current user: public

If you have questions about the server, please let us know.

Query: PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# E-value Template Links and tools%idFirst YLISFSFLLYSCDEKPKSGITNPSFLPNASGENNEMLIVMDSTKFKGKIGRELVDIYSSYISGLPQPEPRYDLRYIKPRKFNSILKHAKNIVVAFSLEGNSLDSEILRRNFNSESLDKIQSDSSLFYFVRRNQYARGQVVLYLFSENDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENNLMDKIFTDHNIKIKIPYGYDLAKSINEENSNFFWLRQLDLEYDKNIFLYYEDYSNSELKNFYDVFNSSDINIKPIRAYISKKYLRDSEKSKIFMDIQDVFPIQSNKINFKGNLAIESRGLWKLSDISAGGPFLSKIIYDSKLKRVYYLEGYVYAPGLKKRGLMQEISSILMTFELast
1 0.000e+00UniRef50_A0A0D3LKP4 Uncharacterized protein n=2 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A0D3LKP4_9BACT  ali  35  9WLFAILVFCNSCGENKNT--NNRDFLPRASLVPNEILVVIDSSQWNGVLGEAIRDIFTEPIAGLPQEEPHFEVRHIQPQDLRGFLKRYPNILFVFTLDNNSRATQMLKTMFSERSLEQIQNEPQRYMATRKDEFAKGQEVMYLFANSEEQLTSRIYSSRDQLLNYFRDVERKRSIREYTQKVTQPLSNMLSEQYGFSLRFPAGYEVAK----QDSNFVWIRLLDNQVDKSIWATWKPYTDQKVFERE--------NITQFRNSVARNYIWGSDSTTY-MRLENQFPLDMEETNFNGRFAIETRGLWRLEKMVMGGPFISYTFVDEATNRLYYIEGFTYAPGQDKRAAISEMEAILWTFK 353
2 1.000e-97UniRef50_A0A1V5N5K9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin408 TaxID=1852813 RepID=A0A1V5N5K9_9BACT  ali  23  11.LLVCLILSISCKNNNSG-------LPSSTGKTAEVLFVIDRFHWDGTAGNNIKQIFTAEYQVLNQPEPLFNLAHIEPGDFSKIFQSHRNIIIVEIKDSIS----------------------KDMMEIRKDVWAQPQLVIKMVSQTPGGFVEMLEKHSKQIIALLYETERKRMQKSFSNEQDMSLTNALQQGFGFSMTLPKGYFMAKKSG----DFCWIRRETEETSMGLLVYTYPYTDTISFNSTY--------ILNLRDSLTRIHIPGPRDGSFMQVSHKVVLPVSKKTTFNNRFAVETRGLWDMKGDFMGGPFINYTFTDSTQQKIITLDGFVYAPRFDKRNYIIQLESIIFSYK 327
3 6.000e-97UniRef50_A0A2T2V8V2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium SW_11_45_7 TaxID=1919113 RepID=A0A2T2V8V2_9BACT  ali  27  21FCFGFFIVLTSCTEEQQRQAG---VMPSSSGSHDEVLVVMNDSTWEGPLGDSIRKYFRASFMVLPQPEPIFGVKQTSYDKFKDLFRKFRNVLFVGVLDRNHPTANHIREMLGDKQLKRAKSNQGFYSFIKRNRWAKPQLHCYLFAPDRSTLGKVIHRNHQRFIELFQNSELDKYKSLYIEGTNNQLTERVREKFAINLRIPSNYKKAM----DKKNFMWLRYDTDEITINLMLSKKPYDNAQFANKG----------ILWRNSLGKKYVESTVKGSY-MSTDTILGPISKKTKLNGYEVYENRGLWRMENDFMGGPFLNYYLLDRKHKQMILMDGFVYAPGKDKKKLMRQLEAIFSTF. 361
