQEREEVVEAISSILEEDTPEIFSEEILEDSESETSTS----------------------GFDTEEPQIRAGGSAESLFGKWLANRAKATDFGKSKKSKDRVERGAAAIIDAFLSKNPQIGKVRDVDSPVQEWASKGLEEDASLVTETMAKLYAKQGQMSRARKAFKLLALKYPDKSVYFAAQLKKLSKK... 289
128 2.000e-26UniRef50_L8JKB2 Uncharacterized protein n=1 Tax=Fulvivirga imtechensis AK7 TaxID=1237149 RepID=L8JKB2_9BACT  ali  14  1MNKQKFTKIIQNYHNIPDDDREKLHELAKTYPYSQVIHTLVAKANHDAQTSIASQTLNYAAMYATDRGVLKDVIQLKATHTNAPELTRPATIPSGTKEVDEVNPSAKTPVDSKPDQTPVISREEKKITVNLEEINPEGDLIRDEIWFELEALKKSKATYMEWLKETTTGSEDTLPIAGDEKAPKTSEKTSTQKEKKDTKKHQETTPDIKSGEETAKKKPKAPKEDQNKLIENFISKEPSITKPLKSSENQPDLSAASTSFNEDLVSENLANIFINQGKRDKAIDIYKKLIWKFPQKKAYFASRIEELQK.... 333
129 2.000e-26UniRef50_F0NZL8 Uncharacterized protein n=3 Tax=Weeksella TaxID=1013 RepID=F0NZL8_WEEVC  ali  24  1MMETRLTFLLKNPLESSIDDFSMLKKSIEKYPYFYQIRAIQLYALKKENHPSYEDFLHLTSLYSHNRAELYHYLHTQKKGEEPNVEEIEDEEIIEPNTLENIIENVVHPTEKQEDGKELAEPHPKEIISPEEEFVDKIKEETQPSESVGTENKAFENTTSEIVANTVAEQNINHPSKKSEKATQTDEMASTSLVTEKHTFSDWLKMGSTKTEKKEEEKATTAQKEKLKIIDTFLQNAPRILPLDKDFSSNTPKTPQEEQEFSELMTETLAQIYTDQHKYDKAIRAYKILCLKYPKKNAYFADRIQEIENLKN. 334
130 3.000e-26UniRef50_A0A2N5ZH77 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5ZH77_9BACT  ali  21  1MKETEIIKYINQPELLIDCNLEQLKYLVYNFPFFQSAHILYLKALLIHDKAKFKKQLPKSSTYISDRDLLFTFLNRELELKEQQVVSSNDDVDEPVKDHKLLKNKDIRRRINNSFDGMGENISETISSKIEFSSVKEKDTLEYPSEIYFIEEEREGKNNIITIDADPDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESFELLEMDESVPKERGEVKKKDDLIAKFIEKNPRIK-AKEIDHEIKDISQDSIKEDSNLLSETLIKVYIKQGLFEKAIESYEKLSLKYPEKNTYFASQIEILQEKLN. 329
131 4.000e-26UniRef50_UPI0003459A81 hypothetical protein n=1 Tax=Nafulsella turpanensis TaxID=1265690 RepID=UPI0003459A81  ali  18  1MNKSHFIEFVENPAKLKARDADILAELARNYPYSSLVHILQAKALQQTDKARTS--LATAALYIPDRSVLKMVMENTLVQPKNEAALTTPPYPEEGEHKPVKVPVAIITKESTAEKPVAESSVVPEIPERAGVXXXXXXXXXXXXXXXXXXXXXDEVSGEASIQETGSAADDTHIRKKVHQPLPER-------------------LQEIIENREEQEIDDPKRKEQINLIDSFIQNSSAIARKDDQKQAQDDLTSHYSLTPHDLATENLAQIMVRQGKTEKAIDIYEKLILKYPQKKAYFASCIEKLK..... 291
132 6.000e-26UniRef50_A0A2E6SXT2 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E6SXT2_9FLAO  ali  20  1MNKELFNQLIQEPSNVDPQYKDELKELVHSFPYSSNIRMLYLSALLNDADVLFEQELKKSAAFITDRRVLKKIIAPASRKEDYLINNTPLKVVDQKEEDIPSSEIPVDTDSKNDHHIEEEKPKISEENPPDKVDELDELIISSAIDASLSLEISEAAEELKTEPNTKTGESEEHLSNQTTRVSTPDQKQDEGSPKTFLEWIGANDIDKGPALPKKELERIEFKRKAELLIDQFIENQPKIKP-KTEFYSPENMAQKSIEDNGEIVTETLAKVYANQGNIQKAKSIYKQLVLNNPEKKHYFASLLKNL...... 329
133 8.000e-26UniRef50_Q89ZK0 Uncharacterized protein n=13 Tax=Bacteroides TaxID=816 RepID=Q89ZK0_BACTN  ali  23  1MTSVNLQQWIQHPETLNRDTLYELRNQLARYPYFQSLRLLYLKNLYILHDINFGAELRKAVLYIADRRKLFHLIEGERFAVESQKKGLPLSEVLKDEPTVDRTLALIDAFLSTAPEEVTSQTSFDYSMDYTAYLLEETPVADEPAEAMPKLK---------------------GHELIDNFIEKSETDPVVYLKPLREEEKAKAASSAETNETGRTDETTETNTIEEEDDSCFTETLAKI--------------------------------YVKQQRYSKALEIIKKLSLKYPKKNAYFADQIRFLEKLIIN 260
134 8.000e-26UniRef50_A0A0Q4GKT6 Uncharacterized protein n=11 Tax=Pedobacter TaxID=84567 RepID=A0A0Q4GKT6_9SPHI  ali  20  3.NKKLLADLLAQPGKVGPEHVSMLQDMVQQFPYAQPIHLLLAKALYSQGHVLFTEEVEIAAAQTVSEEHLPAAENINIETPDYLPGVDRHLMDLPIDEDSFIESVAAVDFFAFEQKLSTDVVTQAPEIETVVPDEHERNFVSQYNDDKLPYTFLWWLAKTRKEHEQIFQPYAHASSARVKPQTPHTQQQPEFQQQYVEHIFHIQTPFEVADHLAEYPAGEIKDAKGAEIIERFLKEDPTIKPPKPEQIDNENKAKKSAEDNYDLVSETLAKIYIEQMLYHKAIDTYKKLSLKYPEKSRYFADLIQSIEKK... 346
135 1.000e-25UniRef50_K1L305 Uncharacterized protein n=3 Tax=Cyclobacteriaceae TaxID=563798 RepID=K1L305_9BACT  ali  18  1MNPLQLLGIIQHANHLSKDDFTELLKLHEAFPYFQIPKVLLAKYEFDKSNAQVNELLHWAAITSPDRVWLRKMVETKVPFETREEFLKKKLIEVTESKKAIEGKNLIDDLEGQLIPENKKVTSTKDLTATLKKLGEDLAQSKIKALEKLEKGNIKQDPSQEVITPEETTPKTPPVETVKIKPDKTQKPENKSSAKNPKRRVHKDELIESIKKKEKKEILDKKKLEQIDIIKAFSKKEIKLATIKEIEQRQEDLSENSTKLNPSLITEAYAGILVKQGKKVKAKEIYKKLMVKFPEKNTYFANLIERLEK.... 311
136 1.000e-25UniRef50_A0A2H0IRQ2 Uncharacterized protein n=1 Tax=Cytophagales bacterium CG12_big_fil_rev_8_21_14_0_65_40_12 TaxID=1973954 RepID=A0A2H0IRQ2_9BACT :  ali  22  1MNKERFNHLLSHLNDVTNEDIKSLNELRKKYPFFQTPYVIVAKALKELDHPKTDAFIKKAAIYSPDRAHLKKIITGELVF----------DQVETKEIQVDKSESKKEKAEVPKSDAVQPSEAIITPPTVEVKVEVQAKANEITKDQEAVLVKAPMDSSTLVKPNQQKAFEKTAPSKLGKTDQXXXXXXXXXXXXXXXXXXXXXLNQQEDDVEQTKSSKKKTSKSQVELIEKFIQNEPQFGKPKESEYLQEDLATKKLKYQDEFATETLAALLFKQKKYERALDIYEKLSLKFPEKRTYFALQIQKIKE.... 303
137 2.000e-25UniRef50_A0A0R2T1A0 Uncharacterized protein n=2 Tax=Flavobacteriia TaxID=117743 RepID=A0A0R2T1A0_9FLAO  ali  31  1MQVSRFTDLLEKPEIIQESDLSALRQIVETYPYFQAARGMELIGLKNANSFKYNAALKKHAAYTSDRSWLFEIITQEAFNSQTKVKKAPQTSLSKETDLAKQGAEPSEIPTITQKYTEED-----------------------------------YTEQTSDKKNDSQQVKEANFSSLELGKPLEFNKNDRYSFEEWLQLSAKNSVENKTETSIVKTSDTPKKAAKMAQINAFIATNPKMSTPLTNPEEITIKDAQKIN-KEALMTETLARVYLEQKKYKKALQAYKILSLKYPEKNSFFASQIKVVQKLIK. 277
138 2.000e-25UniRef50_A0A2W1K8S4 Uncharacterized protein n=2 Tax=Mesonia TaxID=232115 RepID=A0A2W1K8S4_9FLAO  ali  37  1MEKEEYIAKTANLETVNHNDLHELDLLLAKYPYFQSARAMRLKLLKNTNSFEYNFELKRTAAYTSDRTVLFDFITSVEFDQNQLSQEIKARETEEA------------------------------------SFAAKQNSAVSEKPTHNFEMEDHEVNQVLDPELFQTKSNETEIEDEDKIELERSELEIGKPLEFDQTETHSFTEWLKLTSMKPIVREKSEKEQNFELIDKFIKENPKINPSKENSPTVPVLEPSST----NLMTETLARVYLEQKKYDKAIQAYKILILKYPEKSSLFANQIRAIENLKE. 272
139 3.000e-25UniRef50_A9DPL7 Uncharacterized protein n=2 Tax=Kordia TaxID=221065 RepID=A9DPL7_9FLAO  ali  31  1MNISDFTYILQNPVHINAAQTKAIEAITKEFPYFQAARVVHLKGLKNQDSFKYNQSLKTTAAYTTDRSILFDFITSKKFEQHKISSTITESQNNTKEIEVEVEEIKIDKNLRMEDAIKTKLQEANAILDPELFQPKATPITIAAVPNDDTEVEVENEVEAETDVKIESEVISEEIASNXXXXXXXXXXXXXXQLTNLKPIDRSDEVETKVKTEPKITIKAEKKEETTPKIDATIEVSEEEKQKKPTLEKTINLANDTSVDQSMLMTETLAKVYLEQKKYRKAIKAYDILILKYPEKSGFFADQIRAIKKLQQN 376
140 3.000e-25UniRef50_A0A1I2T7R8 Uncharacterized protein n=1 Tax=Pedobacter insulae TaxID=414048 RepID=A0A1I2T7R8_9SPHI  ali  19  8..KKQLTDLLARPAMVSDAHMDLLTDLIKTYPFYQPLHLLLAKAS--QGTSNYEHALATASLYNGGALTYQMMFRPETLVEADVQDKVNDEQETFEEISEVAPSDFFAFEQNFSTEQADPLHKGDSIVVVTQPEEYNQEAEAQSTVSKYDDDKLPYTFLWWLAKTRKEHEQIFQPYVTAKQQQHSAPI-GELQHQYVEHIFHLQTPFNVGEEAKRGPVNLQAQPKGTALIDSFIKNDPQIKALKPEQINTENKAKKSAEDNYDLVSETLASIYIEQMLYHKAIDTYEKLSLKFPEKSRYFADLIQSLEKKI.. 349
141 7.000e-25UniRef50_A0A1M4WQG3 Uncharacterized protein n=1 Tax=Flavisolibacter ginsengisoli DSM 18119 TaxID=1121884 RepID=A0A1M4WQG3_9BACT  ali  16  8.....LAQHLFGKATIDECDLSEVKGLAQRYPYFAPAQFLLLEKLKQEGAEAYNAQLQKAILYYPDPLQFQYFINSGRYYTEISFDDQEEQDARDFNTTLEETEVGTGLEIAEVPMEEPERGHEPEADNEPVTIEPEVPPTLMEPDKENEINNTHITAVSETGISTVDETTEQPPAPVAGLLKDKLNEPVKDTGISFEPFHMVDYFASQGIKISQEELPKDKFGKQVKSFTEWLKTMKRLPAVDAGTETKVQNMALNSIHDASVWTEAMAEVWVKQGNASKAIEVYNKLSLLNPSKRAYFATKIENLKR.... 340
142 7.000e-25UniRef50_A0A0T5VMN0 Uncharacterized protein n=12 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A0T5VMN0_9SPHI  ali  20  3.NKKLLADLLAQPGKVGPEHVSMLQEMVAQFPYAQPIHLLLAKALYSQGHVLFQVVFEETGELASDLHSENPVISIETPNHLPGIDSHLMDLPADDDSFIESVAATDFFAFEQKLSTDVVTAAPEIETVVPDEPERNFVSQYNDDKLPYTFLWWLAKTRKEHEQIFQPYAHPNAGKVKPQPQNNQQQERAEFQQQYVEHIFHIQTPFEVADHLAEYPSAEIKDAKGAEIIERFLKEDPTIKPPRPEQIDNENKAKKSAEDNYDLVSETLAKIYIEQMLYHKAIDTYKKLSLKYPEKSRYFADLIQSIEKK... 347
143 4.000e-24UniRef50_A0A2D5KC78 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5KC78_9FLAO  ali  20  1MKKGEFIAYVQEPSALKADDISSLQNILSEYPFFQSAQLLLSKVFQQEENINFEKQLRKSAAYAANRKRLHSLLFSDAKPNEVAAKTETEDVSLKSKTEAPSVQEKTPSEEEDLLNQQILTEAISSSILTEVDERVDEINKESQQQEFQRKEEKAQPTVSKSSFDENRSHPFSEWLSHFSEEEAKTKKVWQAASPETQET---------------------------------IKRFTKVNRPKQEFYSASKMAKLSVQEDGDLVTETLAKIYVAQQNFEKAIKAYEKLQLKYPEKKVYFAAQIQSIKNQLN. 279
144 5.000e-24UniRef50_A0A088EU21 Uncharacterized protein n=3 Tax=Sphingobacterium TaxID=28453 RepID=A0A088EU21_9SPHI  ali  17  9.DINLFHQAINNPLTLSESD---LLSLIAKFPYAQSLRFAYERHLYLLNKEVHN--ISSTLLYAANPNWLYEYLHKATPVEPTAEVAFEDDEYIDFEDTTDEEVEEQESEDVYPITETILPVETIIEKGEEERVSVYDDDLLPYSFLWWLHKTRLEHAETYQPFLKAPIFRPEPVEQDITRFKQTIDSQLLDQQIRENIFHLQSPEVKLSEEFKNTVPFQVEKKNTDHLIERFIKEDPQIKPPPADKINLENKARKSSEDQYSLVTETLARIYIEQGLYPKAIEVYKKLVLKYPEKNAYFASEILNLEKKL.. 350
145 6.000e-24UniRef50_F4CAQ1 Uncharacterized protein n=3 Tax=Sphingobacteriaceae TaxID=84566 RepID=F4CAQ1_SPHS2  ali  19  9....KFNGLLADSTQMKQEDLALL---LQAYPYSHILWFLEAKRCSQDKGDQ-QAIFKKAALFASDPEQLYNFIYNSPLNDLTLSQDDAVAKLDISEAAIVEEDVIDETIESADEPEVIYTEEDQRVPTGVAPPSPEETEASREDVSKYDDDLMPYTFVWWLHKTRLAYADTYQPYATNRKPSLKKLQNDISDQQIRENIFHLQEPEEKLSIKESRTITFKVPKKTDEIIERFIKEEPQIRPPQASQITLENKARQSAEDQSNFVSETLAQIYEEQGLYHKAIDTYMKLSLKYPKKSAYFADRIKALESRIN. 333
146 6.000e-24UniRef50_A0A1I0QW63 Uncharacterized protein n=1 Tax=Fabibacter pacificus TaxID=1267423 RepID=A0A1I0QW63_9BACT  ali  20  1MERERFNTLLQDPAKITNNDIKALNEYRKKYPYFQGLYVIVAKALQQREHPKTEAFIKKAAIYSADRSYLKGIIEGEYTFPSKPDKVTTQQVKSEEKEEVKQEEKVIPKAEKKPDTQTTISE--------------------QQPEKQAVAPKGRKPEAKVEAPKPAPKAEAQKPEEYDELKATKLRIEALLRGELPEEEKPTETPQAPLEDSPAKAKTKRAKASQVDIIQKFIDTDPRFDAPYEETEPQEDLSQKNLKNSEEFFTETMAELMLKQKKYKKAINIYEKLGLKFPEKSAYFARQIEKVKSEYN. 297
147 6.000e-24UniRef50_A0A1N6WFX2 Uncharacterized protein n=11 Tax=root TaxID=1 RepID=A0A1N6WFX2_9FLAO  ali  31  1MNVKDFTYFLEHPTKVEPIHTKHLEDIIDEYPYFQAARALHLKGLKNLNSYKYNKALKVTAAYTTDRDVLFEFITSKDFLQNQIETIEKEDHPVPTEKTSTLDDSNTAVKTNEIEITEIDTSDTITAATTPSLIPPSVDKPLPQDKNDADQILDPKLFQSKKPSNTEEEEALDIGKPLTFNAKEKYSFSEWLSLASKNPLEKSDALITGNNEDEITEQQTEAKERSTEKAAQEIQEQKIIPRPSKKPSAVIDISKSSRIDHNELMTETLARVYLEQKKYKNAIQAYKILSLKYPEKSSFFADRIKAVEKLRKD 372
148 8.000e-24UniRef50_UPI0004256671 hypothetical protein n=1 Tax=Eisenibacter elegans TaxID=997 RepID=UPI0004256671  ali  16  1MDAETFLYWIDDPNRINDNDLEQLEDLAREYPYFQLAHQLIAKGTKNKPSVSLPVKLRKASLYAYNRAVLRQLMEVRPEDIQIIPAEQPIDPYQAVEADSTNETFAPIPVPTDEEPEAAFVPTPEEDTTPVSHDPTADIPTTPAAADLPASLEGIALNEGIAMDLFNDGRIEEAILVYQHLAAKQPDKHSYYQTQLQIMTDNDYFVLQVPEDLRQVYHPTQDTPAPQTETPDTTSFFDTLPPEETPSTPNNAPEASSTTGDETAVTEFQASQLYEDGQYEAAIEAYQQLSQQEPDRAAFYALQIQRIERAI.. 321
149 9.000e-24UniRef50_A0A2G4HCU7 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4HCU7_9FLAO  ali  19  5.DAARVQELWANPDRVAASDLVWLEELVAAYPAAVPLWWLYLRAVQRAESPKFAQVLQRCAAISPDRSALMSWVEEPLIPQAKGAKPESKVAKQEPKVAKPEPKVVQPEPEPKVVQPEPEPKAEVPLTAPALPKEIDLDSLPEKTNTASEPHAAVFVESDPREIPILAEPVTKQDAPPKPAAKAKQEVVLKPTLATEALPSAVTGLSPFAQFVARLSNAAPVGPNAEDLIDEFLSTNPRISPLEKRDKDVSEPIVRSSALVTGLVTETLARLYADQGHAAKAIQAYEILKLRVPEKSLIFAARIEALRN.... 345
150 1.000e-23UniRef50_M7N5C8 Uncharacterized protein n=1 Tax=Cesiribacter andamanensis AMV16 TaxID=1279009 RepID=M7N5C8_9BACT  ali  18  1MNRTKLTELINHPEKVTSRDAAMMADMAAQYPYAAILQILLAKS--QQQHEQARQYLGTAALYTPNRSVLRLVMENRLPGLAAQAAEAPQPPLQQPQASASQQESSPHISTA---------------------SGNEQLLDRSPEPETDEHQGPSPDFYNELQENLRRLKANRTKSSSASTGSPEESPTTENAQVPEKAPPISPTVQQIMQEHQEQTLENPRVQQQRSLIDSFLQNGSMLPRQPASESPQADLSQPATFTPPDLATETLAAIMERQGKTEKAIDIYQKLLLKYPQKSAYFADCIERLKKI... 292
151 1.000e-23UniRef50_A0A2T2VA95 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium SW_11_45_7 TaxID=1919113 RepID=A0A2T2VA95_9BACT  ali  18  1MEQETLFRLLDDPSRIEECSIVSLEQLVQRYPWVPTFHLLLTKKYQLAGHDGFDSQLQKTALRAGHRQRLFTLINELPKGVAQEPERVEGDETKEAQKQEPKGSESNDRQEDEANDQEGQVAGPSIPMEEAEAYHRFMKEFGIIQESSKKGQPEKSNYKEDTLNPRDQETQMGANQQEEKPGPAPQTSDDRAGEEIAEDEKASRSFTQWLALFKQQQNPQHSTGKQQQDQAPFQXXXXXXXXPPDEMEKVSEQAEKSVEESDEAVSQTLAQIYKSQKKYVKAIAVYEKLRLKYPEKSSYFVDKINELKK.... 331
152 1.000e-23UniRef50_A0A081PF71 Uncharacterized protein n=7 Tax=Pedobacter TaxID=84567 RepID=A0A081PF71_9SPHI  ali  20  8..KNQLSELLADPAKAGPADRFMLQELIQEYPYFQPLHLLLARALMQEQPHEILHVLSAAATEQPAETENTEYRPFRNGTQPAADAPRRPSPEHDFAVESIASSDFFAFEQNFGTEAPAEIQEQELQVTAPVQTEEKVEPAEPEEKSSVSNYHDEKLPYTFLWWLAKTRKEHQSIFQPYAVQKTRNNDSPELQQQYVEHIFHLQSPLTGQAELPEAEDKPKHTGKEFELIESFIKNDPQINPPKAEQIDTENKAKKSAEDQNDLVSETLANIYIEQMLYDKAIDTYEKLSLKFPEKSRYFADLIQGIQKKI.. 363
153 2.000e-23UniRef50_A0A2T4X6T9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4X6T9_9BACT  ali  18  1MNAENYAEYLAQPAKLYQLPYQEIKNLVEEYPFSANLRWLLTVKSKIEHDPKFEQHLHQLAAHTFDRKKLYQLVNEDLQQLAEAEKIPVVRPPEQPAAPAAQMTMSPPPPPAPGTLEYLDEDDFFLPAAPPPLPGPPPASSAPPPAELPAVAPPPEENEQVQPEQVPALTPATEPLREIEWEIAPPTYLIPAEMVTALIGFSILPQEKLAPLPTTVFDSWNSLREQDQRRQLVRLRQRAVRGSSTPTPQKRQVAKKSLQEQPDLASETLADLLARQGQYAKAIKIYQRLSLLNPEKSVYFAATIENLKQKL.. 329
154 2.000e-23UniRef50_F0SF38 Uncharacterized protein n=1 Tax=Pseudopedobacter saltans (strain ATCC 51119 / DSM 12145 / JCM 21818 / LMG 10337 / NBRC 100064 / NCIMB  ali  21  34..........FDLQNLSEKDLEDIVALKETYPYCHAFYLLAAKSS--VGSSSYDRYLAEAAANVPSRNVLYDLIHQPERHTTSGEEKVEVEIDNLLEESTVQGAPYIETIGDEFLKEGDQVVKKIEEESDSSSENLPAIKEQGNIFRYHEERLPYTFLWWLNKTRKQYENIRPYADYYLDNPAPENSSPKDALEHQIVENIFHITSVDEVENNKQTVPFDFMINKQHHIIERFIKEEPHITAPRADKIDTENKAKRSSEDNNELVSETLARVYVEQMLYHKALDIYKKLSLKYPEKNAYFASQIKYLELKVN. 384
155 2.000e-23UniRef50_A0A1M6WDL1 Uncharacterized protein n=1 Tax=Chishuiella changwenlii TaxID=1434701 RepID=A0A1M6WDL1_9FLAO  ali  25  2...TRIEYLVAHPYEVEKSDIPLLKKEVEKYPYFYTLRALLLYGLKKENHPSFEDYLNKTSIHSSNRVDLYHYLNSEKIEKKDNFKNDTNLDETPSFEEKIQEESISVINEVKEEVIEEFTPTNIEETIELIQEIEEVPVEQENNLEDDILNALQQTSEIEVEEEKNIVNDPIIKEEETIVEEIKAENIDSDSTHSFSDWLKRFPSQQKDQKTLEEEQEIAEREIKYKLIDDFLEKNPKIVPMKKVDIPSPNTTSNNSEEYSDLMTETLAQIYIEQKKYDKAIKAYKILILKYPEKNGLFANRIKEIENLTN. 345
156 2.000e-23UniRef50_F3ZNL5 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=F3ZNL5_9BACE  ali  20  1MDYSTLKKWLESPHQLSEQDFIELSDAIVDYPYSQPLRLFFLVQLKTRESEQFSEELKKAALYIADRKLLYFILEDNSEKEVLPTKNGIIREEQRTVIKPAIIKETVKKATNSSSILSDEMAPEDHTDQTLDLIDSFLSTLPQGELESDGLELASDYTSYLLDEEEINSAPPLDGQDLIDEFICIHKSGNQKSGNVPDFKKISMDTPQEGDVEISEPES----------------------------------------EDEGFFTETLAKIYVKQQRYDKALEILKKLSLKYPNKNAYFADQIRFLEKLIIN 273
157 2.000e-23UniRef50_A0A2W4P3G7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2W4P3G7_9BACT  ali  17  3.TKNQFIKILHGYLSSTEEDAWQIQALKEAYPYSQVLHVLAARLSKDHHLPTEQADLQRAAVHAGDRAVLKDIMTRIHTPEVVEEHAVAEDVMNELNRLHELRQNFENLFEAESARIAEAQAEAQTEEVTSTEPEQPETPPVATEPKKPRGRVGRKPGRAKAQRIIELARALNAQHQQQAASAESEQPKKSSGQKKNAASPDDLILDAIEQSKKKLAPASERQQEQLEIIDEFINASPSISSIRSRAAAVSNDDLSQVEFGDHLVSETLVEILVNQGKKERAIEVLKKLIWKFPQKKAYFAAQIEDLRK.... 327
158 3.000e-23UniRef50_UPI000487497D hypothetical protein n=1 Tax=Crocinitomix catalasitica TaxID=184607 RepID=UPI000487497D  ali  22  5...EDISNWIAEPRKITQAPAEELRLLTEKYPYASSLQLLYLKLLADQNDLKFEATLKKVASNVMDRERLYAIIKLAPIEKDIQVVAEETIETETPIISEEIDIPTINEMPVEEVISNMEIPSEKLDKPSDLSPEIEDVVDPILEPIKIVEEPIIEVVPQEKKNITKKADNRIVAEKSEPEVLAKDLSFVDWLKLKKQQDKKANSVKKPVHVREKSPKREKRSTDISALLDKFIAEEPSISRPTKDFYNPSLNARNSVEEVSDLVTETLAKIHVIQKNYRKAIHAYEQLILLYPEKKTFFASQIEKIKQEI.. 330
159 3.000e-23UniRef50_A0A2W5V271 Uncharacterized protein n=1 Tax=Azospira oryzae TaxID=146939 RepID=A0A2W5V271_9RHOO  ali  17  1MKKDRFLLLVQNYTSLSEEEAIELDILQRDYPFSQIIHHLATRAAQDNQLPTHKQLLSVSAVYSTDRSVLKELMTEPKSERKTVIPPDEPVVIEAEKPTHKEDQVVYEPLVMPTVAHSSSTLSGDSLISEIKSDLSRLKELRHHFELSLQEFEN----------------------AHAHPTPLAESKKPAKKSKIIDEDDHLDELIEEIRNKKEVDSDSHRQKEQFHIIDQFIRKSPAISRGKATPEDAEDLAEKSSAFGDHIISETLVDILLKQGKTDKAIEVLRKLIWKFPQKKAIFAAQIENLRK.... 289
160 4.000e-23UniRef50_R7ZP20 Uncharacterized protein n=1 Tax=Lunatimonas lonarensis TaxID=1232681 RepID=R7ZP20_9BACT  ali  18  1MTPQELLRIINRGNTLDDGDLAKARQLADEFPYFSIPQIVAAKAAARTENENAPFYISQAAIRVPNRSRLKKLIYEEWTFIPVPTFTPERIPSDEPLPTPMEQTEVPEDLVADPSTLKEESIEPT---------------------------QPDESPSAGPXXXXXXXXXXXXXXXXXXXXXGLENPSEPKSSQPANQTQSTDELIESIKKREKKEISNDKGREQIEIISQFANKSIRLSPLDNPMEPPEDLSVKSTQINDSMISEGFAKILVKQKKLQEAIEIYGKLQLKYPDKKAYFADCIKKLEKK... 286
161 5.000e-23UniRef50_UPI0009B1908D hypothetical protein n=2 Tax=Spirosoma TaxID=107 RepID=UPI0009B1908D  ali  18  5.DKETFSYWVTHPDDLSATDFVQLQESLQAYPYCQSLHTLTAKAASVHLKAQTVPFIRQAASHALSRNALRKLIDNEFQWSENLLMKLNELSAKHVPIPDDYQQESYALFKSKAGLGSTFPSLSLLRLPGQTALPPVEAE-------------------------------------------PPVTVPTPEDPTLAETNLQNELEQIAEATPPALSPADLERQRQLDLIDSFIKKEPRIPPVRAEPLEQEDLTKRNKPGGGGFVTESFAKILEKQGKIDKARDIYEKLMAKNPEKKAYFAAKISELTESKN. 275
162 5.000e-23UniRef50_F4KQ01 Uncharacterized protein n=1 Tax=Haliscomenobacter hydrossis (strain ATCC 27775 / DSM 1100 / LMG 10767 / O) TaxID=760192 RepID=F4KQ01_  ali  17  1MNAESFANLLKEYAHLYQLPMEELRTMVMQYPYCHNLQVLLQEKSELDQHPDREKTLAKAATYAIDRKQLFYHLGEDFLELKDLSIVQADLEKIALGVYQDPTSSQTMAIDPEPPSSIDAEPKTEPSINSWNGAWDGSTEEETELDTSFEEAVIDLSQTPSLPTNEPPAILDPVKDLDESDTSDPELPTHTPPHPNPHPISPTPKKAFSSWSRTDQSAYLQASVQQLLAAEQLDHKKNKHLGSVESKNEVSKKAWQSIVDGDSMASETWAQLLVAQKQYHKAIEVYERLMLLIPEKSIFFAAQIESIKK.... 326
163 7.000e-23UniRef50_A0A127VHC8 Uncharacterized protein n=3 Tax=Pedobacter TaxID=84567 RepID=A0A127VHC8_9SPHI  ali  18  8...QQLAELIADPQKATPQHTAMLSDLLQTYPYYQPLHLLLAKA--DLQRAKSTNQLVQASLYTNGPILHQFLFKKENTPVTFTAEVPERKNSLEDDFVFESIASSDFFAFEQNFSTTTVIEPPKPQLVADAPVIEEHEAQAAAEIENSQVSNYHDENLPYTFLWWLAKTRKEHQSIFQPYALPKTNNAQELQQQYVEHIFHIQSHLTTSEALIGAEEQQRPATKDAEIIESFIKNDPQILPPKPEQIDNENKAKKSAEDQNDLVSETLANIYIEQMLYDKAIDTYEKLSLKFPEKRRYFADLIQSIEKKI.. 363
164 9.000e-23UniRef50_A0A1I5S1B1 Uncharacterized protein n=1 Tax=Parafilimonas terrae TaxID=1465490 RepID=A0A1I5S1B1_9BACT  ali  15  5..AENILQALFNKPAVN-VTEDQLRQLTADEPYYGTAYFLLADKLYRAKQHGYEHALQKAALHFSDELLLHYNLNITEEQASKTAQPVTDEKEGLPVVKEEDLIVVQPLSAMQPEIVKEDISVTGENDAAIEEAEEFTQPPGEEDFPEDGPVSDLAEDEIINDKLSSLLQQQAAAFEKPVEEPVMEVPIETMPLHRVDYFESQGIKLDE-EKPNDKLSKQLRRFTDWLKQMKSINPSPTELRSDEAGEQHVQHIAQHSNDAEEVVTETMAEVLVKQGKPQQAINIYEKLSFINPSKSAYFAAKIKELK..... 308
165 1.000e-22UniRef50_A0A0R2VMX1 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium BACL12 MAG-120813-bin55 TaxID=1655600 RepID=A0A0R2VMX1_9SPHI  ali  18  1METLELHSLIHDNALLQQASNDALKSVMEQHPWYALPYVLLAKKAFLEQDPQYEYWLAAAAARVPDRNVLMQIMQGDNKAAEAEGSEVQAPEAVQESAEINLAEMEEPLREEEQHNHQQEAEQEDPVFEYAPYEMELQKAILDLEKSGKGAALPNFPVEPAEETTAGADMQLSMHTDGM---------------HSFSEWLHLLTGDSMVQLVPYSSARRPLKVSSKGMLVHQDGADAEDAAEDFTEWEAKELARKSSQLGEGVISETLASIFVQQGKPEKAIEIYKQLGLKYPEKISYFAGLILDINKK... 295