4 6.000e-97UniRef50_A0A1V6JFK9 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6JFK9_9BACT  ali  25  12...FIALVFYSCDKGSKG---KKTFLPNVTGAAGEVVVVLDKAVWEESIGKTYNDILREEYPMLPQSEPIFDVVMIPPSAFTDIFKSHRNIVITKVGSEF----------------------AQAQIVLQRDVWAAPQTVLNIVGPTYPAIAKMLNDDKDRFVQLLEQAERDRVVQNAIRYEEKGLRKLLEKKFDISLNFPKGYQL----RLDTTDFVWISHETPDISQGIFIYQYPYTDENTFTLNY--------LVEKRNSFVNKYVPGPTEGSY-MITETLIAPIFQPLMYKNRYFGQLRGLWDVQMHPMGGPFVSYTTVDEERNRVITVEGYIYAPRFNKRNYVRQLEALLLTF. 328
5 8.000e-97UniRef50_A0A2P8CI46 Uncharacterized protein DUF4837 n=3 Tax=Prolixibacter TaxID=314318 RepID=A0A2P8CI46_9BACT  ali  22  12..FVLGAMLSSCGGDSN------PTMKNSTGKPGEIVVVIPKATWEGEAGDTIFHFLAQPVADLPQEEPMLNVVHIPPQAFGEIFKTGRNLLLTKINPSV----------------------KEPKITIQRNVWAKPQIIVSVQAPNEKSFTDFFAKKGNDIVSIFVKEERNRLMKMYRKFKNDAVAERMAKEHHFTLNVPKGFVV----SVDTTNFVWIRYETPNISQDVIAYWYPYTSDSTFTRNY--------LLNKRDSVLKKNVPGPDPGTYMM-TERQIPTLFRAFKLNGNYTAMLRGLWKVHGDFMGGPFVSISTLDPIRGRVLTLEGFVYAPKKDKRELMRQVEAMIYSV. 328
6 8.000e-97UniRef50_A0A0S7BTA1 Uncharacterized protein n=1 Tax=Lentimicrobium saccharophilum TaxID=1678841 RepID=A0A0S7BTA1_9BACT  ali  27  14.LIGLSFTVLSCRHEGKT------MKPSSTGKPSEIVVVSENNLWKSSAGDSIRAFFSRPVPGLPQPEPFYKLVQIKEDEFGRLLKIHRNVLIITIDSAL----------------------AKPQAELRRDIWASPQRVVKISSPTIEGIKEIFAERSSEILNLYDNAEIERLQALYSKSLNLKASESIKKVFNLDMNIPADYYVA----VQKDNFIWLRRETNVMSQGLLIYSYPYTDTVAFNPLK--------IKSVRNQFTQLFIPGPSDSSYMVIADEFIIPQSRTITLKEEPAIEMRGLWEVRKDFMGGPFINYTFVDKKNNLVIGLDGYVYAPNEPKYDYLKQVQAILLSFK 331
7 1.000e-96UniRef50_M7N7F6 Uncharacterized protein n=1 Tax=Cesiribacter andamanensis AMV16 TaxID=1279009 RepID=M7N7F6_9BACT  ali  33  17........ITACGGNSNSQDNDKDFLPRASLVPYELLVVMDSAQWRGVLGEAIRDVFTEPVQGLPQEEPHFKVRYITPQGLKGFNKRYPNILFAFTLDKRSQASEMLRSMFSEQSLEQIRQDEQRYRLSRKDEFARGQEVMYLFGQTEDQLVSRIYTNKENLLNHFLTVERQRYMRDYANRVTQSLSNSLASEYGFKMNFPAGYQVAK----QDTNFVWIRLLDNKVDKSVWVTWKPYTDQSIFQRD--------NLMNYRNQVVRNYIWGS-DSSTYMRLETQLPVEVRQVNFNGRYGVEARGLWRLEKMVMGGPFLGYAFVDEATNRVYYIEGFTYAPGQDKRLAMSELEAILWSF. 357
8 3.000e-96UniRef50_A0A1G9DDX8 Uncharacterized protein n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G9DDX8_9BACT  ali  29  9FWIVLLAVLGACSTDESS---SDLTKPVALGRAGDVLFVVDSTLWNGPVGKQLRTIFEQPMPGLPTDEAAYYVQRISPYDLNRFQQQRRNLVFVHVFNDKSAESQRMSTYFGKDVRERVDSDSSFFLATEENKFARGQTVMYLFAPTAADLLAQLQENPQRILNRFRNSELKSIRDDVLKKENRSLERQLRNDYGFVIRLPENYKLA----LERDNFVWLRNMEAVLDRSIVIGWREYTSESQFSPD--------SVVAWRDQLGR-YITGSDDTASYMVTETYIPPDFETTTFNGRYAVESRGLWKMNDNRLGGVFLSYTFVDDAQQRLYYVEGFIYAPNMDKREYLREMEALLQTFQ 352
9 5.000e-96UniRef50_A0A0L8VF97 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0L8VF97_9BACT  ali  23  20..........SCQDDS------TNMRKKITGKAGELVVVVPTPTWEGATGKRFREVMAQPQLGLPQEEPIFDLIAVPPSAFKEIFKTSRNIVQIKISTTIDS----------------------SKVEFKKDIWAWPQAVVNIQAKSTEDFNQLFDQYSDRIVAYMLRAERDRLQLNYKKYHDKAAKNVIRDKFNIELNVPPGFKVTK----ERDDFAWVRYETPDISQGILIHTYPYTSDSTFTENY--------ILNKRDSILQAHVEGPADGSY-MTTEHQLPAIFNVFELRKNYAAETRGLWKVEGDYMGGPFINLTVLDAANNRIVMLDGYVYAPRFDKRNLLRQVEAMVYSVE 327
10 5.000e-96UniRef50_A0A2N3A514 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-11 TaxID=2013679 RepID=A0A2N3A514_9BACT  ali  27  14.VFLVLVMLTSCNRDEK------PTKPSSTGKPSEIVVVSEDNLWKSSAGDSVRAFFARPVAGLPQPEPLYKLVQIKEDELGRMLKIHRNIFIITIDSSMKTPLTEMR----------------------RDLWAAPQRVVKISASSIEGIKEGFASKREEILNLFDNAEIERLHKLYSKSRNQKAIDAIAKKFNLKINIPADYYLA----VEKDNFIWIRRETNKDGQGIIIYSYPYTDTVAFKAAK--------IQSVRNQFTQLFVPGPSDSSFMIVADEFVTPISRTISLKNQTATETRGLWEVRKDFMGGPFINYTFVDERNNMVIALDGYVYAPNESKLPLLKQVQSILLSFE 331
11 1.000e-95UniRef50_A0A1H5UJY4 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A1H5UJY4_9BACT  ali  25  17.................GACSSGPVMTQATGLAYEVIVVMDQKDWKGEAGEIIKADLESPVPGLPQSEPSLKITYAQPKDFNGLLKLVRNILIVKINPSTYT---------------------KVSLSYENNPWAKGQVVLTLKAPDAQSIVEYLTANKNKLANFFVEAEMNRAIAQLEKNYSSVVMEHLKKDFDVMLNAPENMTYYK----DTTNFFWASNNANTGRTDLVVYTFPYTDPDTFTADY--------LVAKRDSVLKANLPGAFPGSY-MATETLGGVHYEPITVNGKYCGVLRGLWKMRGDMMGGPFVSHIRLDEKNNRVVVAEGFVFAPETSKRNFIRRIEAALYTL. 323
12 1.000e-95UniRef50_A0A1C2BXX6 DUF4837 domain-containing protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1C2BXX6_9PORP  ali  25  6.LFFSMMLLVICMSACEGGPVVS----KATGSPGDLIVVMDKSAWEGPAGIAIKDLLSSDVPGLTQPEPVMDISYTEPQNFDRMLQIVRNIMIVEINPSMYT---------------------KAGMNYSQDRWAKGQIIVKLQAPDAASLELYITNNAKSILDFFVKSELNRTIETLDKTYSSYTFKKVKEIFDVELKAPESMKFYK----DTTNFFWASNNAAEGRRDMIIYSFPYTDNNTFTPEY--------LIAKRDSVLKANIPGSFENSYMTTETRFGGVSFTPITVKGKYCAEIRGLWKMVGDMMGGPFVSHARLDEANQRVIVVEGFVYAPEKDKRNIIRQVEASLYTLK 326