166 1.000e-22UniRef50_A0A150X564 Uncharacterized protein n=1 Tax=Roseivirga spongicola TaxID=333140 RepID=A0A150X564_9BACT  ali  19  1MDKERFSTLLQDPSLVTNADIKALNEYRKKYPYFQSLYVVVAKALKDREHPKTEAFIKKAAIYSANRSHLKEIIEGDFSFSKPKQETEQKPVLKVGQSIKAKDSLPQTKTEKIEGKDEAKEKLEENT-----------------EKEKPAEQSSKEKEGSSAMAEKPKDKQPAETPKTAADQEKIDNDLAEIEAAKRRIEALLSGQLDETQERKKEKPLSEKKKNQIQIIEKFIQNEPQLDREREGNVDIEDLADKSILKEEAFETETLAELMAKQGKLKKAESIYKKLSLKFPEKSTYFATQIEKLK..... 295
167 1.000e-22UniRef50_A0A2E2TF66 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E2TF66_9FLAO  ali  15  1MNFNWLTESIENPAVL-LQSKSELQELKQRYPYLSSLYVFDAKLEQLESGLDYQDKIKKAAIYASNRSALYEYVIKPNVEEAIANQEKNTTKNAVIDSTTSQSKTEQAQLDVVPERSLTQKEKDEKRALEKEILNHAISASILKESASSPTKSQKDEAEIKETEVLKKPTPEEPKIELDNSMGVLDWLNSSLVKETVHSNTSTSTPVVQKSQLIEKFIKGG--EEKIHLTKEVTPTLLQIERPQTEFFSPENMAKMSLAENEDFVTETLAKIYAQQGNIKKAISAYEKLSLKIPEKSNYFALLIQELKE.... 306
168 1.000e-22UniRef50_A0A1S2VS36 Uncharacterized protein n=19 Tax=Cytophagaceae TaxID=89373 RepID=A0A1S2VS36_9BACT  ali  20  5.DKETLSYWVTHPNDLTDSDFQQLQESLQVYPYCQALYSLTAKAASIHQKSQTITFARKAAAYALSRNALRRLIDNEFQWSD------------------------------------------------HLLSRLNELSTGQVPIPDDYQQESYALFKSKSGLNNGLAGVPLIRLPEPKMPELVIPEPDELPLLENTLQTELAQQPTAEQPEPAPAANEEERQRQSEIIDTFIRNEPRIAPFRTDPVEQVDLAQRNTSSGLSLATESFAKILIKQGKVNQAIEIYEKLLLKNPDKKAYFASRIDELRE.... 267
169 1.000e-22UniRef50_A0A0Q4LPK6 Uncharacterized protein n=5 Tax=Pedobacter TaxID=84567 RepID=A0A0Q4LPK6_9SPHI  ali  19  3.NKQLLADLLAQPGKVGLAHVPMLKEMAARFPYAQPIHLLLAKAE--------ASFVPKAALYTKGHTLFHILNIVPITEAEEEIIGKEIVEEQLISEEIKDENAAAAEIAPPSEIETPKPEPPQIETVTPDEPEIHRVSKYDDDQLPYTFLWWLAKTRKEHEQIFQPYAQPRPGLAHKQQQTNQQQERAEFQQQYVEHIFHIQTPFEVADHLAEYPTPEVKDAKGAEIIEKFLKEDPTIKPPKPEQIDNENKAKKSAEDNYDLVSETLAKIYIEQMLYHKAIDTYKKLSLKYPEKSRYFADLIQSIEKK... 343
170 2.000e-22UniRef50_UPI000873423F hypothetical protein n=1 Tax=Crocinitomix algicola TaxID=1740263 RepID=UPI000873423F  ali  20  5...EDIAKYISNPAAISAAHVLELEKLLIKHPYSSSLHLLYLKGLALHNHLNFEEKLKSTAIHSADRAHLYQLIHSGEGDVNDNETPIVENTSTNLQEKEPETIIEATRVKESVIQPNEQTDEPTSQQPSENLIQENEKTEDEEDETDAEEKIATHVSTEQSPDNETGLADKNSTKTNEKEISTENLSFTAWLKYKQNNPTASAEPSEKELKTAPSHEKVSEEPQKNKKTKSEIKEEPRISKPIKEFYNPVDHAKKSIEETDNLVTETLAKIHVMQKNYSKAITAYEKLILLYPEKKTFFASQIEKIREEIKN 368
171 2.000e-22UniRef50_A0A2E0FD78 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E0FD78_9FLAO  ali  21  1MTKDEFQSYLTAFRLPDQKHITVLRDLAEAHPYSSTIQMLYTKTLHTSKSIYYEDQLQSAALVASDRRKLYQLIMSPPLETAVIQNAETELIVADQSIDSASERTNDAVDQGILIEAINSSIQQEISESEPENYEDLAKELVEESKEKNVPD---------------------------------------------NQTGSKENPSHQSFNDWLNAGSSESKKIEPELIQIAEQLASTPKREKKQFFSATKMAAKSLIDEGEIVTETLAKIYADQGNYVKAIQAYRTLCLKIPEKSVLFAARIKELEKLKN. 267
172 2.000e-22UniRef50_A0A2T8HFJ0 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=A0A2T8HFJ0_9SPHI  ali  16  10..KKLFAEALRDPNAVSDVDFQLL---FSEYPFAQALVFAYQCRRSTATDPSVHATVQKALLHTDNRYWLYDLVEQRQEEVETENTGDELADLIFEQAQSADYFALEKTTEGAEPSTDIAAVTPVEPSVKDADSEEDLSVYDDELMPYSFRWWLYKMRLKHADTYQPFNLQSLTTRADGQFVPSKFDETILDHQIRENIFHLQDPEDKLSAAIRQKTVEVSMPKKTDAVIERFIREEPQIQPPTPDVVNNENKARKSAEDHFSLVTETLANIYIEQGLYPKAADVFRKLISINPEKKAYFASRIEELEQK... 345
173 2.000e-22UniRef50_A0A2E3N1F2 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E3N1F2_9FLAO  ali  20  3.NTESIAKKIKSPELINSDDLKSLENLSIKYPYSQIFSILYLKGLGITKNIRFEEELKKHSYKVTDRIQLYKLIHEYSNGVSVSDDISISDNNQXXXXXXXXXXXXXXXXXXXXXEILSKQKTDSS-----------QENKNEEKLNANILYHTVRDNYELPKLTEEEITRLNTRIKPITSLKQEGKKEEQKEELKIREQKKSFNSWINLNHNYSSSINYDEKEKNITDFNQEKQLYGEILKPKKAFFSPLKQAKESLNEDNIPVSETLAKIYAMQGNFPQAIKAYKELSLKNPEKKIFFANLIEELTNKLN. 302
174 2.000e-22UniRef50_A0A1V3MVH1 Uncharacterized protein n=11 Tax=Sphingobacterium TaxID=28453 RepID=A0A1V3MVH1_9SPHI  ali  19  9.NNELFFQAINQPESVGEE---VILALIEKYPYAQSLRFIHERKIFGESKPVQN--LSATLLYAPSPNWLYEFMHSTVVVAKELQLEDITLDEEIEDEVSDDIVMEEAVVAETEVDQTDANVEEVEKADEHVEVAVQSSKDTQERVTVYDDDTMPYSFLWWLHKTRLEYAETYQPYVKSPAKIHEKLDSQLLDQQIRENIFHLQSPEAKLSDEVKTTIAFQIPRKTDEVIEKFIREEPMIQPLQAEKLDLENKARKSSEDQHSLVTETLAKIYAEQGLYPKAIEVYEKLVLKYPEKNAYFAARITELEKKLN. 360
175 6.000e-22UniRef50_A0A1M5VZC0 Uncharacterized protein n=1 Tax=Chryseolinea serpens TaxID=947013 RepID=A0A1M5VZC0_9BACT  ali  17  1MEKETFIKLLERYPESTAEEAQAVLMLKEAFPYSQVLHTLSARLCKEQGFSTQTQELQLAAVYAADRGVLKEVMQADHPPDDFDPDSVADEVMHDLEKLHELKQNFEALFIEGKTKAVATPEKEKSKPTKTEPPLPVSFHRDLSKSKKERIVELAKALEEPPKTKKERIIELAKALEAQRQQPNPPAVEPRPPVKKKRDNPGEDIIEEIASTKETIEPESEKQKEQLEMIDQFIKTQPSISNAKDKPTNIASSTIKTGEFSDNIVSETLVDILLKQGKKDKAIEVLKKLIWKFPQKKAYFAAQIEELKN.... 339
176 7.000e-22UniRef50_A0A2A5FP71 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2A5FP71_9BACT  ali  21  24.......................LVDLVSSHPYSGPFRMLLAKASKDAGHLDQRKDLLAAAAHCTSKKALFELMFGESFRNEKIHEIIEEADDVSEEEMEDMVDLVWHSNDNFLKIDPISDEENEIPLAREAVIEAISSSLREEMEGWGSEEKTKKDEKNEFERGKEKKLSKNISQEIPSEIPSEKDSEIDAELTEIKGLGEANSLFGKWLEKRAAEIDSQVIQGSSAIIDAFIKSNPSIGALRELKTPVEEWAKASLADDPSLVTETMAKLYAQQGQLGRARKAFKMLALKYPEKSVYFASQ---LKKLSNN 321
177 8.000e-22UniRef50_A0A0C1UHW7 Uncharacterized protein n=1 Tax=Hassallia byssoidea VB512170 TaxID=1304833 RepID=A0A0C1UHW7_9CYAN  ali  18  1MDKQQLADLLNHYTASSTEEATEVIALSDQYPYSQLLHVLAARVSKDHNLQNQQDILQAAAVYSTDRSVLKQIMTEPMPATVVQENTAAALPVARVAEHDAPDSIDYAEAVLKDLKRLHELKHNFEKMLTVFETGIPDVSE------------------------------------------KKLPRKAVGRPKKAVEVKADPLIEEIKTTKKRIAPESEKTKEQIEIIDQFIKAQPTIKPRSEVTVAGDLTEVKNGEFADNVISETLVEILIRQGKKEKAIEVLKKLIWKFPQKKTYFAAQIEDLKK.... 269
178 9.000e-22UniRef50_A0A1Z9DD94 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TMED114 TaxID=1986720 RepID=A0A1Z9DD94_9FLAO  ali  19  38.......................LGEWVEAYPAFGAGRLLRAKAARDGQDLHSADRLAQAAVFSSVPGRLFDLMFRAGIESEIAAFARAVEALEPEVESAMRLRWHPEEDAGADHLNSKQVEDVEGAAVQVDADVEENADEVKAPVVVPEKGTQDEPTKAPVEGVNEPEIDTTPPPVPDVPAAAPRPADVSGLSPLARWALKRAEEEDVLSSDRPSEVPQGGLEQQAALIDLFIRNEPVISPIQPDVERPKELAKESLVEDTSFITETMARIYAAQGQLGRARRAYKLLALKYPEKSVYFAAQSKKL...... 369
179 1.000e-21UniRef50_A0A180EIL6 Uncharacterized protein n=1 Tax=Lewinella sp. 4G2 TaxID=1803372 RepID=A0A180EIL6_9BACT  ali  15  1MTNATFLSYLRDPSSLIGVDIDSIGQLTARYPYSANAQLLLALAAELNGHPESQTYLQRAATQTFDREQLFDTLYALLNGEASAAEEFTEEEPTFSLEDLMAPEALLLDEEEDYSAEAPLPIEPSPTNVPGFDDDMETGTSNSSYPTSGASIEEEMPPPPPERSPLPAADHAVRTVETMAVTPPATITSSDLSEREAEPTPSDFSPTAIPQDPADFSVRAPISTKEELRKRLQSIRDRQVARAKEQKKSIKKIARRSLIASEGIISPTLAEVFIQQGQYHHAIRIYEQLALANPEKSPIFAALIQDLKQ.... 321
180 1.000e-21UniRef50_A0A2A3UE89 Uncharacterized protein n=1 Tax=Sphingobacteriaceae bacterium TaxID=2021370 RepID=A0A2A3UE89_9SPHI  ali  21  1MQPAELIKYIQNPSLLDKESVKHLQKLVHDFPYFQSAHVLLSMASRKWDASIYQQSLKKTAIVTTNRAHLFKLIHQVENEVPVASSNQQGEVVEAKQKVDTHQEDSKQELDILKATEISTEPVIAVKVEELESEPLEKKEIEQEIKVKPVLNAEEILEREIGKEVVNSFVEKEILKTPELNKTPVKVEDPESFADWLSFLKKNNGQSYKQIEEQPKEEVQARKLKNKAIIDKIIESSPGIIRQKERFYAPDIKAKESLLENEHLVTETLAKIYALQGSVNKAIRAYEILSIKSPQKRAYYDGLIQKLKN.... 345
181 1.000e-21UniRef50_A0A1Q3TBK0 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 44-61 TaxID=1895838 RepID=A0A1Q3TBK0_9SPHI  ali  15  5..INQLTHALTGKEDIGECSENELRQMVRLYPFFSPAHLLLAKKVKADRSEDAAAVAQKASLYFSNPLWFDQLLNETGVTEQLVTETVPGVIHDTILESPATEEEVVEQINSQDNVPVPPVSVHSEEAIFDKADETEDEQVAEQISEIPGKEEESVIGHVEQPLILPSL----------KIEPLDESKMELTFEPYHTVDYFASQGIRFREEDKPKDRLGHQLKSFTEWLKTLKKLPPSQIPVTRQEEKNVEQMAQVSITDREVVTEAMAEVWEKQGNAVKAQELYEKLSLLDPSKSSYFAAKIEHLKQL... 304
182 2.000e-21UniRef50_A0A1E5SYX8 Uncharacterized protein n=1 Tax=Fabibacter misakiensis TaxID=1563681 RepID=A0A1E5SYX8_9BACT  ali  19  1MDRERFSTLLLDPSQVTDADIRALNEYRKKYPYFQSLYVVIAKALKDREHPKTEAFIKKAAIYSANRSHLKSIIEGDYVFPEKEEAPPKPEPAESVKEEKASTPEAIQQVTQEIVEKQEDQSSLKAENDSEGDNNSEDTSKDLEEIRAAKRRIEALLA------------------------------------------GTAIEEEEKPKAKAPTTSPPKNKTSQVEIIEKFIKNEPQLERQKMHHNSQEDLASKVIKGVDHFETETLAKLMLKQGKLKRAINIYENLRLKFPEKSAYFAAQIEEIKTK... 272
183 2.000e-21UniRef50_A0A2A4QR74 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4QR74_9BACT  ali  21  1...............MDASSTTGLKDLISQYPYFQTAHLLYLKNLYDEKNINYSTQLKVAAVYANSRKKLYELVMQSDLRSRIEAVDTSASEARVTILDVS-------------------------------------------PLEQQILKEAVSASIELEVQSDQESVKETSRKTEKQTKKLSTKKKEPDYKGEHTFNQWMTKLTQGEQGVSDEQSSIELITSFIDKAPSLLRNIEKEGGEKEAFFSPIDTARLSIIDDEEFVTETLARIYESQNFYEKAIKAYELLSLKNPKNSNSFAARIKTLKKKLD. 254
184 2.000e-21UniRef50_L0G0U9 Uncharacterized protein n=4 Tax=Cyclobacteriaceae TaxID=563798 RepID=L0G0U9_ECHVK  ali  20  1MNAAQFLNIIKKRNALEKEDFRSLLKLHETFPYFLVPKVLAAKYEKKISKGESQELLHWAAVQSPDRAWLKTLIEGDIHFAP---------------------------PVSPEPAKATPAPQPSKDTTPEKAAPTAEDAPDKAASQQPSGSDRTEIXXXXXXXXXXXXXXXXXXXXXSDKETPSSGAKAPKKKAVKKKDPKNDDLIETIRKKEKKVIKDAKKQEQLDIIKAFSKKEIKLATIKEIEDTNTDLSKNSTQLSDKLLSESYAKLLTKQGKKAKAIDIYQKLSLKFPNKKAYFANLIKELKD.... 284
185 2.000e-21UniRef50_A0A1M3G5B9 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3G5B9_9SPHI  ali  14  1MNPSQLSTALTGKTDLAQLSLSELQQLAGQYPYWGPVQVLIAGKLAQEGSEELNDQLERSMLYLANPLRLQQLLKPEPFLTPDDDTDAADETWTVAVTNDQPAITTPVFAAELEQPATVEEVVIQEEKNDTVSIEE------------NKEEQAPEVPVTAVHVDEPSPAKTGQVIPTLPGMENASMELSFEPYHTVDYFASQGIRIREEDKNPDRFSRQLRSFTEWLKTMKRLPTGEAVVGSPTDERKVVQLAEHSIQDRD-VLTEAMAEVWEKQGDYAQAIRIYEKLSLLDPGKSSYFAAKIDQLK..... 297
186 3.000e-21UniRef50_A0A2E5JBV1 Uncharacterized protein n=2 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E5JBV1_9FLAO  ali  26  5MNEKSFSDLIGNYNTNDETLVSKMAVFIEKYPYFQLPRFIYTKSLIDQNKDPANNALNQLSLYTSDRTVLKNGI--------------------------------------------------ESPLTFTTKSNDLMEKSITILEDKVNKEVEIADTIDEDIIPQKQPNEATIPSIDKTTAEGKPAINTADLKMIFTEWVVYTTXXXXXXXXXXXXXXKQPLSDKLPIIDSFIAADPKITLVEKGATN--NIANQGDFYSEELMTETLAKLLVKQKKYKRAIKAYKILSLKYPKKNVFFAGQIQDIKNLQQ. 264
187 3.000e-21UniRef50_A0A1Q3X763 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 46-16 TaxID=1895925 RepID=A0A1Q3X763_9BACT  ali  14  7..IEYISQVLHEPHAISGEDHESINALVNAYPYFVPAR--YLQAAERHKSRPFDSFMMATMLYDGNWLLLHDFLARSRSNMDDSDTAYEEPYEEAVLQQAPLAETGEEVFTLENEFTAIVEETPLPFTQDDEDRSKGFVFEQAASQVEEQAEEEDETLILPVYTEDYFLHQGVQVSNDIPADAERSGIDDEEAKSLMVVMSFSEWLNHFKTRSEKAREEEEDQKALKTMWQKEKLVAALEEENEEIPENVFQMAVNSITREDDLASESLAEIYAKQGKYDAAIDMYKKLSLRNPQKSAYFARKIDAVLKEK.. 314
188 3.000e-21UniRef50_UPI000DCED472 hypothetical protein n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCED472  ali  16  1MEKDQFIHVVNHFSGSSVQEAQEVLSLKESFPYSQLLHALSARVTKDHGFSNHAGELQLAAVYAADRAALKEIMLEEFDPEEQPVEVAEINAPQAAVATIDDNDNVAEELLHDLERLNALKVNFEKMFSDGFVADVPTAAAEATPAEPPAIETQTEPTPIKSGLSKKERIVALAKALENKSAEKPAEAEPPKTRKKRKAQEGEELIAEIVNSKSQIEPENEKQKEQIDLIDQFIKTQPSIAKDKLNNSPEGDLSSPHADFGDNIISETLVEILLKQGKKDRAIEVLKKLIWKFPQKKAYFAAQIEDLKK.... 312
189 3.000e-21UniRef50_A0A258EVB0 Uncharacterized protein (Fragment) n=1 Tax=Flavobacteriales bacterium 32-35-8 TaxID=1970509 RepID=A0A258EVB0_9FLAO  ali  31  1MNKQEFTYLLSNPGNITGHQTGAVNTIIEAYPYFQSARALYLKGLKNQESFKYNQELKKTAAYTADRSILFDFITSEVFIQNEISQVIKQNDEYLKTIDVSMEDISVNKRVTIDDRLKQQITDTTGVLDPTLFEPKEERIKKVVPFTLDTSDAFEEVTTDKIETKDMSPSDILKLGKPLEFDKRESHSFTEWLKLTRFHP................................................................................................................. 200
190 4.000e-21UniRef50_A0A1I1U021 Uncharacterized protein n=3 Tax=Chitinophaga TaxID=79328 RepID=A0A1I1U021_9BACT  ali  16  1MTANRIIQHIFQAPDIKQVNESALEQMVTAFPYFTTARLLLAKKQYSAQRNLLAPAVKKAQLYSTNMHYFYRFITTEEAAVVPAPVEPETPVHTAPAAYITENEEAPAATYQEPVIEEAPAVEEAPAVTPEATYQEPAKEETATFTPKTIYVEPAPVPVAEEVPVRQEMADTTVNTGEVEEQIKIFPLEMNSSESTLTYQPLYTDDYFAYKRLKEPEQAEVLNEKGASEMKSFTSWLKDIKHTPEVSEAVEKMAMESITLTDDVVSETLAEIWARQRQYQTAIHIYQKLSLLNPNKSAYFAQKIKELQLLTDN 369
191 4.000e-21UniRef50_A0A1H8EX18 Uncharacterized protein n=1 Tax=bacterium A37T11 TaxID=1855384 RepID=A0A1H8EX18_9BACT  ali  18  6.KKEYFHQLLSGY---STSDAGALDELIHPYPFAHSLHVI---KSQITGNP--------AALYAADGIFVNYFPTGKEVLPEETDGFEELLF---------------EHPASMDYLRFNEGMAESAAEAGSAAEDETVSRYHDETMPYSFLWWLHKTRLEHAETYRP--------------YAPIAGPKVLNQQIRENIFHLQDPEEKLSSKYKGDTVTFSIHRKEDAVIERFIREEPQIKPPSPDKIDLENKARKSSEDQSIFVSETLAKIYEDQGLYDKAIHTYEKLSLKYPEKSAYFADRISELTNKLNN 274
192 6.000e-21UniRef50_A0A2P8EEI6 Uncharacterized protein n=1 Tax=Cecembia rubra TaxID=1485585 RepID=A0A2P8EEI6_9BACT  ali  16  1MNPIQLLGIIQNAQHLNKDDVTELLKLHETFPYFQIPKVLLAKYEFKKSTGSEIEILPWAAVTSPDRSWLKKLVETDQFFEEQSITLSKQIQELEDQKKAEDGKNFIDDLEGHLIPDNKKVASTKDLTEDLAQSKLKALEKLESLDKKPEIQNESIKTTTPIVEKDVTKGISEESPTEIKGEIKTEEQSEEATKKPKRRNHYKDELIESIKKKEKKEILDKKKLEQIDIIRAFSKKEIKLATLKEIEEKQDDLSEKSTQLNSSLITESYAKILTKQGKKDRAKEIYKKLMVKFPDKNTYFADLIKELEENKD. 321
193 6.000e-21UniRef50_UPI0004B84937 hypothetical protein n=2 Tax=Bacteroidetes TaxID=976 RepID=UPI0004B84937  ali  17  221...................................................................................PAANHETDKWIIGNIASTDYFMFDKSVADTRGEDKAPIPNAGTVEKESPVAKEAPEVISKYNDEKMPYTFMWWLDKTRREYASVYQPYSIESTIAAKVAPAPPVSPASDALQHQYYENIFHAQSLEELEKTPQPDVPEIKSKEDLIIEKFIREEPQIRPPAANKIDNENKAKRSSEDRNELVSETLARIYTEQMLYHKAIATYKKLMLKFPDKSRYFASQIEQLEKKVN. 449
194 8.000e-21UniRef50_A0A162PI58 Uncharacterized protein n=1 Tax=Flavihumibacter sp. CACIAM 22H1 TaxID=1812911 RepID=A0A162PI58_9BACT  ali  15  1MELTKTIQYYFHQPSLESVTLAELEQLVRAYPYCGPLQYLLLRKMKGNHAAGYPDQWQKSLLFFQDPYFLQAQVNWVHNPVKETVQEEEKPASPAPPIQSKLVKELTSELADALALAKSIAHAATEPETITSQETDEAGS------LTTAPLLRNELLQKESPIRIPSIRDLGPVTDDMPSFEPYHTIDYFASQGIKLSNELPKDKLGKQLKSFTEWIRSMKKLPQTALEEKL---------MDAGKGETIEALAADSIEGKEILTETMADVLLKQGNKAKATEVFRKLSLAYPDKSAYFATRIEQINN.... 294
195 1.000e-20UniRef50_A0A1T5M280 Uncharacterized protein n=1 Tax=Ohtaekwangia koreensis TaxID=688867 RepID=A0A1T5M280_9BACT  ali  17  5.EKDLFIKVLNRYSDSSVEEAKEVLSLKESFPYSQLLHALSARLAKDHGFSSHQSELQIAAVYAADRGVLKEVMTEETIQLQYPEKTEEVMHDLERLHQLRHNFEMLFDDHQPTAQSNVVEAVEKEEEPEVEEVQKDTAKSKKERIKELAKATLAKSEPEETKSKKERIIELAKASQEKGDDTPETEPEPKTKGRKKKSENSGEELIEEIANKEELSPEGDKQKEQLEIIEQFIKIQPSITQTKEKPFTPPSSTIKTGEFGDNIVSETLVEILVKQGKKDKAIEVLKKLIWKFPQKKAYFAAQIEDLRK.... 343
196 1.000e-20UniRef50_A0A2N5ZVD4 Uncharacterized protein n=2 Tax=Salinivirgaceae TaxID=1970190 RepID=A0A2N5ZVD4_9BACT  ali  22  1MRTERFYDLLENPAEINKDDFAEIEEIAEEFPTFQAAQALLVRSHLMRGSFRFKSKLQSLAIQTGDRQNLFQWLYGESQPAIQVSNKPLSEEKHFTDNLQQVSTAALRDEENKQLIRQEVERLLKEKGLLYFDFEHIPTEEKDVTEKVSHETYSLQAEIDRSGDRLTDETKDWLAANIERAKAKAGKVDVSKQKSDQLIDRFISLSQKEKNKNKEISEDKNKE--------------------------IEEITANSVSESPEFMTETMAQIYVKQKLYEKAIATYEKLSLKYPEKNIYFAGRIKEIRKIID. 286
197 2.000e-20UniRef50_A0A2G2EYR0 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2EYR0_9FLAO  ali  19  6....DIATKITIPSKVAVTDFESLAEYANKYPYSQLFSILYLKGLKGASDVRFEEELEKHSYRISDRARLYELISEEGEREKSKSLEQESGVESKLISEEEEIDNLEESTTEIPKEEIPKEEENSQIVEENRSILPEIEIEQEKTQDLVDETILQHAISANYQLSELNSEEKRALEEKNISKEIIAEEIPEIKPIEIAIDTKQSFNSWLDTNSNYTKSDNHSKLAIIDLVSDSEASKEKEKKEKTAFFSPTQKAKESLDENTLPVSETLAKIYALQGNFPKAISAYHQLSLNNPEKKIFFAIRIKELEKKLNN 334
198 2.000e-20UniRef50_A0A1Y2RAG1 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium IBVUCB2 TaxID=1985174 RepID=A0A1Y2RAG1_9BACT  ali  17  4.QINQLVKSLLQKDSLEHCSLEELQSFADRHPYFGAAQLLLTKKLKTENSAQYNDQLQKTFLFFHNPLWVEQLLTDTGHAEVIPAKKSSVEEIIETKEEPIAYTIEPVITPVLETEETITQIQVEENS--------------EIVVEEENDTAPAPNDVVSMAEQNAQEPEIKIPPLKIEPFDPAKAELSFEPYHTVDYFASQGIKFKEEEKPLDKFGIQLKSFTSWLKTMKRLPVSEIAAVVDGISEKKVEKLAEHSLEQREILTEAMAEVWEKQGNNAKAIEIYSKLSLLEPSKSPYFAAKIERLK..... 296
199 2.000e-20UniRef50_A0A1G8XUB7 Uncharacterized protein n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G8XUB7_9BACT  ali  19  1MNKQKFIDLLEDPERIDEHDLELLEELATNFPYCQAAHVLIAKAAHDKGSMLAHQKLKKAAVYTTDRALLKRTLYHARPATFATTPDEVVRA-------------LAQRAGAELGPEALEAEIAQAESPQRPQASPIPDLLEEISETPSVTPDTILTELEARPLREEGVAREEEPKRKPLRVDQLDVIDRFILVNPRLTPNQADENASKDDLASESSRRNENLVSENLAI-----------------------------------------ILTKQGKINKAIEIYHKLMLKHPEKKAYFAARIDSLEKL... 256
200 2.000e-20UniRef50_A0A1M4U7Y5 Uncharacterized protein n=3 Tax=Psychroflexus TaxID=83612 RepID=A0A1M4U7Y5_9FLAO  ali  34  1MNLSRLQHILRFPNEINSTDEDILNEAIELYPYFQALYALKLKYLANTNSFRFNQFLRKTATRTTNRKVLFDFITSTEFKQLKTVNLIN-----------------------------------------------------QNQQKLEELSELEKTLGLSKQEAETIENPDLFEKKNHLEFEKQDKHSFNEWLSYLKVEPVNTENKKDKSKDLEIKFEDNEVAKQQEIINNFIKENPKIKPEKSNRSLERKIELKS--NPSEMMTETLANVYLEQKRYDKAIQAFNILILKNPEKSSLFANRINEIKQLKEN 258
201 5.000e-20UniRef50_A0A1J5B284 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium CG2_30_33_31 TaxID=1805033 RepID=A0A1J5B284_9BACT  ali  18  1MNNSDLNRFIQPDYHFKKEDILILQNIIQKHPWFQLAHHFLAKACYQNSTNDYKTCLNSAAFYSNVSDALYKYIYD------------------------------EKGKANETSNEIIELKNNFTIEKDGEEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTNIAVEDKQDVVVNEELADKKDDSSYSSFIEKGEDNIINTDELSEFSKLGGKLEQTSILNKFIQNEPSINRPADGPYETLRLAKESLEDRLDVVSETLAEIYYKQDNAQKAVKIYKQLILKVPEKKRYFAARIKEI...... 278
202 6.000e-20UniRef50_A0A1T5ESK9 Uncharacterized protein n=2 Tax=Sphingobacterium nematocida TaxID=1513896 RepID=A0A1T5ESK9_9SPHI  ali  16  25.......QALIDPSRLTEDD---LLGLIVRYPYSQPLIFAYERRKKLINEDSPNRELALLYAANANWLWNFVNAPVVKVEELVPEREGYVPFELYDNLTEDVILESENGDEEEKERESAVDVEEEIVPKPASEDPEDVSLYNDDLMPYSFRWWLHKTRLEHASTYQPFITPHLPRPEKGNFDLSKLDETILDQQIKENIIHFQEPESKLSDAVKNSPLKHVEPKKSDQVIDRFIKEEPMIQAPSAENLNNENMARQSAEDNYSLVTETLANIYVDQALYLKAIEVFKKLILKYPEKKSYFAARIQDLEK.... 376
203 8.000e-20UniRef50_A0A1M3IF11 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 43-93 TaxID=1895924 RepID=A0A1M3IF11_9BACT  ali  14  10.....ISQVLSEPQNISAVDKESIDALIQTYPYFVPARYMEAANEHKKQPFNFNEFLKAASGVATAETPKPAPQQAAPQPEAQQEEPAQPEWDATATVETPIAEVVAEPKANEVVTETFVVPEVLEEPQVIEEAPKQAEPATKHHEPLYKDFNSDESFILPVYTEDYFLHQGMNVSNKIPADIQKEGDTTDEDKQLMVVMSFSEWLVFFKNRKAREAEEAEDQKAVKTMWQKEKLAAALEEENEEIPEKVFEMAVNSITKEDDLASESLAEIHAKQGRYDKAIEMYRKLSLRNPQKKAYFARKIEILQKEK.. 338