13 2.000e-95UniRef50_M7MM21 Uncharacterized protein n=44 Tax=Bacteroidetes TaxID=976 RepID=M7MM21_9FLAO  ali  23  9.LLFSVLLVMSCGNKKSS---NQKLLSDSSGNINNLSVVIENNLWEGNVGEAIREVLAAPVDGLPQDEPLFNMSQIPPAVFSGFATHNRTVL-------------------------KIEKGGEASVKIASDVYAQPQKVVLVSGKTDTEIIQQIQENAQKIVAAFKSEEIKEKQRRIKLSLHK--NNTLKEKLGITLNFPTAYRIAK----EEDKFYWIRKDIATGTTNLMVFELP------FSAIKKGDSLVDQIIKLRDSIGQAHIPGPTEGTY-MITEEAYAPAVFETIIDNKPAIETKGLWDVKNAFMSGPFINYIIEDKINNRLLVIEGFAFAPSVEKRDYMFELEAIIRSLK 325
14 4.000e-95UniRef50_A0A2N5Z3E3 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z3E3_9BACT  ali  25  11FLIASSFIFSSCDSE-------YVALPNVTGKAGEVVLVISKNDFKQDIGQAFKDVLCESYPGLPQDEPYFDLVNIPESAFSSIFKTHRNLIF----------------------TNYGKQFKEAGLKVEKDKYSKPQTILNFYAPNKEKLAKYLRDNKIKIQDILVETERQRIINNYKNYEKVSIRRQLEQKHGISLYVPRGYSL----DLDTNNFVWISYETPYTSQGLFIYDYPYTDTTMLTKEA--------LISTRDSLLKAFVPGPMEGSYMSTEKENFVILFDEFMLNKKYFAELRGLWRVEGDFMGGPFISLSTVDEERNRIVTVEGYVFAPKFDKRNYLRQVEAILHTL. 327
15 5.000e-95UniRef50_W2UIR4 Uncharacterized protein n=7 Tax=Flavobacteriaceae TaxID=49546 RepID=W2UIR4_9FLAO  ali  26  7.LITLGVLIFSCNEKDSK-----RVLPNSVGAINTLSVVIDNNLWNGKVGDEIRDHFAAPVDGLPWEEPLFTIHQMPPEVFTDFARNSRNILYVAQDSSNVAA-------------------------IKDDVYARPQKVAFIKGSTAESLIEAIKANSDEIISTFKKHDIKETQNRFKLSLNKE--NELKNKLGVSLTMPSVYKIVK----EDHNFFWIERQIPKGTMNIIVYEMPKD------YYPTDSTRVDQIIKMRDSIGKKYVPGRNPETMWMVTEKAYAPYIFDSNINGYEAIETKGMWEVKNFFMAGPFINYIVKDPINDRTLVLEGFTFAPSTDKRDYMFQLESILKTL. 321
16 1.000e-94UniRef50_A0A2A4QMF6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4QMF6_9BACT  ali  25  16........FIACDTNKSE------LLPGSTGKSGEVIVVIAQNHWESSLGSAIRKVLAQPYPALPQEESLFNVVNVKTAAFKGILRRHKNILYLDIRDS-----------------------SKEAMVKKKEVWAKGQIVVTIYANNNLAAAKLILSRSQKLISYFADADRYRLMKGYSKIKNKKVIDELEKNLQIKLSIPMGYDVA----SKANRFMWIRKETGETSQGLFIYDYPYTDKKSFS--------VESIVHFRDSLTRAYVPGALEGSY-MKVVKEFPPVVKEVSFNDNYAIEVRGLWDVEGDFMGGPYLSYTILDIEHNRVICAEAYVYAPKFSKRDYLRQMEAILLTLK 324
17 6.000e-94UniRef50_A0A2N2WWD1 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2WWD1_9BACT  ali  25  17.............GGCKQSRVKESLLPSSSGNPGEVVLIMEKTAWEGSAGESFRSLLQEETPGLPQREPLFNLVNIPAKAFTDLFKIHRNLIIVSIDPSI----------------------EQAGINVDYNRWSKPQLIITMKAPNRESFFELYDKNNQKILGLLLKAERDRLMNNYKAYSEQSLINRLEKRADIHLDIPKGYYYA----LDTNNFIWLSHETSETSQGLFIYYYDYVDAETFSLNT--------LINKRNEMLKKYVGGENPGSY-MSTELQVLPTFRSFKLNGTYTAELRGLWKVEGDFMGGPFISISQLDESKNRVVTVEGFVYAPKYNKRNYVRQLEAILYSLK 327
18 3.000e-93UniRef50_K6BED4 Uncharacterized protein n=58 Tax=Bacteroidales TaxID=171549 RepID=K6BED4_9BACT  ali  26  18.................GACNSGSVMTQATGFAYEVVVVMDQKDWKGPAGEAIKSELASSVPGLPQAEPSLKITYVQPKDFTGLLRYVRNILVVTIDPTAYT---------------------KVSVGYENNVWARGQVVVSLKAPNTESIVEYSKTHEKALVDFFVKVEMNRAIEQLQKEYSMVVMDNLKSDLNVMLNAPANFTYYK----DTTDFFWSSNNANTGRMDLIVYTFPYTDPNTFTEEY--------LVAKRDSVLKANLPGSFPGSY-MQTETRAGVEYTPITLNGKYCGVMRGLWRMQGDMMGGPFVSHTRLDEKNHRVVVAEGFVYAPETDKRNFMRRIEAALFTL. 324
19 4.000e-93UniRef50_A0A1V5F7G4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA395 TaxID=1852820 RepID=A0A1V5F7G4_9BACT  ali  25  37FVLTLLLIMSGCNSNKSS-------LPGITGSMYEVLVVMDHQQWISAPGRTLVDLLDQDMEALPQPEPVMDIIPCRPEGFSNMFKSSRNIIISDISEKYS----------------------QPKVVYARDKWAHPQAIVRITAPNDSSFVEAVQKFGKNILDFFITQERQRQMEYNKSFVNLEARAEIEKIFGIQIDIPSEFKKA----VKKKDFYWITNDNPKIRKDIVIYSYPYTDKNTFTKDY--------LLAKRDSVMKYNVQGEIEGSYMGTEYKYYPPIFREIWVNGGYCAEIRGLWKMHGAAMGGPFYSHTRLDEINQRVITIEGFVFAPGEKKRNAIRQLESVVYSAK 355
20 8.000e-93UniRef50_UPI0003676A05 DUF4837 family protein n=1 Tax=Flexithrix dorotheae TaxID=70993 RepID=UPI0003676A05  ali  35  14FSFVVIFSIWGCSAKQEKDLG---LLPSAKGEVGEIILVIDTVKWKGALGDQIRETFSQKIEGLPQPEAMFTVRNIEPNSFVSFLRQHKNIVIVTTFDENTAGSRKLKEFFTPESIAQIKNNENLFMTNSENEYAKGQLVMNLFSRDEATLIKHLKENRQKIQDVFNNRERQRVAGKLFKARKKELEVSLAEEHNFKMIVPAGYKFV-PLNTEAENFVWLRYVEYDYDKNIVISYKDYKSEEQFE--------VENILQWREEIMKKYTVQDSPDNY-VIKEKLVPVSSRKVNFNGKYGVELRGIWRLSEAIVGGPFLAYVFYDKDSGRIYYLEGFLSAPGVRKREHMREMEVVLRNF. 358
21 8.000e-93UniRef50_A6LE04 Uncharacterized protein n=22 Tax=Bacteroidales TaxID=171549 RepID=A6LE04_PARD8  ali  23  12..LSLMVGLSACDWTSSSPVAS---LRRATGWPFEVVVVMDRDAWNGEVGELLQEQLRAPIPALPQAEASMRVTYSEPSGFSGLLRYVRNILIVSVDPNRYT---------------------KAGTRESPDEWASGQNVVTLYAPTTAALTEFLLLNEGRLVNHFNRVERERWIVGLSKSHSSWINEKLKSRFGISLFVPEDMSAYK----EETDFFWGSNNANRGRTDILVYSFPYTAQEAFTEDY--------LVAMRDSVVRRNVPGSFPNSY-MKTEKRFELSYEPITYRGEYRGVLRGLWRMEGDKMGGPFVSHALLDKKKGRVIVAESFVYAPESKKANLIRRMEAALFTL. 330