204 1.000e-19UniRef50_A0A1M3D470 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1M3D470_9BACT  ali  20  1...............MNDNEIIALEQLVEKYPWYTLAHLELYKNLSERGPEERKRYLQRAAAFVHSRELLFD-IAQIHDSSPNIEEDEEVAIDNVMVDDVEVAEEREIAEEKVAVKEEEITEDNDIVDEQQVLKSSASVLNFSDDDFFELIPEEGEIVVTE------------------------------------------TNTVMPGGDYFTRREMELLELDENKPIDKFIAEKPSLLRGSGYSSEPVEVEETDEFVDSGFYTETLARIYAEQGFVKRALDVYAKLILLYPEKSTYFASLVKELKTKNN. 254
205 1.000e-19UniRef50_F8EHZ4 Uncharacterized protein n=3 Tax=Runella TaxID=105 RepID=F8EHZ4_RUNSL  ali  17  7..KESFSYWTAHPDDTSEGDISQLEEAVQSYPYCQSLHILIAKAMAVHHPEQAERSIQKAAAYSLSRNTLRKLIQNEFEWSPNLRSRQFENVLIWPGDYQKPAATSYSKPDWKLPELPKISLFDQPETLQPKPTLPELPPIDDTTIRENALQTELEQI------------------------------------------------ESSVMEEIQTDQRELERQRQIQIIDSFIENEARMGPIRANFIDLANQEQEDLAKKRNMISEGMAKIMARQGKIERAIEIYEQLMLKKPEKKAYFAEKIKDL...... 269
206 1.000e-19UniRef50_U2J0D4 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=U2J0D4_9SPHI  ali  17  14.......QALVDPSRLTEDD---LLGLIVRFPYSQPLIFAYERRKKLVEEESPSREL--ALLYAANANWLWSFVNAPMVKVEEIVPEEEEYIPFEIYDGAGEIRVEDEYFVFEQKEKGESPENSDVMPILSDDEPEDVSLYNDDLMPYSFRWWLHKTRLEYADTYQPFIVPHLPKPEKGHFDLSKLDETILDQQIKENIIHFQAPESKLSDAVKNSPLKVVEPKKSDEVIERFIKEEPIIQAPSAQKLHNENMARQSAEDNYSLVTETLANIYVDQALYLKAIEVFKKLILKYPEKKSYFATQIQELEK.... 359
207 1.000e-19UniRef50_A0A1Q3ZH53 Uncharacterized protein n=1 Tax=Flavobacteriia bacterium 40-80 TaxID=1895763 RepID=A0A1Q3ZH53_9BACT  ali  16  1MDSVAIADIVSGKREPAFTDVGALKMLADKYPYAQLFAILYLKALSDSKSFEFEEALNKYAYRVTDRMKLYEIIHAQPEDIQEQEPVGDDFKAASETEIESAVEEEIPEEAIFGQEEISELHEEISETEEYNTIEEEIKEQVEPEIFAGTEETSANTEVPAEEIISDEEEKTLEMNILSSVIENVYSQVLENTVIEADPEVSQEIEEEPEAKTEEQASAKINEDQKNQIIDKFIEEEPSISRPKKEFFSPSKKAKESIDESGLMYSETLANIYVLQGNFPLAIKAYEQLCLTNPEKSVIFAQKIEELKEKLN. 367
208 2.000e-19UniRef50_A0A1M7P9V9 Uncharacterized protein n=1 Tax=Cyclobacterium lianum TaxID=388280 RepID=A0A1M7P9V9_9BACT  ali  19  4.NSQELISLLLKAGQLDKEDFKNSLKLQEEFPYFLIPKVLGARYEWNHSGSASNTLLHWAAVLSPDRKRLKTLVTEEMISPDITGKDDDTSDAAQNVAEETIPEEKEQDISEQIDQSWDAGERDAPE---------------------NTDKPERSVKPNRDEILRRLEENLNRIKKKDSGQEHPGGQEKKKEETGPSTENDGEDLVSGIARKESLAQTDQRKKEQLDMINNFQERPIRLSPEQMDQENNPDLSEKSTVLNDNMLSESFARLLVKQNKKPEAIEIYRKLILKFPQKKTYFADQIEQLK..... 290
209 2.000e-19UniRef50_A0A0B8T778 Uncharacterized protein n=1 Tax=Sphingobacterium deserti TaxID=1229276 RepID=A0A0B8T778_9SPHI  ali  17  362...................................................................................................................NNEADSNSSVISEPVDQQKEEDVSVYNDDLMPYSFRWWLHKTRLEYADTYQPFASPHLPTNKKSSFDPEAFDKVVLDQQIRENIIHLQSPEDKLSEEVKQRAVTYSRVDKTTEVIERFIREEPQIQPPPADQLTMENKARKSSEEQFNLVTETLANIYASQGMYVKAIEVYKKLILRFPEKKSYFATQIKGLEEKL.. 557
210 2.000e-19UniRef50_A0A2V3PSX6 Uncharacterized protein n=1 Tax=Dysgonomonas alginatilytica TaxID=1605892 RepID=A0A2V3PSX6_9BACT  ali  19  1MNIKDFYELVELKKEPDVSMLLKLQLLTKKYPFFQAGLYTYIKCLHLGESDNFSSELNRLAPFIMDRKALFYYVMSAEYKEFQKKSGHALPESRTNVLISAFFETLDNTDEQRELEHAIINSSMASLDYFSYLESSVNTESGEKVNLDSIPSFSIEDIDLHGKGDDEVVISDVEAEIEVSEEIEPIGEVVQMKHQGIIDSFITKAQDKENLRITFDPSIQDNLYDGDDV--------------------PLQDETEEELDDDFFFTQTLANIYIKQKKYNRAYEIIKRLSLNYPEKNIYFADQLSFLEKVIKN 293
211 2.000e-19UniRef50_A0A2N2YDW5 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2YDW5_9BACT  ali  33  1MNTTDFTYLLHNPNKITKNQLGDLEKLVPAFPYFQAARAL------------YLKALKNENSYLYN---------------------------------------------QELKKTAAYTTDRSVLFEYITSPSFLHDEKKLEPIENAPWEEVQKAEAILDPKLFERKPISEKELSAESILEVNRPLPFTKNDAHSFVEWLKLTSAKPIERKLKIEDKENIREEKFKLIDKFIQENPKIDP--KIPTTTDNLAKPFSQATDALMTETLAKVYVQQNNYKKAIQAYKILILKNPEKSGYFADQIRAIHKIQEN 254
212 2.000e-19UniRef50_A0A1H9BPX7 Uncharacterized protein n=2 Tax=Lewinella agarilytica TaxID=478744 RepID=A0A1H9BPX7_9BACT  ali  18  1MTAQEFQHYLDQPHSLLQLQLTDLQEIALKFPYSANIRLLLLLKTHLEGHPEEAAYLSRCAATTFDRAHIYELIRELDASLPEEFLEETETLELKELEELHEQPIVETSPPISIALPSVLNETDIPVVPDAPTQSPTEEAPSQHAEPSDHSYKEEVLISTDNWVENAATFLSVLPAPAPIVQQSSDAPERPELFVTTHSPGLQQRLKRIRRQQAQRKDEGR--------------------------ESVNKIARRSLLAQDDVASETLARLLVQQGQYQNAIKMYRRLMLLYPDKKTIFAGLINDLKEKL.. 285
213 3.000e-19UniRef50_A0A1Z8LEK7 Uncharacterized protein n=1 Tax=Owenweeksia sp. TMED14 TaxID=1986609 RepID=A0A1Z8LEK7_9FLAO  ali  23  11........LLKGKSTFSSKTTKKLGDLVDKYPYAPIFHFLYLRGLQEEDSYKFPSQLNRSSVSTMNRSALLDWAETPLIPIEIQIAAIEDSIQEKPLEVPQVQTSNKDYKENEGSRSKIKTVQTKSPSIKGSEKIVDLSALPEKVREQNSEKEIDLGSDKTNFQDSRIKKKSKIVNDLKIKKSPSKKQSEKYLNELSPFARFLNALELEGNKEDFLIKEDRDIKNERAILEQFIELNPKISAPRNL--GKSEDLTLKTPNVSGLVTETLANHYFEQGFFLKAIQAYEILKLKVPQKSSIFAARIAEMRNLQ.. 345
214 3.000e-19UniRef50_A0A1Z8QRW8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TMED39 TaxID=1986664 RepID=A0A1Z8QRW8_9BACT  ali  18  15....................LGDLKDLVKKKPWFEAAHILLARKAIVEKSTQAKDILFEASLHAGDRRILKQLIDLPKEAKPKKKPQVETKKKAAPAKKENQGRAKIEKITEPVKIEVKKTAKPTKASHPIKLESKPETNELVRIEMPAQPSKPREIILGEKKEKGKNKKKATKRQNKSYDPIEALAKKIDEPGQTTDFLYWLNDLDQQKIDSQVKHT------NEEAIIEKFIKEQPKVRKPQKNKEYKLVNEKEQKGEN-QWVTETLAEVYIRQGLISKAIDIYKTLSLQNPSKKTYFANLIKKLKK.... 296
215 3.000e-19UniRef50_D7ND75 Uncharacterized protein n=10 Tax=Prevotella TaxID=838 RepID=D7ND75_9BACT  ali  17  2....DIKRLILHPEYMDRETLYDLRSFIALHPYYQTARILMLQNLYILHDPAFDEELRKAAICITDRRILFNMIEAAHYKVHADKSTSTQRKLHETTAENGDRTTKLIDSFLDSIPEDIEEEAKDKT------------------------------------RRPTPADATVDYVSYLLNLEEEEEQEQRQQKAQDRTTTLIDNFIEDGGFNLRTEEDTNEELTKNYAISYQIEDIETGTPTPTLPLEPEPQPQEENEGDENYFTETLARIYVKQGRYEKALEIIKRLNLNNPKK................. 257
216 4.000e-19UniRef50_A0A2G2FHH6 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2FHH6_9FLAO  ali  18  6....KIAQLIENPSLVDSSDLDSLKELSDKYPFSPIFSQLYLKGLSVNNPILFEDELKLHAYRIPDRAQLYSLVHFVSQNDTESMSVHNNEESVKDVPTNDEKEENPIVEKEDLDAEKLEAEKEIIKDTDVTNGEKEAVEEVKGEENSTHKTDDLDREILSHAVSSSISFEVDSEFTSDDTFKIDYSKLNTLDQDSEETVSVDIEFESIIEEGSVEVPNSKDELKSGDQKKSFIRELSTLTKPKQEFFSPVKKAKESLDESRLPVSETLAKIYGAQGNYPKAIEAYEKLMLKFPEKKSFFALQIESLKRKLN. 375
217 4.000e-19UniRef50_A0A1T5NF30 Uncharacterized protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1T5NF30_9BACT  ali  12  1MTANRIIAHVFLQPSLELVNEAAMEQLVADHPYFSAARLLLARKVYQQTGNLHHPAVKKALLYSDQHHYAYQLITAEQVLQEVENRVAAIIPEDALPEIETIPEPAEQEVVIPDPEEQESHTMEVLPPPVVMPAATNGQDHVDHVEAANEEEESTSSGPIKIFPMAAAEEETELIFQPLYTDDYFAYKRLKHPEEADDLNEQGAAEMKSFTSWLRQMKDNFAGKTSKDWYHQQLHRMYEEDEEPEVSETVEKMAMDSIVFNNDIVSETLAEIWVRQQQYGNAIKIYQKLSLLNPDKNAYFAQKILDLKSK... 363
218 4.000e-19UniRef50_A0A2T3HQP0 Uncharacterized protein n=1 Tax=Pedobacter yulinensis TaxID=2126353 RepID=A0A2T3HQP0_9SPHI  ali  20  167.........................................................................ISAHGYPRTDAPGPDREQAEEHAPATAEKETPPPAVPLPESVASFDFFAFDARFPATTVAEQAPETTAEPTDDGRVSKYHDDALPYTFLWWLAKTRKEYESFRPYANPVKRSGPPPEPGLQQQYVEHIFHIQTPFEAEDLVGDNETEARQGKEAELIDKFIRQQPQINAPEPEKIDTENKAKKSAEDQYDLVTETLAKIYIEQMLYHKAIDTYKKLSLKYPEKSRYFADLIQSIEKKI.. 404
219 4.000e-19UniRef50_UPI000DBEB8BA hypothetical protein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEB8BA  ali  17  1MNAAKLLDIVKRSNSLNKEDFRALLKLHETFPYFLVPKVLAAKYERKVSDGKSQELLHWAAVQSPDRSWLKSLI--------------------------EEEIHFVQLPEQNTQGTKEQSKTTKNLQPKPTADTEKPTPQEQQTSPKPQVTDRAEVLKKLEENLNKLRHNEPDQKTTDDQKNIEKNKTTAKKKTTRRKSTNNNDLIETIKKKDKKAIKDTKKQEQMDIIKAFSKKEIKLAAIKEIEDTNTDLSVQSTQLSDKLLSESYAKLLTKQGKKEKAIDIYQKLSLKFPNKKAYFANLIKELKD.... 285
220 5.000e-19UniRef50_A0A142HAY7 Uncharacterized protein n=1 Tax=Hymenobacter sp. PAMC 26554 TaxID=1484116 RepID=A0A142HAY7_9BACT  ali  15  1MTRATLLQLLAQPTALTGADVRALEELAEAFPYCQAAHMLAGQRLRRAATYAADRALLRAAPYPPSGEPSQPVSDSTAGATEPLDKQAEDLLVDMPEQELAPAASHPAGPAPALEPEPELPPQAPPIRPPAEAAAASAEFGLADESPVELMAYQLPELVENAETGRPVGTPLLPPFTGLADVAYAPAERDEVPAARLPPAGEFFAPDALLLAHVAAQQPEAAKARPLDLINSFLQRAPTASRPTPDEEDQTDLSVRSTRAEPDLASESLAKILARQGKIDRAIVIYERLMVKQPEKMAYFVTQIDSLR..... 369
221 5.000e-19UniRef50_R9GUD5 Uncharacterized protein n=2 Tax=Arcticibacter TaxID=1288026 RepID=R9GUD5_9SPHI  ali  21  10...REFIKFLSPSDNWTDADKAALKYLVLKFPYCQPLHFANASALRTESKDTYDSYLKRASVYAPKRDILYRFINEPQYFQTDIDLSEGIEEPVVPEVIVSVEVEPALPDEPEETLIETVTPEESIETVIPDIEILTTEATLIKSDDRLALQSVASSDYFRFNRSQLDPLQPEEKKETEEVSRYDDDTMPNTFLWWLHKTRKEYERDFQPYTQKPTVRTNQMPAKSPQLNQQIIENIFHIQPPSMAKVDTENKARKSSEDKLDLVSETLAQIYVDQMLFDKAIETYKKLSLKYPDKSLYFASQIQHLEKKI.. 380
222 5.000e-19UniRef50_A0A2E4EH06 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E4EH06_9FLAO  ali  17  1MNTQRIIEIARDNEALLSAG-KELDTLIAQYPQVALFQKLKAKQFQLNSDPNYQLQLKKTAVFSPDRKKLYQYLIQPQIVKQIEEVEEELKVSPAEIEVKEVQTQKKQTSVPSP---------LEKYSFEKEEEPNTEEIARKQLEREILQHAVSSSILLDADHVEIQKESTEPNEPAKATNEEQVSKDDNFNELGLLDWLKLGEVKQEEKKPDELIEAFIKSDPSHISTSEEKETKIIINRPKQEFFSPENMAKMSLMEDEDLVTETLAKIYAKQGNLSKARKTYEKLSLKYPEKSDYFARLKKELDNKQ.. 301
223 6.000e-19UniRef50_UPI0005F229CF hypothetical protein n=1 Tax=Hymenobacter sp. AT01-02 TaxID=1571877 RepID=UPI0005F229CF  ali  13  1MTRASLLHILNHVSEISDAETRELEQLAAAFPYCQTAHVLLAKAAHDRGSMLASQRLRRAATYAANRDLLRQLLETPAPSVREAAPVLEQSVHDAAVATTLAEATPEAVTELEADQLPTTPQEALAESRPAADPKQEAADHLAPATTEPELAEPALTEPDEIFKAYLPLASENLLVIPATSEQEQPEQRNDHTPVLSPGTDTDDTSVETASSETVNSISEKTEVILLPIAQHEAEAPTTEVNQQEEPAHVVP----SLGVEGDGAADTLATQLSEQ..................................... 272
224 6.000e-19UniRef50_A0A2T5Y410 Uncharacterized protein n=2 Tax=Sphingobacterium faecium TaxID=34087 RepID=A0A2T5Y410_9SPHI  ali  18  23.DINLFHQAINNPLSLSESDLLS---LIAKFPYAQSLRFAYERHLYLLNREVHN--ISSTLLYAANPNWLYEYLHKAAPVEWIDEVESADDYIAFEDTVEEEDEKSDLDQENDGTEPDILELSSVSVIESVENPISVTKEQDEERVSVYDDELMPYSFLWWLHKTRLDHAETYQPEQHVTRFKQKIDAQVLDQQIRENIFHLQSPEVKLSEEFKNTVPFQVEKKNTDHLIERFIKEDPQIKPPPADKINLENKARKSSEDQYSLVTETLARIYIEQGLYPKAIEVYKKLVLKYPEKNAYFASEILNLEKKL.. 382
225 6.000e-19UniRef50_A0A2T5JCI9 Uncharacterized protein n=2 Tax=Mucilaginibacter yixingensis TaxID=1295612 RepID=A0A2T5JCI9_9SPHI  ali  18  349.........................................................................................................................ENPVVEEKAHEDLSKYNDDQMPYSFMWWLDKTRKEHSNLYQPYITNPQTSSTGAAANSPTGLATKQVADDLQQQYYENIFHVTNIDEFGKETTPQPLEFDMQSKEDRIIQRFIAEDPQISPPSSERLDTENKAKRSAEDADSMVTETLAKIYTDQMLYPKAIATYRKLMLKFPEKSSYFASRIEILERKTN. 539
226 6.000e-19UniRef50_A0A1G8JVZ5 Uncharacterized protein n=8 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1G8JVZ5_9SPHI  ali  19  222.................................................................................PVAVDEAKDVRDDVTEKWIIGNIASTDYFLFDNSVVDTRNDDKAISQESAPQPAEIEATEQQEVLSKYNDEKMPYTFMWWLDKTRKEYASTYQPYNIETVAQPKKPVASDSQTQHQYYENIFHSQSLEELEKTPQPDVPEIKRKEDIIIEKFIKEEPQIRPPSIDKLDNENKAKKSSEDRNDLVSETLAQIYIDQMLYHKAIATYKKLMLKFPEKSRYFASQIEELEKKTN. 456
227 8.000e-19UniRef50_A0A150WYZ1 Uncharacterized protein n=4 Tax=Roseivirga TaxID=290180 RepID=A0A150WYZ1_9BACT  ali  23  19.NRERFNQLLGNLHQVTNEDIKSLNDLRKKYPFFQTPYVIVAKALKDRNHPKTDAFIKKAAIYSPNRAHLKKIILGEISFEAPQENTIKKKQGKTIETPETSKEIVTPKAETETETVTKEAISKTDKDGPQEEPIVPQTLGKQNPEINQLEKDLLEIKERKLRLAKMFEG-------------------------------------QEETKTIKAETTPQSNKSQVELIEKFIQNEPRFENKKENEYTQEDLAAKHMKSKDEFVTETLAKLLLKQKKYTRAIDIYKKLSLKFPEKRTYFASQIQKIKEVQN. 296
228 8.000e-19UniRef50_A0A256WQH8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_77 TaxID=1972459 RepID=A0A256WQH8_9BACT  ali  19  1MDIRNLYHWQENPHLLNKETLVELEQLLKEYSYSENIRLLYALNLLITNDYRFQKALVFAAVFSSNRKTLKYW---------------------------------------------------VESLNKISQEEELKTEITAIELEDQKNPTLKENTAKSAIDIEQGTENQQDITYKAQQQQKAIKSKSELLKLVKKRLSEIDSEKKKQELLTDEHKQGADKQAKTKLIDQFIQNQPSISRPDDFFDPQNEAVNSTIDEDDFFITETLAQIHADQGNKKKALEIYRKLILRNPKKSSYFASRIEELNK.... 260
229 8.000e-19UniRef50_A0A1N7LEQ3 Uncharacterized protein n=5 Tax=Cytophagales TaxID=768507 RepID=A0A1N7LEQ3_9BACT  ali  18  1MNAEQFLEIIKQGNQLSKEQVNQLVKLHENFPYFQIPNVLLAKYEYQKSKGKAKDFLPWAAISSPNRAWLKVLLG----------------------------------------------EKLIFPVSSPNTPSSDKKIQAEKEDGEDEAELIPKPSPEENPTQRAGLXXXXXXXXXXXXXXXXXXXXXLKKPKRKKRAGAADDLIETIKRKEKKEIVDVKKKEQIDIIKAFSKKEIKLATIKEIESKQEDLSEKSTQLNPNILSESFAKLLIKQGKKGKAKEIYQKLMVKFPNKSTYFADLIKELED.... 265
230 9.000e-19UniRef50_A0A2C6CP08 Uncharacterized protein n=2 Tax=Lewinellaceae bacterium SD302 TaxID=2014804 RepID=A0A2C6CP08_9BACT  ali  18  6MNRQTFLHFLEEPAKLYQLPLIELQGLVLEFPYSPNLRLLLLLKARLEDHPRQQEMLQQLASRTFDREHLHDMIRELDREAIREEAAKEERLELPDLNKLDFAFVTNDSQEEVAAKENSLAAEINPPPAPVTSEDELLETISDEVQLPDDDDGPTLADSFNLDGIITETTAPTKTVSTEPEATPATDQDNLLPAAISISEVTRSYYASYRPPVPQPIEELVAPDSDGDRPDKVKSRLRRHRKKQRERDRLKEIARQSVSAHDEVASETLAKLLTRQGQYAKAIKMYQRLSLQNPKKSVIFAGLIQELKEKL.. 338
231 9.000e-19UniRef50_UPI000DE98C16 hypothetical protein n=1 Tax=Mucilaginibacter sp. ZR32 TaxID=2201324 RepID=UPI000DE98C16  ali  20  371......................................................................................................................QDVVTPAPEASTQTASDAVSADEESNVSRYHDEKMPYSFLWWLDKTRKEHAGVYRPYAAVQPQASAGQVAVTDALQQQYYENIFHITSVDQLDKSTAGNGDSKVKHKGDEIIERFIKEEPQIRPTNTERLDNENKAKKSSEDQNDLVTETLANIYAEQMLYPKAIAIYKKLMLKFPEKSRYFADRIKNLEKK... 562
232 1.000e-18UniRef50_A0A1K1RTA0 Uncharacterized protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1K1RTA0_9BACT  ali  17  1MTANKIIQHIFQLPDIKQVDEHSIDRIISQYPYFTAARLLLARKQYCEQKNLLAPAVKKAQQFSNNMHYFYRFITTDEVVVEPVVAAPHESGAETESALAETPADVYEAPFVEESEEITTFTSDDELHIGTDNVTVTPEEPEPEVIKEQIKEEEQEMVPEPIIVASDLPATITGEEVEKPFKIFPLEMPALEDSSTLTFQPLYTDDYFAYKRLKDPEKADELSEKGRAEMKSFTSWLKDMKTSPEVSEAVEKMAMSSITLNNDMVTETLAEVWAKQRQYNTAILIYQKLSLLNPGKSAYFAQKIKELQIL... 363
233 1.000e-18UniRef50_UPI0006BBC12C hypothetical protein n=1 Tax=Chitinophagaceae bacterium PMP191F TaxID=1691979 RepID=UPI0006BBC12C  ali  14  5..IQTLVKQIFRKDDLKDVTVNELEQFTASFPYAAVGQFLLARKLKETGSEQFTHQADKASLYFNNPLWAHWQLQQQATAVTEPAPVLPIVTQRAEAPVQHEPVVSVVSLAEEAVEQQEIPTIATPEADATISEEQPEIIHSTETAEVTDVQPEEEDDYEPEEKEDDTNAPPLPPLLQATGTPMQTVQAPEEDLFEPYHTIDYFASQGIKLSKEDTDTIQGTLDRQLKSFTEWLRSMKRIAPVDDTTNQSIVQIAEHSVSGNEIVTEAMAEVWAKQGNLPQAIAIYEKLSLQNPAKNAYFAARIQEV...... 352
234 1.000e-18UniRef50_UPI000DC47879 tetratricopeptide repeat protein n=1 Tax=Alloprevotella sp. E39 TaxID=2133944 RepID=UPI000DC47879  ali  22  2....RISEYINRPEKLDKQTLFELRTLLAKHPYHQPARLLFLKNLFLLHDATFSEELHKSALFLPDRRVLFDLVEASNYDIKTENEQTGKTEKSTKGK------------------------------------DSTDSIIDKFIKETEKAEGGGSIDHKPTAADATTNYIEFLNRQKGPENKSQKSKKEQSRGDRLLNDFIESGGIKIKPEEKEQPTQEGTDNTKKEKAEKNAHKETKDSKKKTATESILQ------ETDDSYFTETLAKIYIKQGKYEKALEIIRTLSLNYPKKNSYFADQIRFLEKLIIN 268
235 1.000e-18UniRef50_UPI0006A9F2CC hypothetical protein n=2 Tax=Persicobacter TaxID=59740 RepID=UPI0006A9F2CC  ali  19  2.........LFNLEKVTLSEITDLQDLSEQHPYCSLYKILMAKIAKENDGLDYREMLASAALRSPNRKHLKSVLETQNLKQFFSLTLSDETTSGKYLIPQHKLLEEDNFVSSESGIKNNNTLNLPSASEVAEPKMEGFTAARSPEIEAEAN---------------LAEQIHASLEEYLRVKTEYEDQQDDEQAFPDAEEKSITEEENKQVDNTYMTDREHLLKEQSDLIDRFIADCPSVSRPERESTKAVDLSNQSTKMSSELYTENLAKIMERQGNFSEAVKIYEALIWKFPEKKAYFVNCIEKLQNQK.. 291
236 2.000e-18UniRef50_A0A256W4Q9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_112 TaxID=1971630 RepID=A0A256W4Q9_9BACT  ali  20  17................SQSDITELKALQQKYPYFQIGSMLLSKALLKNKDAAYKTTLAKTAALVLDRDVLFKFLYKDILNTPTKPRISPTPATTVAKEKTTVKPEVKAPISDIKSVSKPEGPKPILSAKGDEIKDKKEMMKVEKAKVEEKKEPKKSIEKEAKSSVKKVAKKSDVKVAKEKAPAKTTKKVTKASSTASSKKPISKTAKKSTAKPRVKKIKPVDRTTSIAIMEKFISEDPSINRPEDKAYEKEKLAKSSVAEEYNIVSETMAKLYSAQGNKKKAKKIYEKLSLIYPEKNTYFAARISEL...... 356
237 2.000e-18UniRef50_A0A2J6H310 Uncharacterized protein n=3 Tax=Mucilaginibacter TaxID=423349 RepID=A0A2J6H310_9SPHI  ali  19  377.....................................................................................................EPEPAESAPKHADTQAQQIDATAQPTAESKADEGRVARYDDDKMPYTFLWWLNKTRKEHAENLRPYAPVNRVQAGNAKEAGVDNLKRADELQQQYFENIFSLTSVSGIEREDTPEPVEFDHTKKEDVIIERFIQTDPQIKPLSADKLDNENKAKKSSEDQNEVVTETLARIYADQMLYHKAIATYKKLILKFPEKSTYFAARIGELEKKTN. 587
238 3.000e-18UniRef50_A0A1H8NAH1 Uncharacterized protein n=1 Tax=Mucilaginibacter sp. OK283 TaxID=1881049 RepID=A0A1H8NAH1_9SPHI  ali  20  319......................................................................................................................................EAETVSKYHDEKMPYTFMWWLDKTRKEYASTYQPYLSPVQQQATQGITAEEKKEHAADELQQQYFENIFHDKSLLDLENAPIPDAPEVKRKEDIIIEKFIKEEPQIRPPSINKIDNENKAKKSSEDKNELVSETLAQIYADQMLYHKAIATYKKLMLKFPEKSRYFAHQIEQLEKKTN. 496
239 3.000e-18UniRef50_A0A2H9VSM6 Uncharacterized protein n=1 Tax=Mucilaginibacter auburnensis TaxID=1457233 RepID=A0A2H9VSM6_9SPHI  ali  18  283.................................................................................................KHDANIESSYEVFEPVLPQDEEQKAANIAAHPGGRKTGDRMARYNDEKMPYSFMWWLDKTRKEHAAVYQPFVEGQKPVEAAATIQKPQPPADHLQQQYMENILTVTTVVNELSLVPPKVDAPPPADSKVDKIIERFIQEEPQIKHPASAKLNNENKAKKSSEDIDELVTETLAKIYTEQMLYHKAILTYKKLMLKFPEKSLYFAGQIEQLEKKIN. 497
240 3.000e-18UniRef50_A0A1M3R056 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1M3R056_9SPHI  ali  16  1MNVNDIPDHLFQKRALEDVDAGDIEQLVIKYPFYAPAQYLLAKKYQQPGGDRYTDQLKKTALYFTNPHWLNALLHPETLPEREVKYIEKEAGIAGKTVVDAAPDYITEEEEPVQHTFGKTIVDIVEERLMVEEKSVEPEIDEVSDTGTAEQAENIESVQYEEPGETLNPELPVTEIKTGNFDQPLPADDHTGDIIPIEPLHTVDYFASQGIKLSHEYEGKDKLSKKLKSFTEWLKTMKKIHPERNNTQSSIQNIAEHSNEQKEVVTEAMAEVYARQGLHKKAIETYQKLSLLNPDKRVYFAAKISKLNE.... 369
241 4.000e-18UniRef50_A0A2S9JES2 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=A0A2S9JES2_9SPHI  ali  18  164...............................................................................................................KDKQFEQQKGEISEEQQTENDRKEENISLYNDELMPYSFRWWLHKTRLEHADTYQPFASLRIPVANRTSFNPAELDRVTLDQQIREHIIHLQHPEDKLSDEVKRRESIANGPSKVAEVIERFIREEPQIQPPQPENLNVENKARKSSEEQFDLVTETLADIYADQAMYVKAIEVYKKLILRFPEKKSYFATRIKELEEKL.. 363