22 9.000e-93UniRef50_X0YHM7 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0YHM7_9ZZZZ  ali  28  12.LLCFIFINFSCKPDE------HSILPKITGSAGEVLLILEKYRWEHEVGAEFRNLLSQYHAALPQPEPIFDLIHVPLAQFSKIYQSHRNIIFTRIGSQYS----------------------ELKIVVQRNMFATPQIIINIQAPNDSACVALLRQSGNEIIKRINRSELNRIAGNYKKSQVQEIVTTLKEKHNLTLYIPKGYTIDLNV----DDFVWIALETPLTTQSILIYYYQYTDTNTFTPDY--------LVEKRNQYLKKYVPGPVPGTY-MATEDLIPVEFKELTYKDRYFAELRGLWKLENGFMGGPFVSLSTVDEKQNRVVTVEGFVYAPRDKKREFLRQVESILYTLE 328
23 1.000e-92UniRef50_A0A0L8AKW4 Uncharacterized protein n=5 Tax=Cytophagales TaxID=768507 RepID=A0A0L8AKW4_9BACT  ali  30  6FLAMILLSISSCGSKSEKTKMNPNLLPDATGQSGELVIVMNKEKWDGPLGEALKEVFHASVPGLNRTEPSFTTRVIEPFQYNRIFQLSRNVVYVTTLDGTTPADNYLKGILPDSFKERIQNEPDLFMNTSDDQYAKGQKILNLFGKNDQDLINHLKENGAIIRNYFNMAERERLATDIRASVDSRISDRIKDKFGYYIKIPVGFELATTS----DDFMWSRYLPARGSKNIFVYFKDYESQDEFTHE--------NVIKLRNEVGKKYIYGDPENSYMITETEFMRPVFRDITFDGKYTVEMRGAWKTNNYSVGGTFISYTFVDEKTNRLYYIEGFIIHPNEEHRELIRQMESILTTF. 360
24 2.000e-92UniRef50_G2EEA6 Uncharacterized protein n=19 Tax=Bacteroidetes TaxID=976 RepID=G2EEA6_9FLAO  ali  25  7.VLISLIVLTSCNEGKSS---KNRVLSQSSGKINNLSVVIDNDLWDGKIGETIRNILAAPVHGLPQDEPLFILSQLPPVVFTGFAQQSRIVLKIERSD-------------------------KPNVKIANNVFARPQRVVIVSGNTETEISKQLTDNAEQIVKALKNEEIREQQRRIKISVHK--NNTIEDNLGISINFPSAYRIA----TEDDKFYWIRKDITTGTTNILLYELPYGSIKDN------DSLVGQIIKVRDSIGKAYIPGPLDGSF-MITEDAYTPFLAKTTINDKLAFETRGIWDVKNAFMSGPFVNYVIDDVANNRLLVVEGFAFAPSVGKRDYMFELEAIIKSIK 323
25 3.000e-92UniRef50_A0A1M5DXG4 Uncharacterized protein n=25 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M5DXG4_9FLAO  ali  24  7.LFFSLALLVACKSNEDK--EEKRILSDSSGNINQITLVIKNSLWEGKVGEAIRDNFAAAVNGLPQEEPMFSLSQIPPETFTGFARKNRSFISI--------------------------QKGEAGKRVVENLYARPQTGVIITGKNQDELIKEINENSEELVKRFKNTELKEKQRRMRKSLASD--EQLQEKFNLSLKFPTAYRYAKV----EDDFVWIRKEIPKGNMEILIYEVP------IKTIEADTNIVGNIIKMRDSIGKAHIPGPTEGSY-MITEEAYAPYLFETKIDGKFAYETRGTWEVKNAFMAGPFVNYAIKDEANDRFLIVEGFVFSPSQSKRDNVFEIDAILQS.. 321
26 3.000e-92UniRef50_A0A2E9GAZ7 Uncharacterized protein n=1 Tax=Thalassobius sp. TaxID=1979401 RepID=A0A2E9GAZ7_9RHOB  ali  37  26..........SCSPKSDKELG---LLKTAKGDAYELILVMDTVKWKGKLGDAVKDIFMEDIKGLPQAEPMFTVRHINPVAFNGFLREHKNIVIVTTFDERTAGSQKLKEFFTPESIKKVREDDELFMLRQTDEFAKGQVVLSLFSKDEATLIKHLKESKTRIQDIMVETERKRMEASLFKARKKELEAALKKSSDIELMIPEGYKLAK----EEKDFIWLRYPEYDLDKNILIYYKDYQSQNEFNED--------SIMAWREKIMSTYTRDPENPDVYVSIQTIAPVNQRKISISGKYAIETRGLWRLKGRYRGGPFLSYVFADEESGRIYYAEGFAYAPGGSKRQHIRELEVILKKF. 358
27 4.000e-92UniRef50_A0A1F3LUS5 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3LUS5_9BACT  ali  25  6FLLFLLIFLSSCFDNTFQ-------KRNITGKAGEMIIVIPKEAWSGAPGTVLRKILNQPQLGLPQEEPIFSLIDVPPAAFNDIFRTTRNIITVRISSTID----------------------EPVAEYKNDVWAHPQAVVNINAKSQEEFEKLFLENSDKIVAFFLKAEKDRLMGNYKQYSDKVVYNTLLKSFNLKMNVPPGFKVVK----KTDDFAWLRYETTEISQWIFIYTYKYESDSTFTPDFQ--------LAKRDEYLKKYVPGPRDSTY-MTTERQIIPLFNIFEHNGNHASEMRGLWRVENDFMGGPFISIAELDASNNRIVTVEGSVYAPRFDKRNYLRQVEAIVYSME 326
28 6.000e-92UniRef50_A0A0S8H734 Uncharacterized protein n=1 Tax=Bacteroides sp. SM23_62_1 TaxID=1703353 RepID=A0A0S8H734_9BACE  ali  26  51..IILFILLAACSNNKQ------PLLPKVTGKPGEVLLVVDQYIWESEIGNFLNTMLTQPFEAIPQEEPIYDPIRISSSAFNNIFKSHRNIILAKISS----------------------RNKKPRIIVQRDIWAKPQLVVNIIGPNDSTTLQYLEENQDKLVSLLNQAEINRTIENYKKNRAKGIDEALKTKHHLTISVPIGYQM----DVDADNFIWISHELSDLTQGILIYYYEYTDSNTFTPEY--------LVQKRNEFTRRYVPGPVDGSY-MKTEDLYPVVYNQYNRDDKYYIELRGLWKLEKAFMGGPYVSLTTLDEKRNRIVTVDGFVYAPSLNKRNYVREIEAIIHTL. 365
29 7.000e-92UniRef50_L8JLP8 Uncharacterized protein n=1 Tax=Fulvivirga imtechensis AK7 TaxID=1237149 RepID=L8JLP8_9BACT  ali  32  9...IITLFFLGCSSNGDR--KNKNLLPPASGRAGEIIVVMDSAQWKGPVGEEIRETFRAEVGGLPREEFMFKINHVDPRKLNDVLKSVKNLLFVMTVDDRGPGSKVVRNYFTKSSIDKIKNDPNLFVHTAEDEFARGQTVMYLFGQNKNQLLEKIKVNREKLQNFFNQAENKRLYALYQAKEEIGFNKMLKADHECSMRLPFAYKLVVNQP----GFIWFRQINAESDKNIFVTYRPYTSEKAFDREA--------ILSLRDSIAHQLFEDPAYPETFITTETYVPVTTEKVSFNGKYAIKMTGLWKTNNLSMGGPFISYTLVDEELDRLYYIEGFLYSPGKNQREFMRELEVILSTFK 355
30 3.000e-91UniRef50_A0A2N3A9A5 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A2N3A9A5_9BACT  ali  27  7FLLLVIFLFYSCDET------NERILPKISGKSGELLVVVDSSYWNNKTGEAIQEAFSTTQVGLPQAEAVFDLIHVPHRAFASILQTNRNIILIEIN-----------------------ANKESAVAIKKDVWSDGQMVVTILAKNDKNAAEIIEKNAKNLVDYFNEKETERLQNKYKVNKNSKLAKQLEEKLKLSMHIDDLFYIAK----EDTNFIWLRKEYHPISQGFIIYTYPYDNDSIFN--------VHQLTAKRNAVTKQHIPGGADGSY-METFGAYIPKEREINFKGIYAKELRGLWQMNGDFMGGPFVSYSMVDEQRNRVITIDGYVYAPKFDKREYLRQLQALALTV. 328
31 3.000e-91UniRef50_A0A1F3EBJ1 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3EBJ1_9BACT  ali  23  8.LMIATFILVSCKNKDSS-----RLMTNVTGKAGEVVIVIEPGMWNSNIGVEFRRKLAQDYPGLPQAEPLFDLVHIPYSAFSNIFKTHRNILLVKVSNEYD----------------------EPKMIIQKNLYAKPQIVINILAPDDSSMEALIRDKGDLIVDRLLKKEMSRYASNYTKYEDKTVGERLEKKFGINITIPKGFKI----DMDTTDFVWVANDSPAMSQGLLIFSYDKPDVELTTPY---------IIAKRNQFTSQFVKGENPNSF-MIVEQEVEPFRREIVINKLKVTELRSLWRVEGDFMGGPFVSFTFVDDKKNKVIHADGFVYAPQFDKRDYIRQLEAILNSVK 324