242 4.000e-18UniRef50_A0A1N7DKV7 Uncharacterized protein n=4 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1N7DKV7_9SPHI  ali  16  205................................................EDDVYDEILGIEHIHIAGHEHEKAHEPVVADEKPKASEPEPMSEDWVIGSIAGSDYFMFDRSVADQRHHEEVKKEESAPQVSVAATHTNGSIPADNESQNVSKYDDEKMPYTFMWWLDKTRKEYAATYQPYSSPEPSPAQPARIQQANSVKEPATDALQQEELEKTPQPDGPEVKRKEDVIIERFIQEEPQIRPPAMDKLDNENKAKKSSEDRNDLVSETLAHIYADQMLYHKAIATYKKLMLKFPEKSRYFATQIEQLEKKTN. 480
243 5.000e-18UniRef50_A0A1Q6A6B3 Uncharacterized protein n=2 Tax=Mucilaginibacter polytrichastri TaxID=1302689 RepID=A0A1Q6A6B3_9SPHI  ali  19  278..........................................................................................EEPYYTNYTEQRNDEVIIPAPTTPKPEFNLEDQITESIYATDYFAFKDALLEEPAVQPEQQVAQLEAAQADENQTMAKYHDDNLPYSFLWWLDKTRREHANMYQPYAKPSALPAMESLADEKEALGLSLPDTKHKEEEIIERFIQAEPQIKPPAGDKLDNENKARNSAEDSDELVTETLARIYIDQMLYPKAIATYKKLMLRYPEKSSYFAGQIENLENKIN. 499
244 9.000e-18UniRef50_K1XP90 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1XP90_9ZZZZ  ali  19  1...............MKDNDLSAIEQIIERYPWYSSAHLELYKRLSELGGEQREAYLHKAAAYLYSRDRLYDIAFNVVPALVVSYTP------------------------------------AETSVETSVEFEEEQEKNQEIEKPDLLELDTKELVPDKSKSTALKDSDFEFIFDIDEDKEVIHRVVISGGDYFSRTDFDTIVLDEEMPLDRFIVEKPSLLRSSLASREGFIPTDE------------VEIDSAEVFEDSGFYTETLARIYTSQGFYKRALDVYAKLILLYPEKSAYFATLVKELKTKHN. 249
245 1.000e-17UniRef50_G0J589 Uncharacterized protein n=6 Tax=Cyclobacterium TaxID=68288 RepID=G0J589_CYCMS  ali  17  1MNAQGFLDLISKADNLENADLKKALKLQEKYPYFLAPKVLAAKYEWDKASGASKTLLHWAAVVSPDRKRLKSLLTGTSPIVQHHPIETPPVALDKNSESKEIIAPSAPPLPEKTNTQKEEVVTDNTSRPKRDEILRRLEENLKKIKKTAPSSNTNN------------------------------QEQVKKKEEVLEKEVEKKEPTTESNKKPKKPATKKNKKAQQKLIDEFKEKPIRLTKDKLDESVAPDLSEQSTHLNHSMLSESYAKLLFKQNKKNEAVEIYQKLILNFPKKRAYFADQIEKLRE.... 280
246 1.000e-17UniRef50_I4A1B8 Uncharacterized protein n=1 Tax=Ornithobacterium rhinotracheale (strain ATCC 51463 / DSM 15997 / CCUG 23171 / CIP 104009 / LMG 9086)  ali  28  2....EILELLKNPLDLKDNKLFLIERELEKYPYFQPLHLLQTKAMQGAEESIFLENLQKTATYCGSRKILYDYLFYQKKEKTETSTPLIAKEVKEEIEQKPILDNAQEAEREQTLAIEQPEESPKEEAQIPQKSELLFNQWLKANKKSDLSSSEDEKNDKSH--------------------------------------------EKTFQEKNQSSAELEGIQDKLKIINEFLEKSPKIKPSEDYKPSPIKLKQD--QNMSHLMTETLAKIYVEQKKYDKAITAYNILRLKYPEKSGFFADQINLIKELKNN 264
247 1.000e-17UniRef50_A0A223P1Q7 Uncharacterized protein n=2 Tax=Mucilaginibacter sp. BJC16-A31 TaxID=1234841 RepID=A0A223P1Q7_9SPHI  ali  18  425...................................................................................IEPDIISNIAATDYFRFDQAFGGHEEQAAVNETEPVVQQIQEAVNSEADDADQQDVTKYNDEKLPYSFLWWLDKTRKEHAGVYQPYVPAVDEKKRKAKVKPGTDELQQQYYENIFHITSVEELDKITPPPPHETSGFTPKLKEQVIIERFIQEEPQIRPQSSDKLDNENKAKKSSEDRDELVSETLAAIYSDQMLYHKAIASYKKLMLRFPEKSRYFAEKIEQLEKKTN. 653
248 2.000e-17UniRef50_A0A142HNZ4 Uncharacterized protein n=1 Tax=Mucilaginibacter sp. PAMC 26640 TaxID=1300914 RepID=A0A142HNZ4_9SPHI  ali  17  471.................................................................................TPPAEENAPAADIPVAPIAEVAPQAAAISVAPAELPAQQAALPEHEPDVVAKYNDESLPYSFMWWLDKTRKEHAGTTQPYVAATPTPPNSPFRPEFNPSQETLVQKPIPDELQQQYYANIFSLTSVSSIGDAEPPQIAFDPDKKEDVIIERFIHTDPHIKPLAADKLDNENKAKKSSEDQDIMVTETLARIYGDQMLYHKAIATYKKLQLKIPEKKLYFASRIEQLEKKIN. 701
249 2.000e-17UniRef50_A0A1R4L0A1 Uncharacterized protein n=3 Tax=Sphingobacterium TaxID=28453 RepID=A0A1R4L0A1_9SPHI  ali  16  151...........................................................................NLNYDLSRSSQEDDLHSLVNEGIGGGDFFALHSKPVTGETAEEGASRAEKAAQKTEKEKEEDISLYNDELMPYSFRWWLHKTRLEFAETYQPFASPSLPIKNKPAFDASELDRVILDQQIRESIIHLQDPEDKLSDATKQRATAPPAESRTTEVIERFIREEPQIQPPPAEQLNMENKARKSSEEQFDLVTETLAAIYTDQAMYVKAIEVYKKLIVRFPEKKSYFATQIKELEEKL.. 386
250 2.000e-17UniRef50_UPI00082BD19A hypothetical protein n=1 Tax=Mucilaginibacter sp. L294 TaxID=1643920 RepID=UPI00082BD19A  ali  17  290.............................................................................FHQPEGVVEPATDHTKTIEQEDRLILGGIVNADYLSFDKKLDELRNTAPAETAKPQPETQEVSRYDDDKMPYSFMWWLNKTRKEHAENLQPYATVLSPAEKTGETTRRPKAADELQHQYYENIFSLTSVSGVDRETDPAEVAFDPNKKEDIIIERFIHTEPQIKPLSADKLDNENKAKKSSEDQDYFVTETLARIYTDQMLYHKAIATYKKLLLKYPEKKLYFAAQIEQLEKKTN. 524
251 2.000e-17UniRef50_UPI0003784761 hypothetical protein n=1 Tax=Lewinella persica TaxID=70998 RepID=UPI0003784761  ali  16  48MKPQEFQQYLEQPGLLYQLPLTSLQQLAMEYPYSPNLRLLLLLKTHLEGHPDEADYLSRCSAASFDRSFIYDLL--------------QDIELQPAGGNQEDTEILELRTLDEIALEEAAMLAEDASTSSPETEPSYQSVFPPLEDFVEEPDLPLEPKVVPVPPSPVDTYHSWADNAAAYLSALPEQPADPTVSQSPEPVTNFRNAALTKKAPSLRERLLTIRRFQADKIADEQEEVKKI-------------ARRSLVAQEAVASETLAKLLVRQGQYQNAIKMYQHLALLYPKKKTTFAGLIKDLKEKL.. 331
252 2.000e-17UniRef50_A0A2N3IF84 Uncharacterized protein n=1 Tax=Raineya orbicola TaxID=2016530 RepID=A0A2N3IF84_9BACT  ali  16  1MDKQILLGLLHQPEFLKDNLLEELNEIIQKHPYFAIPHILLAKNLHDQASSLAPQKIRRASLYAYNRSILKKFIMEKPTRINAEEEFDKKMETITPEELDKELASITESYIPQEYNLEKESENNTNTELHLTENQKEQNSLIDEFLKSDFFTSTPTTNLEESSTETDSEEQSQINIFSMSFDDIVTNEVLSTTPETTDVDLQINTDSLLQEILNTPKAEKSTPSTSEKFSEDFQATEIENSTSQPETSSQTTDNSFADVLSDDEVSEAKAIAYFNEGNVAKAIEIYRKLMLQIPEKKAYFASQIEILE..... 362
253 2.000e-17UniRef50_UPI000693ACB8 hypothetical protein n=1 Tax=Flavihumibacter sp. ZG627 TaxID=1463156 RepID=UPI000693ACB8  ali  14  1MELNKTIQHFFHQPHLDVVDIDEIRRATERYPYVGAXXXXXXXXXXXXXXSQTDDQYAKAALFVPNIYQIDSVLRDRPVHENFTSPFVRELVPVQEKEEPKVEPERSTVEPGYEIENAQSHSEEVEEVQVKELEQLLEMEPIKEDETEIAPEPYLEEGKESEEFSKEQHDDTPEMESPIPIPSLRDISPRTDEMPVFEPYHTIDYFASQGIKLGQDVKPGDKLGKQLKSFTEWIRTMKRLPNTEMEQQENIVAMAAGSVEMKEVVTETMAEVLLKQGNKARAIDIYRKLSLAYPDKSAYFAARIENIK..... 324
254 2.000e-17UniRef50_A0A1Z5SEZ6 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium IBVUCB1 TaxID=1985173 RepID=A0A1Z5SEZ6_9BACT  ali  13  7..IQYISQVLAEPQNISDADAESISALIETYPYFVPARYMDAANKHKQEPYN-NPMMSAMQLYMNNWLMYCQFLATAMNSDAAIPAQAATETAATAEEVITAPTTAITTEDTDIAADEIIEEESEAFIQPPPQPIYTQKKAPKQEDEDYQPETDESFILPVYTEDYFLHQGMQVSNNIPTDLPGKDISPAEEAKSLMVVMSFSEWLVYFKKRKEQEQEEVEGQKAVKTMWQKEKLAAALEEENEEIPEKVFEMAVNSITKEDDLASESLAEIHAMQGKYDKAIEMYRKLSLRNPQKKAYFARKIEVLLKDKQ. 340
255 3.000e-17UniRef50_C2G0J6 Uncharacterized protein n=3 Tax=Sphingobacteriaceae TaxID=84566 RepID=C2G0J6_9SPHI  ali  20  147................................................................................QEAQLEKEYFPEFQLSDEEIVPDPQEEGTTELEKEYFPEFQLSGEEIVQVSSEEEERVSLYHDDLMPYSFLWWLHKTRLEHAGTYRPFAEVKLPKPQKGQFDPSKLDEHILDQQIREHVFRSQSPEAKLSEEVKHKPVQPL-PKKLDDVIEKFIREEPQIKPPQADQLNMENKARKSAEDQFTLVTETLAIIYADQGLFPKAIEVYKKLILKFPEKNAYFAGRIKELEQKLN. 377
256 3.000e-17UniRef50_A0A069D3Z9 Uncharacterized protein n=1 Tax=Bacteroides graminisolvens DSM 19988 = JCM 15093 TaxID=1121097 RepID=A0A069D3Z9_9BACE  ali  18  1MTSYDLQQWMEHPDQLNRETLYEIRTLLARYPYFQSLRLLYLKNLYLLHDITFGPELRKAALYVADRRSLFYLIEGEKYAIQKAEKKKNLSGEEDEEPGLDRTISLIDAFLSTIPEESENALENDMPVGDEQPATDAPRLKGQDLIDGFIARNDAESLWVKKQMLAAEPAAVEPIPAAPEELIAQEPEQPEEDETDVPDEEIDSTTDPETEQIEVETFVGEEDEDEEEYYNEEEDEEPQIPQDETAEATHDNPVLEDEDDEEGCFTETLAKIYIKQQRYEKALEIIEKLNLNYPKK................. 338
257 5.000e-17UniRef50_A0A0M3C9Q4 Uncharacterized protein n=1 Tax=Sphingobacterium sp. IITKGP-BTPF85 TaxID=1338009 RepID=A0A0M3C9Q4_9SPHI  ali  20  3..........................................................................................FFDWKTDDILEEIKDDISNEPMLSVESTFVIGPVDEEVREEERISVYDDELMPYSFLWWLHKTRLEHADTYQPFLKAPNYHAHSAEQHVTRFKQTIDAQVLDQQIKENIFHLQSPEVKLSEEFKNTVPFQVEKKNTDHLIERFIKEDPQIKPPPVDKINLENKARKSSEDQYSLVTETLARIYLEQGLYPKAIEVYKKLVLKYPEKNAYFASEILNLEKKL.. 223
258 5.000e-17UniRef50_A0A1I7N054 Uncharacterized protein n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1I7N054_9BACT  ali  15  1MTEEKIIAHLFAANSLSDVEIYRIEETITRYPYFALPRYWLAKKLWQDQSRPDASTLPRARLFADNPFLFLQYLHTPFDDVRQEADIREAPAIEAQAASSSASSELSESTAAEAFIANIEPSSQSLAPEAQEASETPISLQSAEVPAAPSKADSGQEPAEEGLSSPWVAPLYTRDYFAYAGISLAEEEADLHKPTSAQMKSFTEWLRSTRRPLHST---------------------------DPDASEDDDASESHTEPSFRVITESMANIWLQQGQPQKAIEILEQLRLLNPEKSDYFAQRIASIRNQI.. 285
259 5.000e-17UniRef50_A0A2D5BCZ0 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium TaxID=1898111 RepID=A0A2D5BCZ0_9FLAO  ali  24  11........LLKGKSSFSSKTTKKLGDLVDKYPXAPIFHFLYLRGLXEEDSYKFPSQLNRSSVSTMNRSALLDWAETPLIPIEIQIAAIEDSNQEKQAEVPQVKTSNNYHKENEDKEKPKGSRSEIKTVQTKSPSIKGSEKIVDLSSLPEKVRDQILRSRAIKAKYRSVEDDDLSVSEQREKKSPSKKHSDKYLNQLSPFAQFLNNLQLEENKENSLVNEDRDINKERAILKQFIELNPKISAPRNF--GKSEDLTLKTPNVSGLVTETLANXYFEQGAFLKAIQAYEILKLKVPQKSSIFAARIAEMRNLQ.. 353
260 5.000e-17UniRef50_A0A2N2WT62 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2WT62_9BACT  ali  18  1...............MSDNNISVIEQYLGKYPWFSEGYLDLYKAMCSLEGDVGLTYLNKAASHVWSRSKLYELIEQADADSEIVEVEIPAAVVETPAVEVEIEAPVVVAEILAVEVEAPTVEVEIPAVVVETPVVVVETPAVVAEIPEVVVETEVPAVEAEAPVAEERVEPESEKPAETKPERVAVKIEERTTKPAKTPTYREYELIQLDEDEDQKKDFEMIELDLSQPLDHFIAEKPTIIGKGTKPVVINDTESAESLDDEAFYTETLASIYIEQGFYKRALDVYAKLILLFPEKSSYFATLVKEIKNKYN. 336
261 6.000e-17UniRef50_A0A2S6I7V9 Uncharacterized protein n=1 Tax=Lewinella xylanilytica TaxID=1514080 RepID=A0A2S6I7V9_9BACT  ali  17  2...............LAEVSLDELLAQLASYPYSTNLRLLVLLKAKQSNHPDFEAHLSAFASSTFDRSQLYHLLTALEQREESSSDVLELIELEELELSPLESSFNEEIPSRLNELPEPQTETNRFPVT------EIKPIFLEPFDEEPLFPEVSPGVARTARWVRLAEAYTSLFPSMFKSPRPEDPAHFLTELRYQPQTTL----------------------------------NERLRKLRHLTVHRPDSTKGNGLEDVAVVSETLAALLVRQEQYQSAIQMYRRLTLLYPEKKPIFAGLIKELKEKL.. 257
262 7.000e-17UniRef50_R6ZX04 Uncharacterized protein n=4 Tax=Bacteroides TaxID=816 RepID=R6ZX04_9BACE  ali  21  1MIQQHLQQWIEHPESLGTESLYELRQLLERYPYFQTARILYLKNLFLLHDPSFQEELRKGALFVADLSVLFYAIEGEHFVIKQHAGPKESSHPGSDDRTLDLIDRFLADASEPSA--ETLLPLPAEAVDYTSVLEEEVQAGDTVAVAPLRGQELIDSFIEKNAKEEEHPEEKQVPEEAGVEEPCLPSKEEKEGVPPSEIVNEVPEVEEEENYFTETLAKIYVKQQRYDKALEIIKK----------------------------------------------------LNLKYPKKNTYFADQIRFLEKLIIN 259
263 1.000e-16UniRef50_A0A2E2Y785 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2Y785_9FLAO  ali  20  1MNAKQIKEYFENPEKMDAAALISLQQAVQDFPYASALQMLYMKVLKSEXSYQLPSQVKRAAISVPDPALLKHFYDSSNKEELPTITFDKKLQSENSKKKISSKREEVKKASKSLVTKEEKVESSKNQVAKSVAPKSETGSLDHLPEKVRNAITRSRELNSSSLKKSYETAKVPATENDIEAQQKSKKVVPVEQTKKEGSTQQKREKPKDLELAEMVNPAQDIQESEDIRIMPFSEKASQLPKFESNLDGKINVFNLEADKEGRFVTETLAEIYFNQRVFDKAIKAYEVLSLKYPEKSSFFADRIRAIKKEKN. 370
264 1.000e-16UniRef50_A0A1G7K8X5 Uncharacterized protein n=2 Tax=Mucilaginibacter pineti TaxID=1391627 RepID=A0A1G7K8X5_9SPHI  ali  19  277..........................................................................................FDNSIADQNGSDKNDSGAQPEPASSQIEIVATQNTIGGAESIDISKYHDEKMPYTFMWWLDKTRKEYAATYQPYSAPLVAPAQSQPAPALAAELKDQAADALQQQYFENIFHDKSLQDLEKTPQPDVPE--IKRKEDVIIEKFIQEEPQIRPPAMDKLDNENKAKKSAEDRNDLVSETLAQIYSDQMLYHKAIATYKKLILKFPEKSRYFAHQIEQLEKK... 494
265 2.000e-16UniRef50_W4PB87 Uncharacterized protein n=1 Tax=Bacteroides pyogenes JCM 6292 TaxID=1235809 RepID=W4PB87_9BACE  ali  20  1MTSANLQEWIEHPEKLDRDTLYELRNMLARYPYFQTLRLLYLKNLYILHDISFGTELRKSVLYAADRQKLFYLIEGGNFAIQPRKENIAAEEAVEEEPSVDRTLALIDAFLANAPEEITNQTGLPDYSTDYTAYLLQDEAAGEVAEPHHRLKGYELIDHFIENSEKD.................................................................................................................................................. 167
266 2.000e-16UniRef50_A0A1S9PC37 Uncharacterized protein n=1 Tax=Mucilaginibacter pedocola TaxID=1792845 RepID=A0A1S9PC37_9SPHI  ali  17  422...................................................................................NASTPTETAAQPVAQVPAPEPTAEPAIEAAPEPVAQFAVAEVTQQPQIAETAKDPERVSKYDDDTLPYSFLWWLDKTRKEHAGSTRPYAQAQPQGAAIADNIKAVTADGLQQQYFANIFSLTSVSSVGDIEPPQIAFDPEKKEDVIIERFIHNDPQIKPLAADKLDNENKARRSSEDQDAMVTETLARIYGDQMLYHKAIATYKKLMLKIPEKKTYFATQIEQLEKKIN. 650
267 2.000e-16UniRef50_A0A2D1UAE6 Uncharacterized protein n=1 Tax=Pedobacter ginsengisoli TaxID=363852 RepID=A0A2D1UAE6_9SPHI  ali  21  8..KEKLAELIAAPEKVSQHDSAMLQDFAKQHPYFQPVHALYTNGQLLHNFLHETESLESSSPFGNDPETLDEVIIDEVPGESEELQITDDQEVFDEIGEVDISEYNQESREQENFKVEPAPETLEVTQIEEYQETESVEEDDTIVISKYDDDQLPYTFLWWLAKTRKEHQQIFQPYASPKQVKKEEKPDVNKKANELQQQYVENIFHMQSPFDEEEASEFKPRTKGDEIIESFIKNEPQISPPKPEQINNENKAKKSAEDHNDLVSETLANIYIEQMLYDKAIETYEKLSLMFPEKSRYFADLIQSIERKI.. 369
268 4.000e-16UniRef50_UPI00041357B5 hypothetical protein n=1 Tax=Rikenella microfusus TaxID=28139 RepID=UPI00041357B5  ali  32  109...................................................................................................................................................................................................................................SVIDEFLSNEERIAPPPPGAEGQEDISAESVAEDGEIATETLAGIYLAQGLPDRAIEIYYKLSLKYPEKSVYFANLIADVR..... 193
269 4.000e-16UniRef50_A0A1G6S1X9 Uncharacterized protein n=2 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6S1X9_9BACT  ali  28  73................................................................................................................................................................KHNRTTTPKEIDTQEYEELAKPVLVEVDLLEITENSQAEKIIESQNSLPNSLPSKDLIELDEVDEKVDLIDAFLKAAPRITPPKELPTDQEDISLESLKEPQDVATEMLARIFVEQKLFEKAIAAYEKLCLKYPEKSAYFASQIEEVKKKLQ. 224
270 5.000e-16UniRef50_A0A1V5GC21 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA245 TaxID=1852818 RepID=A0A1V5GC21_9BACT  ali  17  4.QINQLVKSIFQKENLEQCSLQELQRYAERHPYFGAAQLLLTKKMQVEHNDNYNDQLQKTFLFFNNPLWVKQLLDESGNATIQPAEKEKPVAINEAAVLEAILPPVASTEVVSQIEEQTNLPEIQLQIKKSQEMALKDELVFEPYHTVDYFASQGIKIKEEEKPVDKFGKQLKSFTDWLKTMKRLPITDLKNT-------------------------------------------------PVTQAEQKVEVLAENSLADRHVITESMAAVWEKQGNTQKAIEIYEKLSLLEPTKSAYFAARIAELKK.... 262
271 5.000e-16UniRef50_A0A1M3GHQ6 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1M3GHQ6_9SPHI  ali  16  1MNQNDIAAILLQKE-LKDADETQLRRLAEEHPYFAAAQLLLAAKLQQNDDAQFGAQLQKTFLYVQPPLRLQHLLYNTGDADVEEKAGTEIIASVIEKEAPAVDIPVPLVETTGPAVSETAEEVPVASKTILPEELPEQPAAPSLEETELVIDQTPPAMETEYEEEPLPEGAEDDMPARPIPGLKIEPIDPAKAELNFTPYHTVDYFASLGIRMREEEKPSDSFGRQLKSFTEWIKVMRKLPRTDAVAEKKVEILANDSVTGEQAETEAMAEVWEKQGNITRAVALYQKLSLQDPAKSAYFASKIEELKKK... 320
272 6.000e-16UniRef50_UPI000684E877 hypothetical protein n=1 Tax=Olivibacter sitiensis TaxID=376470 RepID=UPI000684E877  ali  17  342.............................................................................PQSQELEDPSVNELPREGEFETDIIETASVPDEAPVVEPEKEQSTETNLSPAVGKEEKEEVSRYDDEHMPYSFLWWLHKTRIDYADTYQPYNVHDSRLSKTKKPAGNDIDTLLDQQIKQHIFNLQAPEKKLSIQDTGKEERTFHFASKTDDIIDRFIKEEPQITPPRADKITLENKARKSAEDESEFVSETLATIYIQQGLYHKAEETYSKLSLKYPEKSAYFADRIEDLRKRK.. 575
273 6.000e-16UniRef50_A0A2N2Z5A0 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2Z5A0_9BACT  ali  17  1...............MKETDLSALEQTIEKYPWYSLAHLEFFKRMNELGEDHRNAYLRKAAAYLYSRETLYDLAFPKSDHSRGEVHTEN------------------------ESFDLSQEPEVMEPDTRADAEADVVELIPDLEEEDDFFEFIPDTDDEPVTEQRVVFAGGDYFSRVELETLELDREQPLDKFIVEKPSLLRASTTSSPKADSPYVKDGDPSPAEIDTSEMF--------------------------EDSGFYTETLAKIYTEQGFYKRALDVYAKLILLYPEKSVYFASLVKELKTKHN. 247
274 6.000e-16UniRef50_B0MU71 Uncharacterized protein n=16 Tax=root TaxID=1 RepID=B0MU71_9BACT  ali  33  78...................................................................................................................................................................................................................................DLIDRFLKEGGHRIVAEEGEVVEEVRTEAELSGDDDLVTEDLAEIYLAQGLYDEAIAIYRKLSLLNPEKSVYFASLIDKIANK... 160
275 8.000e-16UniRef50_A0A2G4GK66 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium TaxID=1869212 RepID=A0A2G4GK66_9BACT  ali  13  8.....LIQSMFERESLDEMTLDELQALAQQYPYSSIVHFLHTSKLKETFDRHFPEALSHTALYFNNPHWLDYQLSDENERGLIKKFNMEEDEEVSSISDPLSEEKIPFTSDSYHNNSEEDELDIDLHPYAHVEKTNEAGYXXXXXXXXXXXXSTHEPISVDEDNLDLNEIEEPTFNTTFQETKPETIDKTAEGQLLEFDPYHTVDYFASQGIKFNDKEDKDELGLKVKSFTAWLKTMKKLQPIALNTSENNDSGEENTEEPFPIVTEAMAEVYLKQGMAEKAIDIYTKLSLQNPSNSHIFANRILAIKQ.... 348
276 8.000e-16UniRef50_A0A1H1NSA4 Uncharacterized protein n=1 Tax=Mucilaginibacter mallensis TaxID=652787 RepID=A0A1H1NSA4_9SPHI  ali  19  310........................................................................................................DKKKTNTDVTIDKSQPAAEPFKPYAHNIPAKFVNNKRVSKYNDDKMPFSFLWWLNKTRKEHSGIYQPYVEFTLDTTQSIKETPPADELQQQYVENIFHLTSVEELDRSTGLIPVEFDSKRKEDVIIERFMQEAPQIKPQTSEKLDNENKARKSSEDKDELVTETLAGIYADQMLYHKAIAAYKKLMLKFPEKSRYFASQIEELEKKTN. 517
277 2.000e-15UniRef50_A0A286A685 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A286A685_9SPHI  ali  20  223.........................................................................IAEEIPAIHKLEEAEEVIVDQNTVEEDEELVIETVAATDFFAFDRSFSTETTTVPEVEETEVNELDTAPAASIDIPAEHIVSKYDDDQLPFTFLWWLAKTRKDHEQIFRPFASPVAANAQPLQQQYVEHIFHIQAPLELIEEVATTSLPTTKEDSIIDNFIKNDPQIKALKPDQINNENKAKRSAEDSNDVVSETLAQIYIEQMLYHKAIDTYQKLSLKFPEKSGYFADLIQSLEKKI.. 460
278 2.000e-15UniRef50_A0A090VZW9 Uncharacterized protein n=1 Tax=Jejuia pallidilutea TaxID=504487 RepID=A0A090VZW9_9FLAO  ali  44  1MNSHDFTSLLQNPQQINPQKTEALESIIQDYPYFQSAKALYLKGLKQQESTKYNQALKTTAAYTTDRSILFDFITSDVFVQNEISKVIKKNTIYLNDINVSAM.................................................................................................................................................................................................................. 103
279 2.000e-15UniRef50_A0A2W2BEI0 Uncharacterized protein n=1 Tax=Taibaiella soli TaxID=1649169 RepID=A0A2W2BEI0_9BACT  ali  16  3.QPASITNWLKNPETLASLDMHAIKELIHQYPFFAPARMLAAAQEHKTAPF-TNPVMQTGFMYSGNRFLFQEMLEHAAGNRRIIMEATPAPSIDPVSDETVNDNKKEKTLIQPIYTEDYFLHQGISVDDNIPSALNNPKQEVHETEEEDDEKSLMRIMSFSEWLMYYKNKXXXXXXXXXXXXXXXXXXXXXKLAAALG------------------------------------------EENDEIPETVFEMAVNSITKEEGLISESLAEILIKQGKYDKAVEMYRKLSLRNPQKNAYFAQKIEAVLKAKK. 270
280 2.000e-15UniRef50_A0A2N2ZBD7 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-13 TaxID=2013681 RepID=A0A2N2ZBD7_9BACT  ali  43  1MNLSDYIYLIQKPEAVTPSQTKELKIVLDEFPYFHSARAVYLKGLKNQGSFLFNDNLRTMAAHTTNRSVLFDFISSETFNQFAISKQIKDNEILVKNLNVVGAIEINPGREHPESVLTINEAEKI............................................................................................................................................................................................ 125
281 2.000e-15UniRef50_UPI000571D5D5 hypothetical protein n=1 Tax=Thermonema rossianum TaxID=55505 RepID=UPI000571D5D5  ali  14  3.NAETFLALLAG-QALTEEQYEEVEALIDKVPYAGLLHLLAARYQSKQGSHLAPQKIRRAALHMYSRKRLFQLSGASGSLKEELSKARNVXXXXXXXXXXXXXXXXXXXXXELDQELEKITTSYTQPKDYFSSLEEEDTAAGEQIVSKPLEQKEENKTASPAPEIPPPDELSESYAITLYSAGKVREAVAVYEALKKKYPEREAYYQSQIDILKEDLGDNDVVTPDVENTTPPAGEDTAQETQPPTMPKPKSLVDALQEAPQTFYTELDAIRLRDEGKDEEAIKIYERLILQHPEKKAYFEKQIQIIKGL... 323
282 3.000e-15UniRef50_A0A1Q3MXF3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 47-18 TaxID=1895926 RepID=A0A1Q3MXF3_9BACT  ali  17  3.TASKLSDLLQHPAGIHGYDNAAVEKWVKEYPFFSLFQ--YIRSLKTDPSADLAALRQ---LYPAHPVLLYLLKQNSSSSYHYKDVSIPETAAADTREAAAKFDNPVDEILFSGSHTPDYFPPAEVSEDIPEDIPTVLHAADPEQATAEDEE----------------------------------------QMALMRVMSFSEWLSFLSHKNKKEKAEEESRRHLKAMWQKEKLAKAMEDETDEIPETVFNMAVNSLNAPEDIMNESMAEVYVRQHKYTKAIEIYQKLSLLYPEKSTYFASKIEKIKKEI.. 267
283 3.000e-15UniRef50_A0A1M7PIW7 Uncharacterized protein n=1 Tax=Mucilaginibacter sp. OK098 TaxID=1855297 RepID=A0A1M7PIW7_9SPHI  ali  17  504.....................................................................................EPDIINNIAATDYFVFDRAFGEHKEPEPVSEAAQSAPEPVNEQDGEAEQQDVSKYNDEKLPYSFLWWLDKTRKEHSGVYQPYIASEKENAVNTNTRSKPNTDELQQQYYENIFHITSVEELDKSVPPPHTPFEFDLKNSKEQVIIERFIQEEPQIRPQSSDKLDNENKAKKSSEDRDELVSETLAAIYSDQMLYHKAIASYKKLMLKFPEKSRYFATKIEQLEKKTN. 730
284 3.000e-15UniRef50_A0A110B0T5 Uncharacterized protein n=1 Tax=Mucilaginibacter gotjawali TaxID=1550579 RepID=A0A110B0T5_9SPHI  ali  16  363.........................................................................IDETYDEIVGIENIHFSDQSTYKPATGDSFFSFDREFGAHADPEEEEAEQAAPTAAANGQADAEQIDVSKYNDEKLPYSFLWWLDKTRKEHSAVYQPYVKPPAANTQPGKRPKKLTDELQQQYFENIFHITTVDDLDKSAAPPKAPYDIKRKEHVIIERFIKEEPQIRPQSSDKLDNENKAKKSSEDRDELVTETLAAIYTDQMLYHKAIASYKKLMLRFPEKSRYFADKIEQLEKKTN. 601
285 4.000e-15UniRef50_A0A1Q6EI00 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 52_46 TaxID=1897040 RepID=A0A1Q6EI00_9BACT  ali  34  173..........................................................................................................................................................................................................................................QDEPQRIPATTVENRHSDEAAAAQQQDTSLLSESLAKIFIRQHQYERAYEIISQLSLKYPEKSVYFADQMRFLRKVINN 251
286 4.000e-15UniRef50_A0A0E9N335 Uncharacterized protein n=2 Tax=Flavihumibacter TaxID=1004301 RepID=A0A0E9N335_9BACT  ali  14  11..........FRQPTLESVSIPELERAISKHPYAASLQLLLLKKQQQEKDPGFNSQWDKCSLYFPNPYLLQTVLSETSVWVKPAAEPVSPLKTEQYHVADPVVPEPEALVKSTVTEAVAAPAPEVPAE--------------------------PESPVQSTEDNSTLRSDILSRESPIPIPGLKDILPQTDSQPLFEPYHTIDYFASQGIKLSTEVAPGDKLGKQLKSFTEWIRTMKKLPAPRIEQQLMDAGNGEKIQEHREILTETMAEVLVKQGNIQKAIELYAKLSLAHPDKSAYFATRIEQLKQ.... 290
287 4.000e-15UniRef50_A0A2J6I0K1 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6I0K1_9BACT  ali  27  45....................................................................................................................................................................PDEQKAESITPETWTEKIEETESAGRISELKKVVEERILETEAEEKTKAADQGKKDYPEKSKKILIDQFIENEPSITRQKGTFFNPVVAAKKSVTDQENIISETLAQIYMDQGFVDKAISTYEKLSLKYPEKSTYFAALIEKAEKKHE. 192
288 4.000e-15UniRef50_A0A1J5TKX1 Uncharacterized protein n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5TKX1_9ZZZZ  ali  17  1MNAEKVLYHLTQKSNLTDISVDDLSHLAKNYPFFAPAQLALAVKLKQDNDFESQTQLQKTALYFSNLNWLQYQLMNGEAKNFRPSEEIKPEPVREENKISEEYKAFVPNIQETADVADDKQEKVVEAHKTFAPPINEIIAADDEQEKTDEKNIAPVQRTEIIEPPGSIDLKIPSNNKTIRQPDKKPVAENAKLDFEMEPYYTIDYFASQGIKVDLTKQPHDKLTKQLLSFTDWLKKMKTVSPNPQDLGTDPELEKQTSNEAKEIATETMAEVFVKQGKIDKAVQLYIKLSFLDPEKSSYFAAKIQQLK..... 370
289 8.000e-15UniRef50_A0A1T4R9X4 Uncharacterized protein n=5 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1T4R9X4_9BACT  ali  15  17.....................KELRNIVREYPYFAPARFLLAAVLQARQRPEAPVAVSQASLYFNNPLWL---------SYKLNKAVAETATEEPEQEITPASFDTPVDTGESDYDFEAGDDTDAPENADTSIPADSKLSSLLSDQLADFKKPVTEDAALEIDADKKKLHTIDYFASLGIKLDLNAIPQDRLTTQLRKFTDWLKDMKHPDAVAAAQASSAGIENERAAA-----------------------QIAENSNESREVVTESMAEVLEKQGQTEKAIQLYIKLSFLNPEKSAYFAAKIQHLK..... 271
290 1.000e-14UniRef50_A0A2N2WKS3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-6 TaxID=2013696 RepID=A0A2N2WKS3_9BACT  ali  19  11.......................LNEMLQHYPYSPHYGVETLKLLKESDPASFSTLLEKLSFKVPNRYMLYQILNPVLTVEPIENLAEAHEETPSAEVVLEYIPPIVIEEVVKHDPVIEKEPGIETLPETVEEAVIEQQEAFVSAESSNIEEMAAPENSFEDNKKPVIEE---------------------------------TDPMKILQQRLAELSGNQERPPIDEIIEKFIQEEPSIRIDRSKQPDKRNLAESSTRENYEVVSETLAKVYEKQGLSQKALTIYEKLLLANPEKSSYFAPLIEEMKKKL.. 265
291 2.000e-14UniRef50_A0A235DY97 Uncharacterized protein n=5 Tax=Sphingobacterium TaxID=28453 RepID=A0A235DY97_9SPHI  ali  17  133................................................................................EDLESEPIEEEPAFDFPSGYNIEKEFAEESNEETIQDTPEVEVNVPEEESQRSSEEDISLYNDELMPYSFRWWLYKTRLEHAETYQPFSSPVLPRQQKGQFDPKKLDEAILDQQIRENIFHLQDPSDKLSDKHKKETVEFKSTEKMDEVIEKFIREEPQIQPPSAEAINTENKARSSSEDQLQVVTETLANIYVSQGMYEKAISVFRKLISDNPEKKSYFATRIKEIEQKL.. 363
292 2.000e-14UniRef50_UPI0008D98AEE hypothetical protein n=1 Tax=Millionella massiliensis TaxID=1871023 RepID=UPI0008D98AEE  ali  32  108..................................................................................................................................................................................................................................NSVIDDFLNSEGDVPPPADVDIPQEDISLDSVADDGEIATETLAEIYLAQGLPDRAVEIYYKLSLKYPEKSTYFADLIADVQ..... 193
293 2.000e-14UniRef50_A0A0U3K149 Uncharacterized protein n=1 Tax=Hymenobacter sedentarius TaxID=1411621 RepID=A0A0U3K149_9BACT  ali  25  178.........................................................................................................................................................................................................FFEPDPLLLDYWATHSPPAPVVPSSLDLINNFLRRQPRLTRPPPAASTQADLSIRSTRAESDLASESLARILVRQGKTARAIEIYEKLMVKQPEKMAYFASQIQQLQ..... 287
294 3.000e-14UniRef50_A0A1F3J361 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWE2_42_42 TaxID=1797339 RepID=A0A1F3J361_9BACT  ali  17  1..........................MLEQHPYSAHLETLVLFQLQKEKPDLFTERIGQSSFKVPDRYMLYVNLQETYADDIESTQKEEAIIASIPVSETIVEEEIIVPVTIPESDVTIQSVSETAIAEETIENIPEVEEVTVEINNEDLQITNEPVSVILDPVEEEIQPIIQNADDPTETVENQKEEEIYQEEVPVQQVAAEEVKEEIQEEPREQEKPQDMEKESIEIIDQFINTEPTIKIDLNRLPDRRNLAEKSTIEKFEVVSETLAAIYEKQGRYEKALLMYEKLLLANPEKSSYFAPLIENLKKKL.. 311
295 3.000e-14UniRef50_W4UNW7 Uncharacterized protein n=1 Tax=Bacteroides reticulotermitis JCM 10512 TaxID=1445607 RepID=W4UNW7_9BACE  ali  26  1MSSVNLQQWIQHPEKLDRDSLYELRNLLVRYPYFQTLRLLYLKNLYILHDISFGTELRKAVLYVTDRRKLFELIEGERFTLYPRKKEASQVDELAE......................................................................................................................................................................................................................... 96
296 3.000e-14UniRef50_UPI0006911EBF hypothetical protein n=1 Tax=Flavobacterium chungangense TaxID=554283 RepID=UPI0006911EBF  ali  22  49...................................................................EPLKIEEQSIDSITEQPTLDSFKEVTPAIEEVPIIKEQTRTFFDEIVEDEVPEVRVESIEQSVYTSLQDASTIVFEEALEEPTETEVPQSVKIAEENLEIGKPLDFSVSEKHSFQEWLQLARPEPIDRTNEGPKEAVKTEIEVENIVENEIMDEEKKKKAEIINKFIEANPKISPIKQTAITPAVQPDSHKEDNSYLMTETLARVYLEQKKYTKAIQAYEILILKYPEKITFFADRISDIKILQQ. 293
297 3.000e-14UniRef50_A0A1W1W0R7 Uncharacterized protein n=1 Tax=Hymenobacter roseosalivarius DSM 11622 TaxID=645990 RepID=A0A1W1W0R7_9BACT  ali  14  1MTRASLLHILDNLGDISETEVQELEQLAATFPYCQTAHLLLAKAAHDRGSMLAAQRLRRAATYAVDRQRLRALIELPALLPAIEATQVAVAPAPLEIAPRPALASTAISAPEESQATSNTSGSELELPNPHHLGSIDLAVTTDLQEPPILAEDEVAEEGITVATPFPEEAFATTSFSNVSEVNEPQSIELTEQETDVEATASDKQDSLLAAETTGEDADTATAVEAASATEAELSLSLRETPE...................................................................... 244
298 3.000e-14UniRef50_A0A1M6HQP2 Uncharacterized protein n=1 Tax=Hymenobacter daecheongensis DSM 21074 TaxID=1121955 RepID=A0A1M6HQP2_9BACT  ali  28  286......................................................................................................................................................................................................................HTPPAPLPSRSSFDLINKFLRAQPRLKAPTPAAEEQADLSVRSLQGVPDLASESLAKIMVRQGKIGKAIEIYERLIVRQPEKKAYFADQIQQLK..... 382
299 4.000e-14UniRef50_W0ESE7 Uncharacterized protein n=1 Tax=Barnesiella viscericola DSM 18177 TaxID=880074 RepID=W0ESE7_9BACT  ali  47  180..............................................................................................................................................................................................................................................................PADTATDDTFFTESLAKIYIKQRRYEKALQIIKKLSLKYPEKNIYFADQIRFLEKLIIN 238
300 4.000e-14UniRef50_A0A136L4U1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium OLB8 TaxID=1617419 RepID=A0A136L4U1_9BACT  ali  13  6.......RLLHFPSMLRSIEESVLVKNLLLYPYFGVLYLLQALKRQDQEEEYFPPVLANDGIYSWYRMGVMHSCNQAVDPHDRESEVIISDESHVEDSNESKEEQSEQYVAKRSNGSLIGMVTEVVEVSALDDMEEDTDAGSPEPEDKSRLSHDVETRIIYREKYSLPRITVNSIYEKGGRVSFAGTGDYEYFDPNSEELSGFARFLRKSTRNTSINPEMRSESTPDPSDAKQSHGVAAISPKKRKKELVDRLVQQSISDNELLVSEPFAEILYAQGYKDKAIKIYEKLMLKNPEKRDIFAAKIVLINNEKN. 337
301 4.000e-14UniRef50_A0A174QEL2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A174QEL2_9FIRM  ali  27  60.......................................................................................................................................................................................................................KKNEAAATRDPFDVIEKFLQETPSRRSPATGTLPGEDLSRESVTEDPDLISEELAEIYAKQGFYSKAREIYTRLSLLYPEKSVYFAE........... 146
302 4.000e-14UniRef50_UPI000C0C0FE4 tetratricopeptide repeat-containing protein n=1 Tax=Sphingobacterium sp. 1.A.5 TaxID=2044604 RepID=UPI000C0C0FE4  ali  15  138...........................................................................DQQNILETEPVFDIPSGYNIEKEFADDDEDVEEDEDFEIEHENQIDINTPAVQENQRTAEEDISLYNDELMPYSFRWWLYKTRLEHADTYQPFSSPVLPKQHKGQFDPKKLDDAILDQQIRENIFHLQNPEDKLSDQHKKETVEFKSTERVDEVIEKFIREEPQIQPPKAESINTENKARSSSEDQLQVVTETLANIYESQGMYEKAISVFRKLISDNPEKKSYFATRIKEIEQKL.. 373
303 4.000e-14UniRef50_A0A226HPL2 Uncharacterized protein n=1 Tax=Flavobacterium hercynium TaxID=387094 RepID=A0A226HPL2_9FLAO  ali  29  502..........................................................................................................................EKHSFQEWLQLSRTEPIDRSKDVSNGEENTTEEITVEEIEETKAEEIPETVIPETTIEEKAIEEIKPEADTKPEPVAIEKAPETDIEAVTTTNIPVEEVEKKKKAELIDKFIEANPKIPPVKEIVTTPTVQFDINKEDNSYLMTETLARVYLEQKKYTKAIQAYEILILKYPEKISFFADRISDIKILQQN 693
304 4.000e-14UniRef50_G8X820 Uncharacterized protein n=5 Tax=Flavobacterium columnare TaxID=996 RepID=G8X820_FLACA  ali  25  1MNTAELISLLKNPNTITHSQCSELESVLKEYPYFQSARSLYLKGLHIQDSFKYTTALKLTAAHTTDRTVLFDFITNKNFAQELYFTENTSAYETKTISPEKITKPISNIIEETRNTTISLELESEAQSSATDEEKLEQSVLNSIIIANEIVEDVNDNTIREESISLKNPLEKSILSSISESDQSANNKIEVATSINPSIREKISWLEDTVDLEQEQAIDINLSE......................................................................................... 224
305 5.000e-14UniRef50_UPI00036A828D hypothetical protein n=2 Tax=Hymenobacter TaxID=89966 RepID=UPI00036A828D  ali  28  120.....................................................................................................................................................................................................................HARAHQPAPKASSLDLINRFLKAQPRIKAAGSPATEQADLSVRSSAGAPALASESLAKIMVRQGKTAKAIEIYERLMTKQPEKMAYFAEQIQQLQQ.... 219
306 6.000e-14UniRef50_A0A1D7XZG5 Uncharacterized protein n=11 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1D7XZG5_9FLAO  ali  32  71..................................................................................................................................FDFITSEVFLQNDISTHIKQNFDQIKTIKVEEFQDISSHTSLIVDDSESKLELGKPLEFDKTETFSFSEWLRVAQKKPIDRSESSEPEEESNRDKKFALIDAFITNKPKLKPLDKNSKLI-NIAEDSAFETEDLMTETLARIYVEQKNYDKAIQSYRILSLKYPEKSSLFADQIQAIKVLQE. 251
307 6.000e-14UniRef50_A0A1F3QBB1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_35_15 TaxID=1797364 RepID=A0A1F3QBB1_9BACT  ali  16  1MNRSQFISYLENPDKLSGNDGVMLSELLKNFPYFQTAHLLYAKSLHNQNSIHYNNQLKIAAAFVTDRKKLHRLITKQYIPEIDSQIERIKEKVTVTEESNEKAVIEIVKEEIKEQHVVIVTEEIRVVETVSQDIEIPQVVKTGEKVIEKITEFIKEDKVIIIEQPVEIKLGQEEQINAIEKPYERIDALEVEYLSNVANASFELEIENYGSNSDGNNAESIDIKVEEE..................................................................................... 228
308 7.000e-14UniRef50_UPI0006973B60 hypothetical protein n=1 Tax=Aureispira sp. CCB-QB1 TaxID=1313421 RepID=UPI0006973B60  ali  18  2...................SYEALDQLLLQFPYCNGIRMLLLKKYKTDKHIAFERHLALASMYAADRSKLYDFLNTPTVANEKTKVIDMKPSDDSEAEKKTPLTTELADPPPENEEEENRSLSNMPIEEWLQEFEPPRIDDKNPALKKGFKLSRIPVFEKGVFDFLEEEAEPKENSTQPTTRKAKTSKKKTRKKTKDVSFVPNAKEETLEDTFPKVEVDKSEQELEFQNLEQMYEKNAEDKKESDIENSTEAWEDDSTTENEEVASETLADLLALQGQKSKAIKMYKTLSLKFPEKSRLFADKIAEL...... 341
309 7.000e-14UniRef50_A0A1Y4C8X9 Uncharacterized protein n=1 Tax=Muribaculum sp. An287 TaxID=1965623 RepID=A0A1Y4C8X9_9BACT  ali  39  144......................................................................................................................................................................................................................................................AEEPEPASPDKPFDDMRFYTETLAAIYAEQGYFDKAKEVYGKLILLYPEKSAYFASLIEKLKQ.... 206
310 8.000e-14UniRef50_D4IJ01 Uncharacterized protein n=12 Tax=Alistipes TaxID=239759 RepID=D4IJ01_9BACT  ali  31  74..............................................................................................................................................................................................................................QLSSEEIIDRFLQEEDLRIVAGEGEPEEEVVLQPELDDDDEVVTEELAEIYLTQGLRDKSVAIYRKLSLRNPEKSVYFAELIGKIENNIK. 163
311 9.000e-14UniRef50_A0A246FHS6 Uncharacterized protein n=1 Tax=Hymenobacter sp. CCM 8682 TaxID=2006685 RepID=A0A246FHS6_9BACT  ali  14  1MTRASLLHILDHANGMAEAEVRELEQLAAAFPYCQTAHLLLAKVAHDQGSMLAGQRLRRAATYAADRELLRRLLEYPIAPSPAAPAETTLPDAAQPDAAPEPDAFAVALAPAAPQAQPESAEAATEVAAIEPATTESAAASDTQDPARFPETEPGPAVANWPEPAPERPENEVPETAEELGDISAGEFSSSADEPVVLLVATPDKAVAAANNDLLPALPPPIRPPAEAGISRF................................................................................ 233
312 9.000e-14UniRef50_A0A1S9B0R6 Uncharacterized protein n=1 Tax=Hymenobacter sp. CRA2 TaxID=1955620 RepID=A0A1S9B0R6_9BACT  ali  34  368....................................................................................................................................................................................................................................LIDKFLRSQPRIKRPAPTDAPQADLSVRSTSAPPSLASESLAKIMVKQGKTARAIEIYEQLMQRQPEKKAYFAAQIDLL...... 449
313 1.000e-13UniRef50_A0A2W5W4L5 Uncharacterized protein n=1 Tax=Citrobacter freundii TaxID=546 RepID=A0A2W5W4L5_CITFR  ali  16  4..ISQLTHALTGKERLQDCTEEELRQIVRLYPFFGPAQVLLAKKKKEAQDDDAVDVSARAALFVPNPLWFGNLMDEEESDPESAQSFAHDTILETPATAEEVVAQPSFIEEKEEVKAIIPEETVLEEPATEEEVIKQEAPTEDEKATAITGEENEETRTAELPEETADPDLTEQGDKAPLRPIPSLKIEPIDPGKTELSFEPYHTVDYFASQGIRFREEEKPRDRLSVQLKSFTEWLKTLKKVPPQEEKNVEQMAKTSISEREVVTEAMAEVWEKQGNAVKAQELYEKLSLLDPSKSAYFAAKIEHLKQL... 371
314 1.000e-13UniRef50_A0A179DH48 Uncharacterized protein n=1 Tax=Pedobacter psychrophilus TaxID=1826909 RepID=A0A179DH48_9SPHI  ali  17  476....................................................................................VDENNQIKNKPERKSLEEILFDSPVQSDFFAFTKEKTQVKETIQENIKEEEATTVSQYNDDSLPYTFLWWLNKTRKEHSLNNNQPYVVAKPSLQKKENKPFSTDPLNHQIAENIFHLRSVEDVEKNKQSTNFTVPYDFRQKEHKIIEKFIKEEPQIKPPAANKIDTENKAKKSSEDANEVVSETLAKIYVEQMLYHKALDVYKKLSLKYPEKSTYFASQIKYLELKVN. 703
315 1.000e-13UniRef50_A0A2N5YV35 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YV35_9BACT  ali  24  2.............................................................................................................................................................EEKIKSDNTENDLDILDINQFTSSKKEEKSEKNYTKPDLKSDDYLNFEFENELESEKSEKKIILNSDKKIALIDKFLSSDPRIVPQKDYTSNGSFATDSVLSEDEELFSETLAKIYIKQEHYDKAILTYEKLCLKYPEKNIYFVSQIEKIKELIKN 157
316 1.000e-13UniRef50_UPI0002DB46E5 hypothetical protein n=1 Tax=Alistipes ihumii TaxID=1470347 RepID=UPI0002DB46E5  ali  28  63..........................................................................................................................................................................................................................RPDTARSEADVIDRFLSRERRIVPDPASFPAGEDLARESVREDPELISEELADIYARQGLYAKAKEIYARLSLLYPEKSVYFAEIIAGL...... 152
317 1.000e-13UniRef50_A0A243WB27 Uncharacterized protein n=1 Tax=Hymenobacter sp. MIMBbqt21 TaxID=1770526 RepID=A0A243WB27_9BACT  ali  18  318........................................................................................................................................................................................QSSDELTLNELMFKVPMGSFEPDALILAHLASHQPAAPTRTSIDIISQFLRNKPRLKPTLPPADEQADLSVKSTRAEPDLASESLALIMVRQGKSDRAIEIYERLMVRQPEKMAYFADQIQKLK..... 444
318 1.000e-13UniRef50_A0A126P9W0 Uncharacterized protein n=5 Tax=Hymenobacter TaxID=89966 RepID=A0A126P9W0_9BACT  ali  25  406................................................................................................................................................................................................................................SSIDLINTFLRRQPRLTRPAMLPPAQADLSARSTRPETELASEGLAQILARQGKTARAIEIYERLMVKQPEKMAYFAAQIQQL...... 491
319 2.000e-13UniRef50_A0A0X3APQ2 Uncharacterized protein n=1 Tax=Apibacter mensalis TaxID=1586267 RepID=A0A0X3APQ2_9FLAO  ali  22  1MDNSRIIQLIENPGKLKFSDKNYIEDLITKYPFAQSFHLVYLKNRYISDSLN-KKDLQKISIYTSYRELIKKSTDDNKKLMKSVTTTEDIIREEENKNLLADENIILESIDSNEFMEEENNLIKLNEIDVNYEKILNKIKTSEELLSDSSKKLDFQPVEDTSKEELNEKFDESKIKDASLNDQNIENEKENITLGLGKLTFNQWISLSKQKNASKAKKTIPQQERQNNIISNFIENNPKIKPVAKDTQYSKDVEKEEIQDIANLMTITLAQLYVEQGKYDTALTAFKILSLKYPEKSSFFASEIRRIKKIKN. 368
320 2.000e-13UniRef50_A0A1Z9CRG3 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TMED120 TaxID=1986702 RepID=A0A1Z9CRG3_9FLAO  ali  31  71...............................................................................................................................................KDWMEIEVSAPPKFSEKKTHKPAPKKKTKTTTKKENTTPNSKKNTTKDSPLRIEKKKAERTFIDWLDQDEKPSITPSKSKGAQWDVIDSFIENNPKISSSKEISPAKNNLAKQQIFEKEELMTETLAKILVQQKKYNKAVKAYKILSLKYPEKNTFFASQINEIKRLIE. 240
321 2.000e-13UniRef50_A0A2E5ANE4 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E5ANE4_9FLAO  ali  16  16.............SELSLEDSKVFKELMSLYPWCSSFTVAYLKSLKTKNDLRFSSELEKYAVELNSRSIIYDLTKNFSQKDEEQGSVEHQTSEKLESVSPDVTVDSPKQGTQTENKLDKLIESEALAARVLNDLKDELPDQVSEEEPTKTSPVNIEVDKSRLNQEVTNVDTPRSFNEWLSVGSVKNESNQKKEYLTF-------------------------------------------EKPKVPFFSPVKKAKESLKLENLPVSETLAKVFESQGNYVMAKSTYEQLILIFPEKKSFFADQIQKLINKIK. 271
322 2.000e-13UniRef50_X1UYJ0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1UYJ0_9ZZZZ  ali  41  1......................................................................................................................................................................................................................................DRFIETDPKIVPEKESWLVQEDISEKSV-ENEGFMTDTLAKIYIRQGYYSKAIFAYEELSLKFPEKSSYFASQIERLKKLIND 82
323 2.000e-13UniRef50_A0A1B2Z558 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1B2Z558_9BACT  ali  15  5.......NYIESIQSLEKNQVPALDQLLNKYPCFHGMFLLKGIYLKQQDEEHYEQALPNIAVHVNDRTVLYDLVHRKYGVIKSKKS-------------TSLVNKISPIKEDVLVPNEPVIDENSEDLKSLVQAIRSNRKKQTSSQAKERSPKNIEGSVNKNKSKSKREKPLAPRKKDQDKKIQATNSFTDWLKNQKPVDLASQSQVPIDPAVSREAELILEAKRSSFKLEDFLVNQIQRKQNKKEGASVTRTNAVS---------ETYAKILANQGKLEQAISIYKELSIKYPKKSSIFARQIEKLK..... 288
324 2.000e-13UniRef50_A0A212T7G3 Uncharacterized protein n=1 Tax=Hymenobacter gelipurpurascens TaxID=89968 RepID=A0A212T7G3_9BACT  ali  12  1MTRASLLHILDHVSEISDAEIRELEQLAAAFPYCQTAHILLAKTAHDRGSMLASQRLRRAATYAANRDLLRHLLEQPAPVAAATVAEPGLAIVPAAPAADEAPTAEADSTVSALFIEDETIANSSEXXXXXXXXXXXXXXXXXXXXXSTNSASTLAGDFAEESPSTAEAPFIVLEADQDGALVSEAVAESVPTPGLETQLNDVQVTTGERAESTETPEAELTAFTEPEKVATTAEVAPVSIEEIEQPTKIAEVAVEPTHEI-PTVDETSASV......................................... 271
325 2.000e-13UniRef50_UPI0006937349 hypothetical protein n=1 Tax=Hymenobacter sp. APR13 TaxID=1356852 RepID=UPI0006937349  ali  25  1MTRASLLHILDHVGGISEAEIRELEQLAAAFPYCQTAHLLLAKADHDRGSMLASQRLRRAATYAADRQLLRHLLEQP............................................................................................................................................................................................................................................ 77
326 2.000e-13UniRef50_A6L8G9 Uncharacterized protein n=25 Tax=Bacteroidales TaxID=171549 RepID=A6L8G9_PARD8  ali  17  1MRAEDLYRLMEEPSELTEGTLLELRRIVEDYPYFQVARMLYLKNLAVLNDMSFTSELEKMAIFLPDRKKLFQLIEGDKYGLNSRVEHEPDMRKEDTFSLIDAFLSNRNEEPEPKKEASFLFQPSVSSDYMFWSLSKEEEEKPSGEDAENRLRHHDLIDSFIKNDQQRMPGSGLEIREETSRAETPESVKDLDDEQSKSLEDSCLTETLARIYIKQKRYDKALQIIKN...................................................................................... 227
327 2.000e-13UniRef50_A0A1F3G1D3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWE2_29_8 TaxID=1797331 RepID=A0A1F3G1D3_9BACT  ali  13  16MNRQQLYTYIQTPDLLSNNDFNDLSTLIKQYPYCQTLRLLYLKSLHNDNNILFENELKITAAYASNRTKLYYLINGENKYKETSQNNTKYNDNQSIIEEEVIESADIDGIPFSESNSDXXXXXXXXXXXXPENIQSIENDVNIEDTEEIIISTNDNTAVIENDIN-IEDTEEIIISANDNNPVIENDVKIEDTEEIFVSTNDNNPVIENDINIEDTEEIIINTNDNTAVIENDINIEDTEEIFVSTNDNNLVIENNIEIDDIINVIEPINENLIKKKNI.................................. 293
328 2.000e-13UniRef50_A0A2M9BRW1 Uncharacterized protein n=1 Tax=Hymenobacter chitinivorans DSM 11115 TaxID=1121954 RepID=A0A2M9BRW1_9BACT  ali  24  399...................................................................................................................................................................................................PLPITEFFAPDALLQEQTPRYRPAPVPAPSPFDLINKFLRNQPRLRTPPASAEEQADLSVRSTQGVPDLASESLARIMVRQGKIQKAIEIYERLMMRQPEKKAYFADQIQQLK..... 514
329 2.000e-13UniRef50_A0A0W8EJM8 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=A0A0W8EJM8_9BACT  ali  30  405....................................................................................................................................................................................................................................LIERFLRSQPRIKRPSPTDEPQTDLSVRSTSAPPSLASESLAKIMVKQGKIARAIEIYEQLMQRQPEKKAYFAAQIDLLNQQTE. 492
330 3.000e-13UniRef50_A0A2M6GER6 Uncharacterized protein n=1 Tax=Cytophagales bacterium CG18_big_fil_WC_8_21_14_2_50_42_9 TaxID=1973956 RepID=A0A2M6GER6_9BACT  ali  15  272......................................................................KINLPASDFAATASNINTETDRVIAEDILARQDPIDADLPEENSFVANTAATNLQDEQETLTRFDEYLFTPEKEAETAEQNTVAPDYQEEIIYKVFDANELGYWMDSSRLGETLLVKNELATAQPYYFSPELFLEYSQHHELTSYQAPPASILTRQLDIIDQFLKLNPKLKSMKISFQPQEDLSSRSTKIKKNIVSENLANILVKQGKIKKAIKIYEHLILKIPEKKAYFASQIEKLQ..... 512
331 3.000e-13UniRef50_A0A1I0DKN6 Uncharacterized protein n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A1I0DKN6_9BACT  ali  27  397.....................................................................................................................................................................................................................HARAHQPAPKPSSLDLINRFLKAQPRIKAVALPAAEQADLSVRSNAAAPALASESLAKIMVRQGKTAKAIEIYERLMAKQPEKMAYFAEQIQQLQQ.... 496
332 3.000e-13UniRef50_K5ZFZ9 Uncharacterized protein n=22 Tax=Bacteroidales TaxID=171549 RepID=K5ZFZ9_9BACT  ali  27  87...............................................................................................................................................................KEENPTREDAFSLIDAFLSNREEEEPKTDASLLFQPSVSSDYIYWSLTKENGQVEEKEEEEEVRLQHHDLIDSFIKNEEQRTPETTGAPVPGNLAELEENQDDSYFTETLAHIYVKQKRYEKALQIIKNLSLKYPEKNVYFADQIRFLEKLIIN 252
333 3.000e-13UniRef50_A0A0J0YES1 Uncharacterized protein n=4 Tax=Flavobacterium TaxID=237 RepID=A0A0J0YES1_9FLAO  ali  22  1MNVTDYTYLINKPDAITEKQTEGLGNVLNEFPYFQSARALRLKGLYDQNSFKYNYALKVTAAHTTDRSVLFDFITSENFVSIQNDYYDQKLLDLLNITVFESEIVLPEIQKVPEIRIDPIEQSILTSIRQATTVVFEESVKTEEQPVIEQPVIIPIKIEQEVIFEELIKTEEQPAALVVEQPLTPAKEETEIVFEELIKTDEQTVPTYIKEETQEQIIPSATEQPVAVPVEEEI-----LAVIEEPIQTEEQPVVTSTPEEPSIVAEETVTI......................................... 267
334 4.000e-13UniRef50_A0A2N2ZCJ0 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-13 TaxID=2013681 RepID=A0A2N2ZCJ0_9BACT  ali  36  1..........................................................................................................................................................................EIESVEESAIEKTPVSFNPNERHSFEEWLKFSVKPGQSIPTETAKQSTSTINREKKFDLIEKFIEQNPKIIPNKESNYHGNLVSENSIAIPE-IMTETLAKVYVAQKKYKKAIRAYKILSLKYPEKSGFFADQIRALTQL... 139
335 4.000e-13UniRef50_A0A1I5UF05 Uncharacterized protein n=2 Tax=Siccationidurans arizonensis TaxID=1227077 RepID=A0A1I5UF05_9BACT  ali  24  416.........................................................................................................................................................................................................FFEPDPLLLNHWATHCPPPPAVPSSLDLINNFLRRQPRLTRPAMLPPPQADLSMRSTRAESDLASESLARIFVRQGKTARAIEIYEKLMVKQPEKMAYFAAQIQSLQ..... 525
336 4.000e-13UniRef50_A0A1S1J0V6 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A1S1J0V6_9FLAO  ali  27  1MNVTDYTYLMNKPDAITEKQAEALGSVLNEFPYFQSARALRLKGLYDQNSFKYNYALKVTAAHTTDRTVLFDFITSESFTSIQSEYYDKKLRDLMEIKVFDSEIVSFEEVKKAPEVRVNPIEQSILDSIKEAATVTFEEPVKAEEKPVNQFIEQSILDSAQEAAAVTFEEPVKTIEKAVESVSEQFIAAEPVEVAPIILEEPAKIEQTETELTEQQPVLPPTKEPTPTFFDEIVEEEIQEIKPEVKEVKVNPVEQ.......................................................... 255
337 4.000e-13UniRef50_A0A1H6R6J1 Uncharacterized protein n=1 Tax=Myroides marinus TaxID=703342 RepID=A0A1H6R6J1_9FLAO  ali  21  1MTLNELDILLRQPQQITEEDATQLKQIIDQYPYFQSVRSLYLKSLYAQNSYNYNQELKTTAAYTLDRDILFDFIVSPDFVAYKPIHIDANIALESTDTLKPADTVTTVTEVITAPEETEIDVTPTVGQLVNQDITTSEETEIDVTPTVGQLVNQDITTSEETEIDVTPTVGQLGNQDITTSKETEIDVTPTVGQLVNQDITTSEETEIDVTP..................................................................................................... 212
338 5.000e-13UniRef50_A0A2N2XWV7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-20 TaxID=2013689 RepID=A0A2N2XWV7_9BACT  ali  28  82.......................................................................................................................................................................................................QHEMLKNSVQTNTQIPEVSDPIQADEISQLIDKFTINPPKMIFDPARHDPNANYAVNSNKEDFELISETLAMVYADQGYVGKAEKMFKKLGLLFPEKSSYFADQIKMLKSKDIN 195
339 5.000e-13UniRef50_A0A1V6CZA5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin123 TaxID=1852804 RepID=A0A1V6CZA5_9BACT  ali  28  114.................................................................................................................................................................................................................................KLRLIEQFLENGATFQPGDASPKSGIDLAEKATEPNDEIITLTFAELLVSQSKYEEAIEAFNKLSLRIPGKSIYFAARIEEVKKKMNH 203
340 5.000e-13UniRef50_A0A0D0EZW9 Uncharacterized protein n=3 Tax=Flavobacterium TaxID=237 RepID=A0A0D0EZW9_9FLAO  ali  26  1MNVTDYTYLMNKPDAITEKQADALGSVLNEFPYFQSARALRLKGLFNQNSFKYNYALKVTAAHTTDRTVLFDFITSEDFTSIQSEYYDRKLRDLLNITVFESEIISPEEIKKVIEVRIDPIEQSILDSIKEATTVTFEEPAKIEEKPIDPIIEQSILTSIKEATPIIKEPTPTFFEEIVEEEEDVAPVRIDPIEQSILTSIKEASKIVFEEVKIEETPQVIEVPETVKIAEENLEIGKPLDFSVNEKHSFQEWLNLSRTEPIDRTNE.............................................. 267
341 6.000e-13UniRef50_K0X7E5 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=K0X7E5_9BACT  ali  41  166.....................................................................................................................................................................................................................................................NQENTEQSASSESSNDDTFFTESLAKIYIKQRRYEKALQIIKKLSLKYPEKNIYFADQIRFLEKLIIN 233
342 6.000e-13UniRef50_A0A2A5X4A5 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium MED-G22 TaxID=1986258 RepID=A0A2A5X4A5_9FLAO  ali  28  75....................................................................................................................................................WKEKQIKMSDKVIHKTEKNNPLKKVVKKPKKKNPTTNEKISKEKTETSPPSQMTFTDWIQFIETKKSDQSKSSTPNERFALVDAFLAQQPKINPKKETVSKNEDLSEPSWTSTEELMTETLAKVFVKQKKYDRAIQAYEILRLKYPEKNSFFANQINVIRDLQKN 239
343 6.000e-13UniRef50_R6SZD6 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=R6SZD6_9BACE  ali  26  88............................................................................................................................................................................................................TYIDEKKREENSKAENEGRKVHVVGGDFFTQTDYEKVRRAEDNVFVPQPIKKKAGQESPFCTETLAQIYAEQGYFEQARKIYAKLILAFPEKSAYFASLIKELDKLINN 203
344 6.000e-13UniRef50_A0A226IKR1 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A226IKR1_9FLAO  ali  28  1MNVTDYTYLMNKPDAITEQQAEALGSVLNEFPYFQSARALRLKGLYNQNSFKYNYALKVTAAHTADRSVLFDFITSENFTTIQGEYYDRKLQDLLEITVVDSEIVSPKPIDKVTFTKIDPIEQSILDSIKEASNVVFEEPAKIIEKPIDPIIEKSILSSIKEAAANTFEEKTKTEEPITSVNEQIIASPSEEEILNSFKEAEKTESNNPIESIIESSVVSPTEEEILNTFEEVTKSEEKTIEP...................................................................... 243
345 6.000e-13UniRef50_A0A085ZQC5 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A085ZQC5_9FLAO  ali  25  1MNVTDYNYLMNKPDAITEKQTEALGSVLNEFPYFQSARALRLKGLYNQNSFKYNYALKVTAAHTADRSVLFDFITSESFTSIQEKYYDQKLKDLLQINVVDSEVILPAATARAAEVRIDPIEKSILDSIKEATTVTFERSVKTEEPKIETVIEQPSVENTPKIETVIFDEVLKTEETETETAADNPVLDAINKIEAVTFEESVKIEEPIIPEIDQSILDSIKKIESITFEEPSKIEENKIDPFIEESILDSIKKIESVTFEEPVKIESKIEPIIDQ..................................... 276
346 7.000e-13UniRef50_A0A2S7SZ92 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium RB1R16 TaxID=2077091 RepID=A0A2S7SZ92_9BACT  ali  15  10.....ISGLLQQAPAAHSKAAGDVDAIIKKYPYFIPAR--YIKAEQSHSKKAFSSELTDTYPYRGNWLMFLDHIQGIKKPVVAATVDLVEEISVVDDQVPAEEIDVLVDDSVSPILLMERDEEILLVEEQIPAEVIEEVVPVVVETVVIEEVVVAENDEDLLKEDEIEEVITVTDEDMQPLTVAEMKEEDIFTPMQSEDYFMQEWLLHFKTTAEKKNSELEDQKAVRTMWQKEKLSAALEEENDEIPENVFEMAVNSIAREEGLASESLADIYMKQGKYDQAIEMYKKLSLRNPQKNAYFARKIEEILKEK.. 350
347 7.000e-13UniRef50_R7HSK9 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:279 TaxID=1262924 RepID=R7HSK9_9BACT  ali  42  205..........................................................................................................................................................................................................................................................PKPTAPVTDDDPSLLSESLAKIYIRQHKFAKALEIIQSLSLNYSEKSIYFADQIRFLKKLIEN 267
348 8.000e-13UniRef50_A0A1V6BS07 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6BS07_9BACT  ali  19  57....................................................................................................................................ESEKTALYVYSRSIPYFILQESLQAEEKQAENEFFTLDLSQEIEKEEAAPSPSAGKQDRGGSAEYILEQPCERTFYPGADYFGKADMANLELDVTVPIDRFISDKPRFVQMLARTGENIDTQQQDTPPDNEFVTETLARIYAQQGYHKLAIASYGKLILLYPEKSAYFATLVQEIKQKINN 240
349 8.000e-13UniRef50_UPI000DC54E7F hypothetical protein n=1 Tax=Flavobacterium lacus TaxID=1353778 RepID=UPI000DC54E7F  ali  25  179.......................................................................................EIFPTEIDEVIEISTEAKDNPSETISETIVEEEKEEEPISIEILEENNEETISTEAISIGQNSFNSSSEEIIPEIEEKLEIGKPITFLQNEKHSFQEWLQLASFKPIDRIDEQNETIPTEKSISKDLKKQENTTDKLKKLKIIDKFIETNPKITPGREATESAAKPIETS--DTTHLMTETLARVYLEQKKYSKAIQAYEILILKYPEKSIFFADRIKDIKILQQN 402
350 9.000e-13UniRef50_R6YMR8 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:714 TaxID=1262749 RepID=R6YMR8_9BACE  ali  37  107...................................................................................................................................................................................................................................................PDEGEATEVSETADEDEDESYFTETLAKIYIKQQRYDKALEIIKKLNLKYPKKNIYFADQIRFLEKLIIN 176
351 9.000e-13UniRef50_A0A132HWT1 Uncharacterized protein n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132HWT1_9BACT  ali  39  135..........................................................................................................................................................................................................................................................EELGRVSLQRDDEICTETLAQILARQGKHSEAIEVYGKLMRKYPEKSATFADRIAALQKEVNN 197
352 9.000e-13UniRef50_A0A1T5KL13 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1T5KL13_9BACT  ali  41  144...................................................................................................................................................................................................................................................................QDMNFYTETLAGIYLEQGYSQEAIDIYSQLILRYPEKSVYFAALIDEINKKDN. 196
353 1.000e-12UniRef50_A0A1F3NXU0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_37_12 TaxID=1797365 RepID=A0A1F3NXU0_9BACT  ali  16  41...................................................................................................KSKHDIQTNPEKSNEIFEKYSIFVHDPVMYRLWVNDDKIVENESINQTNPVFSNKSIQQTDFLKNVPTGNLLFELIINTAESIDSSRYGSVCIPQQVEPIVREQTTASEFVSSQHVETHSSFSPESQRELIDKFINEEPAITPVKNSQTDFSDTEKRSEFRDEEFVSETLAGIFQRQGNTRKAISIYQKLQLKFPEKFTYFAGLLDELK..... 253
354 1.000e-12UniRef50_A0A2D5HN20 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D5HN20_9FLAO  ali  27  78............................................................................................................................................................DTDIIPNKIKEEQIHDKVNKNVKEKSIVKNDSSENNNTSKSELKEMEFYKWFSYIEINKTLPDPNKVDKKFDLIDNFLNNKKRIDPDRNFRNT-EDLSEKSLVSQDELMTETLAKVLMKQKKYNKALEAYQILGLKYPEKNSFFADQIKKIRKLKE. 232
355 1.000e-12UniRef50_A0A2K8XUV5 Uncharacterized protein n=19 Tax=Bacteria TaxID=2 RepID=A0A2K8XUV5_9FLAO  ali  31  71.................................................................................................................................FNYITSFKTDIKNDENIHQQISERLSSEKPIAISSTTTTEITPKIEETVNVEENLEIGKPLSFSSAENHSFNQWLQLSTKEPIARKEEKTIKKVVGKEDLIDKFIQNNPKIIPLEKGKEFAVPVSKN--RQDAALMTETLAKVYLEQKKYENAMQAYRILSLKYPEKSGFFADQIKRIQILQKN 252
356 1.000e-12UniRef50_A0A0X8C2R9 Uncharacterized protein n=4 Tax=Flavobacterium columnare TaxID=996 RepID=A0A0X8C2R9_9FLAO  ali  26  1MNTTELTSLLKNPNIITHSQCSELESVLKEYPYFQSARSLYLKGLHIQDSFKYNAALKLTAAHTTDRTILFDFITNKNFAQERNFEVITPTIHSKFSSSDKINEAIESVSQINEAYTKEELELTKKNTSSNDSINLETEIQNSNVTDEEKLEQSVLNSIIIANETIEDSNNNTITEESISLENPLEKSILSSISESDQSINNKIEIPSSHTPSIREKVSW............................................................................................. 220
357 1.000e-12UniRef50_A0A1G1TL32 Uncharacterized protein n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A1G1TL32_9BACT  ali  22  417....................................................................................................................................................................................................................DHWAAHRPPEAPTSVDLINTFLRRQPRLTRPAMLPPSQVDLSVRNARLETELASEGLAQILARQGKTARAIEIYERLMVKQPEKMAYFAAQIQQLQ..... 515
358 1.000e-12UniRef50_A0A2T2YCC2 Uncharacterized protein n=1 Tax=Adhaeribacter sp. HMF7605 TaxID=2072846 RepID=A0A2T2YCC2_9BACT  ali  18  1MNKSALLHMMHHVSALTDQDVEELEKLVKNFPYCQTAHLLIAKASYDKGNMLSNQKLRKAAAYATNRHLLKKLIYTSDSSISLAEIKEHETSDIKAEAPIATHPNLLISSTADVLHEVPETSNEMDVENAELAPENTGLNNDVPIHSAIVPEEESLVSSTED....................................................................................................................................................... 162
359 1.000e-12UniRef50_UPI0004229181 hypothetical protein n=1 Tax=Adhaeribacter aquaticus TaxID=299567 RepID=UPI0004229181  ali  16  1MNKSAFLDVLHHVSSISEQEVVELEKLVSSFPYCQTAHLLLAKAAYDQGSMLSNQRIRRAAACATNRQLLKRLINTADTNLVLEPIATPEPILTTEPEEVSMPTTIELVEAFSQNSDIAEVPTEVVLLNEEPTSELPVNEELPKLLVNEEPASTESEELNQEVQEPIQELQEPE........................................................................................................................................... 174
360 2.000e-12UniRef50_A0A2J6I0J6 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6I0J6_9BACT  ali  18  50........................................................................................................................EESLPEIALHLPDRLKLRAIYAPESKQELLSDSDSVNPEKKSSERHNQEDKKTKSEAFAGSISQEVTRLIIRNSDFKPLDIYDPLSDIPEQKKDTNTAADITHKEQQKIIDKFIEEQPSISRNRAPFFNPDEQARHSNREPEDLISETLAKIYYQQGNIQKAIKIYKQLGLKFPKKSTYFAAQIEKIINESN. 243
361 2.000e-12UniRef50_A0A0R2SDM8 Uncharacterized protein n=2 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2SDM8_9FLAO  ali  23  183.....................................................................................................................................PSAPKVEPVAVVLPKVEPVQAVPEPVVPTPEPKPVAPAARTSQPKAKKPKQQTAQASQVANEQTSPTLPTSQTILSPFAQFVVNLEASHISKGEELIDQFLSVNPRISKMAKDAPSPVVRTEPDAQV-TGLVTETLARMYAEQGHVAKAIQAYEILKLRVPEKSSIFAARIEALKTK... 358
362 2.000e-12UniRef50_A0A1Q3JS58 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 41-5 TaxID=1895836 RepID=A0A1Q3JS58_9SPHI  ali  14  15.............KDFKDLSADELLKLSTDHPFSGALQLLYAQKLKDENNGDFALQWQKALLYFNNPLFVHHVLNSATASTQIVEESRETIEVGDQEIKVDQPEIEKGIE-------------------------------------------------FSVDQPEEDQQALNIPGLKIEPIDPAKASLSFTPYHTIDYFASQGIKISNEIKSADKFGNQLKSFTSWLKEMRRLPEAEIISKFSNFEQTKVEKMAETSLTGENAITEAMAQVWIKQNNRQKAIEIYKKLSLQNPAKSAFFAAKIEHLKKQI.. 263
363 2.000e-12UniRef50_A0A2V1IZN4 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IZN4_9BACT  ali  26  125...................................................................................................................................................................................................FNPMADYSQVLIKEQEESRLDDGEEPEADEQDRLMDAFVDKEADSRQPENRPSTPRHAASRQAPPPDSMLSESLAKIYIKRRRYEKAYEIIHTLSLNFPEKSIYFADQLRFLKKLILN 250
364 2.000e-12UniRef50_A0A1Q3PZQ4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 37-13 TaxID=1895921 RepID=A0A1Q3PZQ4_9BACT  ali  14  5........LIQHLESLPKEH---LEVHLAAYPWFTAARVVLAKKQ------NTTDAIQQTVPYVADRKWFKNYLDQKPETQILTEKVVEEEFLVEEKSEVSKVLEVQEEILVEDIFETATEQTESALEKSEEFSTQTILEAIENKAEAEQQTEEMEEPKFEEIEEEELSVPENFSFSGWLTHFNNEEKSNKPSTKTKPPKDELDVLIKSNIPYEMLESKIEAETNYSKGLNDFIAQQKQHKKRIVPTADFDGKTQLPI-------TETIAVLLEKQGRIKQAISVYEQLSLKFPMKSTYFAAHIRKLRDKI.. 295
365 2.000e-12UniRef50_A0A1I2GPB9 Uncharacterized protein (Fragment) n=1 Tax=Thermoflexibacter ruber TaxID=1003 RepID=A0A1I2GPB9_9BACT  ali  17  48.........................................................................................KEEEAREIEYVKQLAVFENLTEADFLANNDGREEHESSTLLDDYTLRKEEEGQAYQEMNGHLDFSPQFDEELSDEVEKDNLLTDTSIYFSDEDVLDVLSQKEITAEFDTTNFFDEHQQEHTPTVIKPTYKKSSQEYQRSIIDQFIKESPTIQINRERNEPSIDLAEESTKENERAASEFLAKIYIKQGNKQKAIEIYQRLSLKNPEKSSYFALQIENLKN.... 268
366 2.000e-12UniRef50_A0A2E3AA55 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E3AA55_9FLAO  ali  26  1MTSVEFSALSKKFDALSEEQRMSLEKITYRYPYFQAA---YALYLKTLK----------------------------------------------------EQEKFNFDLILKKTSIISPDRSRLYQWIYDNQTSETTPQKPAEKPVPNSDDTIKKVVETIEETIEVDQSLEEKEIKEEITEEKPVATEVQKIPTNLSFLRWLEWSKSNTIEDFENLPPTSSFEDKIELIDTFIKNNPKIPPVSPNV-PKQNLSKKIKFNKEELMTETLAKVYVKQQKFKKALLAYKILSLKYPEKNSFFADQIKAIKELQK. 256
367 2.000e-12UniRef50_X1TG28 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1TG28_9ZZZZ  ali  36  14.............................................................................................................................................................................................................TENPLPDEERKEPEKPVILSKAELIDRFIETDPKIVPEKESWLDQEDISEEDI-ENKGFMTDTLAKIYVRQGYYSKAIFAYEEMSLKFPEKISYFASQIERIKKLIDD 120
368 2.000e-12UniRef50_A4BWC9 Uncharacterized protein n=13 Tax=Flavobacteriaceae TaxID=49546 RepID=A4BWC9_9FLAO  ali  19  1MKIKSFLNLLGKKPFIKAQETLALKAIVDEFPYFQTARVLYLKGLKNQDSFKYNNELKVTAAFTADRTILFNYITSFDTEISKKGEIQTQNTATVSLQKTKKSVPNEAPGHSQKPHSFSATESHSFHQWLQLATKKTIVRNNDKPVREKHTKEGIINTFIQNNPKITPLEKGENFTTPISKNKQDNALMTETLASVYLAQKKYENAIQAYKILSLKYPEKSGFFANEIKKIQILQKK............................................................................ 237
369 2.000e-12UniRef50_A0A1V5W4W0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W4W0_9BACT  ali  16  1MNSERFIQCITHPLDIDASATAELEKLLEQFPYFQTAHLLFVRGLKNNKSIRFNDQLKIAATYAGNRTKLFELLHCEEHIHVEPIEIIQTIHPQAAIVDEVTNVCIDDTISTEQPESIVDTTLIHSDDHQIKTPEDSPKQETFEAQPYYSNRSYTEHVDSEISTDKPEEPIVIDKKEISIQNIEDIELDDDVYQMRPHDTEGIDDSVSHAQETKVETEPTPEVEHIQQETEVLNQPSIEIPQNKEIQSISSEPILNSEQNNEEKPQE.............................................. 272
370 3.000e-12UniRef50_R7J3U2 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:873 TaxID=1262936 RepID=R7J3U2_9BACT  ali  31  202.............................................................................................................................................................................................................................................PAAVPVTEDAMPAATPAKNSGKDPSSSLSESLAKIYIRQGRYRRAYEILSDLNLKNPEKSIYFADQLRFLRKVI.. 277
371 3.000e-12UniRef50_J9GW49 Uncharacterized protein n=1 Tax=gut metagenome TaxID=749906 RepID=J9GW49_9ZZZZ  ali  21  8.....................................................................................................................................................EHSAELEVSSETFVSSDGDSASETLVSSDEAHASETISSTDEGKSSEAVMPLEVEHVSEAVEPATADNASGTEGNAASSGAAAVQQEAEPDEAVATAEQSESEGSSDEDMDEESYFTETLAKIYVKQQRYSKALEIIKKLNLKYPKKNAYFADQIRFLEKLIIN 171
372 3.000e-12UniRef50_A0A1V5S5P0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin302 TaxID=1852811 RepID=A0A1V5S5P0_9BACT  ali  17  1MTSEQLIYYFKHPDELDKQTVSDLQYLVNEYPYFQSIQLLYLKNLQNIGDLQYHAMLKKTALYAADRSHLQDLMNVLPQIKSKTEEKPISKSETILTETTEYKLVESESVDNQSVPALQHQDLIDKFISDNPRIHPVGQIESNNIVIPDIQEDTDVSSSIFTESLAKIYIKQKQYTKALRIFEKLNLKYPEKSSYFADQIRFLDKIIQNNK...................................................................................................... 211
373 4.000e-12UniRef50_A0A2E7CU72 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E7CU72_9FLAO  ali  17  6..IKNINSIIEHPENTSDKDLDYLYNLSIKYPYSGITQLLVAKIL-----------------HVQDRTGYAEQLKKAAFNCSDRTVIYNYIHREKLVSTIEKADKEISNNNSEIKNDEILELEQNIISSVIDSNIYQEIEEYELINDKTEKDSEEA-------------------------------------PLYDQNSEMTFSKWIALNKNKSFLKEKQNANIDQLLLNLSERNKKRVSKKSNQFFSPIEAAKLSLIDNNELVTETLAEIHIKQGNYPKAIKIYQQLILKNPEKKAFFASRINYINLKTK. 261
374 4.000e-12UniRef50_A0A090W060 Uncharacterized protein n=1 Tax=Jejuia pallidilutea TaxID=504487 RepID=A0A090W060_9FLAO  ali  39  2................................................................................................................................................................................QFSRRETHSFNEWLKLTRLKPIKRPEDLDEKDSDPKVNSLTSNASENTTHFEIIDKFIAENPKITPSKTNA-PKGNLAKVRTAQPEALMTETLARIYLEQKNYKKAIQSYKILSLKYPEKSSFFANQIKAIEQLQE. 136
375 5.000e-12UniRef50_A0A2E9QJ19 Uncharacterized protein n=4 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E9QJ19_9FLAO  ali  17  1MEVEKIIKLINNPQDILSEDVTDLDNLLSKHPYFQSGQLLLTRGLLNTDSIRYNQQLKKAATYTLDRKKLFSLVTKMMGRKDAEISEEIKPKAIEERLELGKPFAFKEGENHSFSKWLTLLNVSKIKRQETSLVDNFIENEIQIKKPKKEAFFNAPNFAKESLIENSNIVTPTLAKVYLEQGHYEKAISSYEKLILKYPEKNSFFAAQIKLISK................................................................................................... 214
376 5.000e-12UniRef50_A0A1M5FQ66 Uncharacterized protein n=9 Tax=Flavobacterium TaxID=237 RepID=A0A1M5FQ66_FLAJO  ali  25  1MNVTDYTYLMNKPDAITEKQAEALGSVLNEFPYFQSARALRLKGLYNQNSFKYNYALKVTAAHTADRSVLFDFITSETFTSIQNDFYDQKLKDLLEIKVFDSFEEVKKAPEVRIDPIEQSILKSIKEATTVVFEEPSKIQQKTEETVIEQPVAVQTEETESNTFAKTEEPVIEEQPTLIIPSEEEILSTFKEVNEVEENKEEVISEQPIAILNEEEIFNSFKEVTKAEEETTQSAENSIETFKEEIADINIETEEIKDKPVEGVIIES............................................. 272
377 5.000e-12UniRef50_A0A136NKL8 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A136NKL8_9BACT  ali  20  1MTKEKFISYIENPFAISQADREELSDIIEQFPYFQTARLLYTKALHNENNYQFNEELKKTAACIGDRRILYELIQKKDDRFFETETVVKSTPEPETEIQQNAIPESETTHVFTEQQDEPPVVFEAIDTSDVAELKTEETEFKQEEESENAFVFEAADDNNLNIXXXXXXXXXXXXXKTEEPSPPSRPLTPXXXXXXXXXXXXXXXXXXXXXTISVDSKIQTESNPEAEPEKSYINPAPEKITEPVLNIVTSEIITEPEELSVQEKEE.............................................. 267
378 5.000e-12UniRef50_W4UPE6 Uncharacterized protein n=1 Tax=Bacteroides reticulotermitis JCM 10512 TaxID=1445607 RepID=W4UPE6_9BACE  ali  32  2...........................................................................................................................................................................................PDEVTAQTEFDYTTDYTGYLLQEETKTNQPEEDTPKLRCFELIDGFIEKEPKIEEEEEQSVVVEEDNRTAEEEDESCFTETLAKIYIKQRRYSKALEIIKKLSLKYPKK................. 118
379 6.000e-12UniRef50_W8F5Y0 Uncharacterized protein n=2 Tax=Hymenobacter TaxID=89966 RepID=W8F5Y0_9BACT  ali  28  386.......................................................................................................................................................................................................................RAHQPKPTASSLDLINQFLKTKPRIKSPPLPAAEQADLSVRSLTAAPALASESLAKIMVRQGKKNKAIEIYERLMERQPEKKAYFADQIQQLQQ.... 482
380 6.000e-12UniRef50_A0A2E2Y072 Uncharacterized protein n=1 Tax=Lentimicrobiaceae bacterium TaxID=2026756 RepID=A0A2E2Y072_9BACT  ali  14  1MNKDAFIGIINNPELLNSSTVNELNGLVEQFPYCQLTRVLLTMNLFKEKSVKYDSELKTTAVYVSSRRLLKKQIDSLISNSQMVVLDDEEDLRLTESYEKEFSSDAKSVIPEDESTSEVDYVIQRHPDEHEIESDKLESAVNSRYLKSGSQIIDEFIKNQPSISRPKAEFYDPLSKSKESIVDNENIVSETLAEIFHDQGHHEKAIKIYRKLSLKYPEKSIYFAALIKKAEKELET............................................................................. 236
381 7.000e-12UniRef50_A0A1I1PW84 Uncharacterized protein n=3 Tax=Flavobacterium TaxID=237 RepID=A0A1I1PW84_9FLAO  ali  25  1MNVTDYTYLMNKPDAITEKQADALGSVLNEFPYFQSARALRLKGLYNQNSFKYNYALKVTAAHTSDRSVLFDFITSEAFTSVQNDFYEQKLRDLLEITVFDSEIISPEQKALEKNNPEEETVSDANEVQTTATQQTVKIEESIKTEEPIKAEEPVKIEEPVITTETKIIPEIDPSIFLAIKEAQTITFEKPVIEEKPKTLPEIDPSIFMTIKEAQTVTFEKPVIEEEKKIDPISISETIETVTSETIESMEETEIPSFIDTES.................................................. 265
382 8.000e-12UniRef50_A0A1F3GV62 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWD2_45_23 TaxID=1797330 RepID=A0A1F3GV62_9BACT  ali  19  1MDKEKLYGFVKEPDTLTTATEEALKTVVEAYPCFQTSRLLYTKYLDLANSDRYIEELGKTAVLCGDRRKLFYLIYRESYHKQLLQPEVQHSGVKDRTEELLDSFLTSLGEGETNETTLDNGALNIVSSDYFSYLESVEETFDPAGDRKLQHHDLIDAFIEKAASEPLFAPYDPGTDAADKKSASDDDGGEFLTETLAKIYIKQKKYEQALTIIKRLSLNFPKKSIYFADQIRFLE.............................................................................. 235
383 8.000e-12UniRef50_UPI0006C885F0 hypothetical protein n=3 Tax=Hymenobacter TaxID=89966 RepID=UPI0006C885F0  ali  25  324.........................................................................................................................................................................................................FFEPDALLLAHAQANRPAPPPAPSSFELINRFLKVQPRLKAPATLPPEQQDLSVRSTSIVPQLASESLAKILVRQGKVAKAIEIYEQLMVRQPEKKTYFADQINQLK..... 432
384 8.000e-12UniRef50_R7PA43 Uncharacterized protein n=16 Tax=root TaxID=1 RepID=R7PA43_9BACT  ali  14  3...NSIVYYISHPESLDATTAQELKACVEQYPYFHAARLLYLQNLYMIHAADFGAELTRAAALIPDRRVLFRMIEGMKYEMRPAARKKSPVNPDEEGADRTASLINRFLDEQPDESMPTRRKLTVADATTDYAAYLLQMDDAEEEVPVTEKSQRSRNLIDDFIGQNQGQIVLTPPAEDEAEEEDMEADPTVQDNDTEEDYFTETLAKIYIQQGRYEKAIEIIRK......................................................................................... 223
385 9.000e-12UniRef50_A0A2T2VVD8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T2VVD8_9BACT  ali  29  15.....................................................................................................................................................EKTKPILEIKVKEKREEVSQGEINEVDTKPKSVEVVIETPKKSLPVNLSFLEWIEWTKNNSSKALQDSESENSFEDKIDLIDAFLRNNPKIPPVSANTA-KQNLSKEIKFDKEELMTETLAKVYVKQGKFKKALLSYKILSLKYPEKNSFFADQIKAIKDLQQ. 176
386 1.000e-11UniRef50_A0A2J6HNC7 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6HNC7_9BACT  ali  20  172...............................................................................PPPIENITPSTKEKPEEEKPEHEETPLPIPETENIVPPVSEEAPPPLPEAKLEEVPPIPEETTPPPVPQEELKTETEQTPPPIEDTKEEEEPVDEDPPVIEVKKEEPPVADEKPAKKEEPVDAAEVLRQRLAELSGGSQKEEPASDQNKIIDEFIEKDPKLN-LNREKENDRDLSEDSTKDNTEVISETLAEIYLNQGNKDKAIDVYEKLSLANPEKSAYFAAQIEKIKEK... 401
387 1.000e-11UniRef50_A0A2E5ZQK9 Uncharacterized protein n=4 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E5ZQK9_9FLAO  ali  46  111............................................................................................................................................................................................................................PKETNQELLIDKFITNTPKIGILKDDKKTV-DLTQKQRFDYKSLMTETLAKIYVKQGKFKNATNAYEILALKYPEKSSLFANQIKKIKKAQN. 201
388 1.000e-11UniRef50_A0A2N5YK60 Uncharacterized protein (Fragment) n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YK60_9BACT  ali  40  1MNKTQFIEYLEEPDLLNDEANKELMELLEEFPYFQTARMLLVKGLHNSGNIKYENQLKLAAAHITDRSKLFSLINFKPDSET....................................................................................................................................................................................................................................... 82
389 1.000e-11UniRef50_A0A2D9UDU8 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D9UDU8_9FLAO  ali  27  84..............................................................................................................................................................................................................QNLFKLIHPTKKINKKNKHLEYSFEDWLKNSSKKKHVKTTNSFISQSVEKSVKNDLNLTTETLAKIYTDQGHYERAIQAYKVLCLKYPKKSGFFANRIKEIRNKIK. 189
390 1.000e-11UniRef50_A0A2E4SAV1 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E4SAV1_9FLAO  ali  17  56...................................................................................................................YENMLKKTAIRFHNRIYLEQLANNLDLNIGKETAKSMDERIHGNEEYPNEDVKTLNENIYGNLIAENIIHEVEEPKTKDDLIEPKTVNKNTPKSFEDWLFKEPIPSTSKEVTVDEILQSLENRKNQSSKTSFFSASESAKKSLELNNDIVTETLAEIHVQQGNYPKAIEIYQKLMLLNPEKKLFFASRIEFINQKTK. 252
391 1.000e-11UniRef50_J0LH81 Uncharacterized protein n=4 Tax=Pontibacter TaxID=323449 RepID=J0LH81_9BACT  ali  13  1MNKSAFLKLIKQVSDISDQQQSELEQVAANFPYCQTAHLLLAKSAYDKGSMLSTQRLRRASAYATDRQLLKRIIYTSPVLELAYAEETEETALEEEAEIIISDTVTDQENDTAVAVAEEAVTEDAETSEAIPEPEASTPEETLEEVYAPAPVEESLYLESEPETESPDAEIDSELALLFTFNSISSSSTDLLSQREEESLEAGEQETEHAHLTEAAEVLHELEETQQTDLVAYDAEDQHVEIEVETEEEAIPVPQAEAYQADSFNTDT............................................. 268
392 1.000e-11UniRef50_U2LGE3 Uncharacterized protein n=38 Tax=Porphyromonadaceae TaxID=171551 RepID=U2LGE3_PORGN  ali  14  1MTTNDLYAYMEHPSRLSADTLPEMKALYEAYPYCSTFVFLYLYNMYVVQDVRYASELRRLAPYLPDRRKLYLLVEQYTHPEQLQPASAEKEPDAFSLIDDFLDEMTRSGADLPSEISYGGASGIPSASDYFAATSPADQAEPSRSMP...................................................................................................................................................................... 147
393 1.000e-11UniRef50_A0A1M7N2Q5 Uncharacterized protein n=3 Tax=Flavobacterium TaxID=237 RepID=A0A1M7N2Q5_9FLAO  ali  24  1MNVTDYTYLINKPDAITEKQTEALGNVLIEFPYFQSARALRLKGLFNQNSFKYNYALKVTAAHTADRSILFDFITSETFTSIQNDFYDKKLRDLLNINVLDSEVVSPDEIKKSIEVRIDPIEQSILTSIKQATSNVFEDSIKTEEKPEDSIEDANAITIEEKKSVVNEEIVKTEDIIIKEDVLIAVEETEPAVFEEVKTHDESIDSTKEETIVIPVKETKHTFFEEVVDDEEIEDIKENFDPVIEKPVSTIEEIAPVVFEESKKHTE.............................................. 267
394 1.000e-11UniRef50_A0A2G4H803 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4H803_9FLAO  ali  22  1MNTQQLISWMKDPVVMGKEATAQLDTLTQTFPYFQTAHLLYIKSLHNENSFLYNNQLKIAAAHATNRKVLYELITKKQVAKETTTLVNENHVESKLQTEKDLGNIEAEVIQPEFPKKKFIKDEDEWESGMLRQLQLLHHWQNSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPSAADEINTLLYVLVEPGDADDIYENDEESNEIDTVENWEIKVLAQETPE......................................................................................... 224
395 1.000e-11UniRef50_A0A1H3R7Z0 Uncharacterized protein n=6 Tax=Flavobacterium TaxID=237 RepID=A0A1H3R7Z0_9FLAO  ali  30  1MNVTDYTYLMNKPDAITEKQAEALGNVLNEFPYFQSARALRLKGLYNQNSFKYNFALKVTAAHTTDRTVLFDFITSETFTSIQGEYYDKKLQDLLNITVFDSEIVLAEEKKKLAEVRVDPIEQSILNSIKEATGVTFEDPSKIEENLIDPVIEEPSLDSFREPTNDTVEVPLTIEENSVDAVTEEPILDSFTEATNVTFEEPVKIEYKP........................................................................................................ 209
396 1.000e-11UniRef50_A0A238V202 Uncharacterized protein n=2 Tax=Hymenobacter mucosus TaxID=1411120 RepID=A0A238V202_9BACT  ali  27  404.......................................................................................................................................................................................................................KANRPKPSASSIDLINRFLQAKPRIKTTTGPPPEQDDLSVRSTRPAPTLASESLAKIMVKQGKTDKAIEIYEVLMQRQPEKMAYFADLIQQLKQ.... 501
397 1.000e-11UniRef50_A0A0S8HQT7 Uncharacterized protein n=1 Tax=Bacteroides sp. SM23_62_1 TaxID=1703353 RepID=A0A0S8HQT7_9BACE  ali  11  1MTGEDIISYIRQPEKLNGDTLGGIEKLTSDYPYFQTAHLLNVKNHHNIKSLKFSESLRFASAHAGDRTILYYLINDLSSSEELDKEEKGDISSVTGLLSFTNWFDHLDQATPEGSGKSDEDTRRMKENELIDKFIKAQPSIIPQKDKSEDQEDISEAFLITDDHLMTETLAEIYVKQGYYTRAIHAYEKLSLKYPEKSSYFATQINKIRQLKDNPNS................................................................................................ 217
398 2.000e-11UniRef50_A0A1I7BWI9 Uncharacterized protein n=1 Tax=Lishizhenia tianjinensis TaxID=477690 RepID=A0A1I7BWI9_9FLAO  ali  17  255..................................................................................HTEQETEVSAANTTSEQVSFTEESTDAPAEDMLHLTEEQEVETNDVTPQQETEKPKDFFAWLAAKKAQNTEEKTQEIEKEALPSSTETEVAKTTLNSAPIAEEEITPETREENQKLGSVKSDIEEKTEVQKQEKEELEAPKSKVDSIIEKFINEEPQISRPKKEFFSPSKVAKKSLDESSLPVSETLAQIFAAQGNYPKAIASYEQLMLKFPEKKSFFAN........... 474
399 2.000e-11UniRef50_A0A1H4CXN9 Uncharacterized protein n=1 Tax=Arachidicoccus rhizosphaerae TaxID=551991 RepID=A0A1H4CXN9_9BACT  ali  16  35........................EALTRQYPAFNLGYYFLSKAQAGTDSKSKQEALQKAALHFNDIRWLDYLLQSDRVEKPEVGAIPATAKSEPAPPIKTGTIQQPNQQSATGSATAATGEEGLTIEPAEKAAAAPVASNAQADTQGSEAAADTHTDTELASDSDNGRLSQVLSQQLAAFKKPVSSDARLEVERDPLYKTDYFASQGIAVLKSLEGDGLGKKVRKFTDWLKEMKQSPTNAGVPQLNTTPEEEAQASSLKNEPIFTESMAEVLVSQGKTEQARDVYQKLSLLYPEKSTYFASKIDLLQ..... 336
400 2.000e-11UniRef50_A0A2D5JIS7 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5JIS7_9FLAO  ali  30  35........................................................................................................................................................................................KPIDFDTAETHSFGEWLKLTKMQPINREEGAKDETSLKPIEKTMKIVDFISKSVKKEKPKKEFFSPIAMAKESIQENTTMMTETLAKVYLEQGHYDKAITAFEILSLKYPQKSGLFADQIKAIKQI... 160
401 2.000e-11UniRef50_A0A1M3E5J8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 43-16 TaxID=1895923 RepID=A0A1M3E5J8_9BACT  ali  19  87.................................................................................................................................................KKSWEDLNEVFLEHEKEQVAQDYFQTMGIEVTDNWPDMAREPGLDEHEKSLMVVMSFAEWLQFIQRKTRAEQEEEAEKRALKAQWQKQKMTEAIEEENEEIPAQVFEMAVNSISREDGIVSESMAVVYEKQGKFREAINIYRKLSLNNPEKSIYFADKIENLQKEI.. 252
402 2.000e-11UniRef50_A0A2P8D5T8 Uncharacterized protein n=1 Tax=Taibaiella chishuiensis TaxID=1434707 RepID=A0A2P8D5T8_9BACT  ali  19  75......................................................................................................................................EEQLEVLMEEPVVPETDLLEALGITQQPAMVADYFSQQGIEVSSDLPEAEELAPHTEEEKSLLVVMSFEEWLSYINTKSRKEKEEEAEQKALKTMWQKQKLAAAIEEESDEIPESVFEMAVNSIARNDDWVSESMAEVYARQGKAQKAIEIYEKLSLLNPEKNTYFAAKIENLQKDLE. 252
403 2.000e-11UniRef50_A0A0R2WYN5 Uncharacterized protein (Fragment) n=1 Tax=Cryomorphaceae bacterium BACL22 MAG-120619-bin32 TaxID=1655630 RepID=A0A0R2WYN5_9FLAO  ali  33  24...............................................................................................................................................QKKDIHQQIKEKILEENPTVIIQKILPIIAEKTSEKIEEKLAIGKPISFSASESYSFNQWLQLSAKKPIERVQEPVPKITTEKEELIDKFIQNNPKIQPI--TKDKNISIIVQENKQDASLMTETLAKVYLEQKKYDNAIQAYRILSLKYPEKSGFFADQIKRIQILQK. 190
404 2.000e-11UniRef50_R5FT34 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:924 TaxID=1262938 RepID=R5FT34_9BACT  ali  25  2....DIAYLIKHPENLDRDTLYDLRSLLALYPYYQSARLLLLQCLFLLHDPSFDEELRRAALYITDRKVLFNLVEAMHYQLRRQPSEEKAEQ............................................................................................................................................................................................................................. 89
405 2.000e-11UniRef50_A0A1F3JXG5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_33_38 TaxID=1797342 RepID=A0A1F3JXG5_9BACT  ali  19  208..............................................................................................ESKIQKAQKIEENSTTQEFNDFIFPQTETVSEKQEIKPIEEDSISSVNTSDFENTNLIGEKDFVKIEEAIVHENSIENNSDKIETKIPSGIISEQEKEFSFSEWLNIVTKKAPEKINLNKKIEKDISPKEKNMQLIDKFIKEEPRIKPKFETAFKQEDISVKSAIPEDNLITETLAKIYIKQEHYEKAISIYEKLSLKNSENYAYFAIQIEKIKELIN. 425
406 2.000e-11UniRef50_A0A0R2QXZ3 Uncharacterized protein n=6 Tax=Flavobacteriales TaxID=200644 RepID=A0A0R2QXZ3_9FLAO  ali  24  1MNTEKIIALINAPQNILSLDVTNLDSLLLKHPYFQSGQLLLAKGLLNTDSIRYNQQLKKAAAYSLDRKKLFSLITLNKISKTEAIVIKELQAESIEEKLELGKPLAFNESENHSFSEWLTLLNVKKIERKEDQKEVSLIDNFLEKEVKISRPKKEAFFNPIDVAKESLIENDD............................................................................................................................................ 173
407 2.000e-11UniRef50_J0RMT8 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=J0RMT8_9FLAO  ali  25  1MNVSDYTYLMNKPDAITEKQADALGSVLNEFPYFQSARALRLKGLYNQNSFKYNYALKVTAAYTADRSVLFDFITSEAFTSIQNDFYEQKLRDLLEITVFDSEIISPEQIQKAIEIKTELEEQPVQDTVKETAISSIENPSVIKIEEPIKTQETIKAEEPIITEEPKKVPEIDPSIFLAIKEAHSVTFEKPVIAEEPKKLPEIDPSIFLAIKEAHSVTFEKPVIETENKVD.................................................................................. 231
408 2.000e-11UniRef50_A0A1J4TCQ8 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A1J4TCQ8_9FLAO  ali  25  1MNLAEFNTNLINPDKIDKLFIDKIEPVLEAYPYFQAARILHLKGLQNQESFKFNDALKKTAAYTTDRSVLFDFICSSNQIVKANTKETISELPKTISAHHKITPFETLSIGKPLVFNATETHSFNEWLQLKQLEPIHREETKPDEPNDLIENFIKTNPKIKPLKTIEKAPIFIESIQENPNIMTETLAKVYLEQKKYE................................................................................................................... 198
409 3.000e-11UniRef50_U5Q2U7 Uncharacterized protein n=1 Tax=Bacteroidales bacterium CF TaxID=1400053 RepID=U5Q2U7_9BACT  ali  27  114..............................................................................................................................................................................................................................KLDLEKPLDKFISEKPSLLKSNINSPKDVEIAAEQVFDDSGFYTETLAKIYSEQGFYKRAIEVYAKLILLYPEKNSYFATLVQELKSKHN. 207
410 3.000e-11UniRef50_A0A2E1HQK1 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2E1HQK1_9FLAO  ali  20  1MNKNQYIKILQNPSEVDKEQIAFINSLIKDFPYFQSSRAIYLKVLKNSGNFKYNEELKLTAAYTTDRSILFDFITSNEFQQEKIVFNENEIKNLQLKDKKNVISKEDQAVSFQKNEMHTFTEWLTISKFKPIDRSLIEENTSSKEEELINKFISSKDHKINPKNDVDGSYNINVNYKESHNDLMTETLAKLYLSQKNYEKAIQSYKILSLKFPEKSSYFADQIKKIRKL.................................................................................... 229
411 3.000e-11UniRef50_A0A1D3UYC3 Uncharacterized protein n=9 Tax=Tannerella TaxID=195950 RepID=A0A1D3UYC3_TANFO  ali  33  106......................................................................................................................................................................................DPMDDETETEASKPALEPSASLDYMRWLTEKDPDASVPKNKLRHQELIDSFIESEKGRETDRKEPEQEKMPEPERESLDDSYFTETLAHVYIRQKRYEKALEIIRSLSLKYPKKNIYFADQIRFLEKLIIH 249
412 4.000e-11UniRef50_A0A060RB35 Uncharacterized protein n=1 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060RB35_9BACT  ali  33  97....................................................................................................................................................................................................................................................QQDDSQDDIAEEYTQFDGEVATETLAQIYLAQGHTERAIEIYLKLCLKNPEKSSYFAELISKISN.... 161
413 4.000e-11UniRef50_A0A0L8VAR8 Uncharacterized protein n=1 Tax=Sunxiuqinia dokdonensis TaxID=1409788 RepID=A0A0L8VAR8_9BACT  ali  37  91..........................................................................................................................................................................................................EDPLVKEYMTPGFYQLSERKEDREESLIDLIRSIRKKEAKKVLDEVEAPVKHEPEEKADHSLVTETLARIYAQQKHYQKAIEAYENLSLKFPEKSTYFAGQIEKLKKLMN. 200
414 4.000e-11UniRef50_A0A0E3ZHE6 Uncharacterized protein n=3 Tax=Pontibacter TaxID=323449 RepID=A0A0E3ZHE6_9BACT  ali  18  340.............................................................................................................................................................DEIDQMYQQDALGYWMSSSRMGEVLQLKEENELTRPRPASFHPELILEYCKTHELVHQEEQALPPLQEQLDIIDQFLKVNPRLKTVKLKPEPQEDLSLKSTKIKRGIASESLANIFLKQGKAKKAIKIYEQLILKNPEKKSYFAEQIEKLQNL... 495
415 4.000e-11UniRef50_A0A2N2XK37 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-23 TaxID=2013692 RepID=A0A2N2XK37_9BACT  ali  23  1MNLTEYTYLLNNPNAVNEKQAKALETVVDSFPYFQSARALYLKGLYNQDSYKYNFTLKQTAAHTTDRSILFDFITSDEFTIIEKDIYEQKLALLMDIEVIESETHLLPSQVENDKENIETKEEIVEEEIPEVEPKLAEIEVDKLTVLPTVEFESSDIEFIRLENDPVIDEVSEEITVTEITPIEIDEIVTISTEKETISETMVEEEKIEEEPIRLEILEETIEETISNEAISIDENS............................................................................ 237
416 5.000e-11UniRef50_R5AJG4 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1031 TaxID=1262917 RepID=R5AJG4_9BACT  ali  19  85.............................................................................................................................................................DIPFYPPENPAPTPSTIDTIDTFLETYGHADAENDALLERMILNPQPEYATVLEKEYADAPDIDTPDEQSRLIDAFLDSQPAPGPEPEPAIETVETALETPAEEESSLNETLAKVYIRQGKYEQAYEILSRLNLNIPEKSVYFADQLRFLQKLIIN 251
417 5.000e-11UniRef50_A0A1Z9GP37 Uncharacterized protein n=3 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A1Z9GP37_9FLAO  ali  29  74.....................................................................................................................................................YEFIEDQFXRSKANHKSKEVVXASEKKKKXIEKNNQKEKSKEKXNQTIXPKALQFYEWATYLKTNXTPVKTSNIENKFELIDSFLAKQQKIXPDKS-KINNEDLSEQSWVNSNELMTETLAKVFIKQKKYVKALEAYQILGLKYPEKNSFFADRIKEIKDLQK. 235
418 5.000e-11UniRef50_A0A0H4VNH3 Uncharacterized protein n=4 Tax=Rufibacter TaxID=1379908 RepID=A0A0H4VNH3_9BACT  ali  17  308...............................................................................HEEIISEITSSSETASLKELPEPADEARELPLAAVATDDNLSAYLEIAELYTVYDTSGYEFPTLKVQEAEPASVEPETEQDLYLSIFTQNNLAYWMGSSRLGESIQLKDELTSLTPFYFQPELILEHVKSSHTPAPEPEETPAAKKQLFIINQFLKSAPKRKNVANPQEPQEDLSAKSSKPKKNLVSENLALIFIKQGKAKKAIKIYEQLIVKFPEKKSYFAEQIEKLRNEL.. 544
419 5.000e-11UniRef50_Q11U23 Uncharacterized protein n=1 Tax=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) TaxID=269798 RepID=Q11U23_CYTH3  ali  14  10.NKQRYIALLKDPSALTKADIPDIEELIEQFPYCQNAHILLAKVQTELGSMHANKLSRKAALYTSDRNKLKRLLSPLKEDTKHTAGVVIEKNGTSLLIEQPEVRVPAEIMADKTVETPADSITVDATPSISVVESIPEPPVTRTVDTPVTFQVKEQADKHANDFXXXXXXXXXXXXXXXXXXXXXLNILPREEKQTIIPENILPPKNVVFTPPSDHVSAPDKQVRIDIPSEDEIKKKDIEVEHTAETETNF.............................................................. 259
420 5.000e-11UniRef50_UPI0008356679 hypothetical protein n=1 Tax=Rufibacter sp. DG15C TaxID=1379909 RepID=UPI0008356679  ali  14  1MNKAAFLNIIRQVAPIQDQEVEDLEELVASFPYCQTAHILLAKAAYDRGSMLSTQKMRRAAAHASNRQLLKRIVYAPPILHNAVDQEVLEEEAPAVFAPIPGNEAKNAFPEVAPEESILQALENISEEDLLDVETDVPDEIEEPEEESIEEQPIEEPATE----DEAEIEEPSQPVDATQILGETISEPQLQVVENPLEDSAPEEEFIAESELEQEASYDLLDEQDSAFIENFILEEDQASEEESEEIQPELKEEESVSVPIDI................................................. 260
421 5.000e-11UniRef50_A0A239BQS5 Uncharacterized protein n=5 Tax=Pontibacter TaxID=323449 RepID=A0A239BQS5_9BACT  ali  16  1MNKSAFLKLIQQVSNISDQQTEELEKVAATFPYCQTAHLLLAKSAYDKGSMLSTQRLRRASAYATNRQLLKRIIYTAPAPEPVFDEQAIEEVQPAEEAVIPVQEDTLVFVEEEEQEENVTFHAEAAEVVPDEEEVLEEEAPTAIPETALRYEQETAEEAEEDEALFVDESLEEFAATEDILEQPMEKLNSELALLLTINSLSPSFTDLLAQRADEEETEETRP.......................................................................................... 223
422 5.000e-11UniRef50_A0A0Q4SA48 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A0Q4SA48_9FLAO  ali  24  1MNVTDYTYLMNKPDAITEKQTDALGSVLNEFPYFQSARALRLKGLYSQNSFKYNYALKVTAAHTTDRAVLFEFITSETFTSIQNEYYDQKLKDLLEIKVFDSEIVSFEEIKKVNEVRIDPIEQSILNSIREATNVTFEQTPTTFEKPVKIEETKIELIDEQAILDSFKETTPTILAETSKVDEPKIELIDEQAILDSFEEVTPTVLEEPVIEETKIEVDSFKEVAKITFEKPSTIEEPKIEIIDEQAILNSFKEVESPTFEEPQKIEE............................................. 275
423 6.000e-11UniRef50_A0A2S7WD17 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2S7WD17_9FLAO  ali  24  1MKKGSFLDILQKNSPIQQVETAELKGIIDAFPYFQSARALYLKGLKNQESFKYNNELKITAAYTTDRTVLFDFITAANFDNPQKDIHQQLKEKISEEKKIEVQEIQQTSIIENSSEEIEEKLSIGKPISFKSSETYSFNQWLQLASKKPIERIENTASKIAPEKEEIIEKFIQNNPKIIPLPKDKNIIVTVEETKPDSSLMTETLAKVYLEQKKYENAIQAYR.......................................................................................... 223
424 6.000e-11UniRef50_C3J8A1 Uncharacterized protein n=1 Tax=Porphyromonas endodontalis (strain ATCC 35406 / BCRC 14492 / JCM 8526 / NCTC 13058 / HG 370) TaxID=55  ali  35  149..................................................................................................................................................................................................................................................PKSQASSLPTQEEVEEEDRGPLFTETLAKIYIQQQRYDRALDILRAIMTKNPEKNAYFADQIRFLERLQE. 218
425 6.000e-11UniRef50_W2CTG1 Uncharacterized protein n=6 Tax=Tannerella sp. oral taxon HOT-286 TaxID=712710 RepID=W2CTG1_9BACT  ali  26  1MTREEFYRYIDRPALLTAATLPELARIVEAFPCFHAARMLYLKNLALTGDLRLKGELERMAIGVPDRARLFLLLQDEARLKDTADAAPARRPTTDE......................................................................................................................................................................................................................... 96
426 6.000e-11UniRef50_A0A1R3WM88 Uncharacterized protein n=2 Tax=Pontibacter TaxID=323449 RepID=A0A1R3WM88_9BACT  ali  18  1MNKSAFLKLIKQVSDISDQQQSELEQVAATFPYCQTAHLLLAKSAYDKGSMLSTQRLRRASAYATDRQLLKRLIYATTVLEPTYAGEDEASVEEETEVATVETVIEEETTVAAVQPTTESAETDVAIAEPEEVEQEESLEQVYSPAPVEQHAYPEENQVETEPETPDAEIDSELALLFTFNSISSSSTDLLSSREEESFEGSEQESPHAHLSEAAE................................................................................................. 216
427 7.000e-11UniRef50_A0A2N5YV49 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YV49_9BACT  ali  16  1MNKEQFLKYVNDFSCLSTDSLEEIKLLIDEFPHFQTAWVLYAKNLHKIQDVRFESKLKIAATHIGDRKVLKAIIDETNKPLQKSNKTETAIISPVLEQEKPEETKLEIQELIAEENPNTNIDKETIPETLDDTPEYKKIEDDFDEEEQNSDQNEIKEEETSVADLILKNISDINKSKSEKDEIIVQETIDSKNFEQASEQKETLELDLEDKIESHKESEDVNIIPEQLISSNSIEPEGFDQKEEVLEDKVEDTSQD......................................................... 256
428 7.000e-11UniRef50_A0A1G4GBE4 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1G4GBE4_9PORP  ali  15  1MDRSDFFSYIADYGKLTETSLEELKALVEEYPCFQAAHLLLARSRYQFRREEFEKHLPEAAVCCADRSRLFYLINNEKYARFFPKASSLEETDRTQTLLDAFLDSFSLDEPEEKMPEETNIISTDYLSYLQSLEGESSPKEEDSSRPELKHQEIIDTFLEKAAANEITITSREPEPAKPSEVEKMPGGNGFLTETLATIYIKQKKYEQALAIIRQLSLNFPKKSVYFADQIRFLE.............................................................................. 236
429 7.000e-11UniRef50_UPI000931D5DD hypothetical protein n=1 Tax=Flavobacteriaceae bacterium A100 TaxID=1917170 RepID=UPI000931D5DD  ali  21  1MNSFSYILLLKNSDFITKSNLDDLEKIVADFPYFQSAHFLKLKGLKSFDSYQYNDALKTTAAHTTDRSILFENISKKKKIVIQPRSTNPQPEKQIKQEATEPKNFKDSKPEETLELGKPIQFESGEYFSFNQWLQIDSDKIKPLKKPSEKEVKTRIIDRFIATSPKITPSKKDSTNEPAIVQQTTDSESLMTETLAKVYLEQKKYD........................................................................................................... 206
430 9.000e-11UniRef50_A0A1F3BTA3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWA2_31_9 TaxID=1797314 RepID=A0A1F3BTA3_9BACT  ali  16  1MNKDTFYNYIESPEILDQTSLKDLSELLVDYPYFQAAQMLYSKNLHNINHVKYDAQLKLTSAYIYNRKRLFQLINLKPKVNVESNIDYKSNEVVTENSINEEVLIDKNSEIIDFDENILIVENIVLNDKTKEFENEAVDINENVVEDDIHEKIVSEHISTNEESKINTENVQQIDEDFKIADENLVVESLVINEIIENKEEKQSALAENIELKTETTTQN............................................................................................. 220
431 9.000e-11UniRef50_A0A1B2Z8R9 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1B2Z8R9_9BACT