32 5.000e-91UniRef50_A0A1W9QXM4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4484_249 TaxID=1970778 RepID=A0A1W9QXM4_9BACT  ali  25  11..FFLFIILNSCGGKKSS-------MPQSVGKTAEIVVVTNNQKWDGEIGETVRTFFNQDFEVLPQTEPLFGLANLQIVNFNKMFKSHHNIFIINID----------------------KKSKEATLEVKKDLWSRPQRIVKITAPTDSSFINFFNKKKEVIESIFMESERERLIRTFKAFKDHEIQNELRKNFDLTLEVPGGFFIAKKY----SNFMWLRKEGQKNSLGILIYTYDFTDTLAFNPE--------RIISYRNTLSKEYIPGPSEGSFMVVDEKFMPVISRRIDFNGMFAVETRGLWKVEGDFMGGPFVNYTFVDEKRNKVITLDGYVYAPNAKKRDLLIQLEAILYSVK 329
33 5.000e-91UniRef50_A0A1F3LF34 Uncharacterized protein n=8 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3LF34_9BACT  ali  24  21..IVAGTIISSCTGGPQ-------LMPNISGKAGEVVIVVNKGNWESDPGAALRSVLAIEHPFLPQSEPLFNLINIPENAFTSIFQSHRNIIILNVIP----------------------NLPESKMVIQENVWAAPQIVVTISAPTPQDAASIISRESDKLANALLQAERNRNIQNAKKYEEKALRDIVTSKFGGSPFFPKGYNLRK----QTEDFIWISYETTYTNQGILIYKYPYTDTTDL--------MIENLLARRNEILQKNVPGQLENTY-MTTNMLFDPGMRWVKYSKRNFIELRGLWEVQNDFMGGPFVDHIFLDKENRNIIVLEAFVYAPRYDKRNYLRQVESIIYSFE 335
34 6.000e-91UniRef50_A0A1F3E319 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3E319_9BACT  ali  28  7.IIVLIVFFYSCRNKEKT-------LPTITGKAGEVVVVIDNNLENLEAGQALKKILTKEVDALPQPEPTFDYINIPSNAFTNIFKTHRNIIICEIN----------------------KSEEKGKIIVKKDVWARPQIFINIIANNDSILNKLITDNEKLILSSILDAENQRIVDNYTKYEDKIITKEIAKKYDISLKIPKGFSL----DLAKDNFAWISHETPQISQGIFLYYYNYTDTNQFSKD--------SLIQVRDEFLKKYVPGPRENSY-MSTEHNYEIHYHEFNIDSMYIARLVGLWKVEGDYMGGPFVSYSTPDIKRNRLITIEGYVYAPRFDKRNYIRQLEGILSTIK 322
35 6.000e-91UniRef50_A0A256WC40 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A256WC40_9BACT  ali  25  14.IALISIAFTSCDFKSSG-------LKPSTGKTNELLVVTNSKDWEGLMGKEIKEFFGQELAGLPQPESMYSMAHIPDPNFGEMFKPHHNIFIVDVDPEID----------------------KPILETRKDLWASPQRVIKMTVPDREQFFTEFAENKEAFIEFFNENERRRVSRAFDAIEDYSFRNRLVDKFDVSMRFPKSFYVA----TETKDFIWLRREAEQFSQAVAIYFYPYDEMTAFNPEV--------IIHVQDSVTKKHIPGPSAGSY-MKVSMFDPPVAKQIEFNGAFAVEMRGIWEVEGDFMGGPFISYTTVDERHNRVVTLLGYVYNPGQDKKDLLRQVEAILHTFE 330
36 8.000e-91UniRef50_A1ZDY0 Uncharacterized protein n=2 Tax=Microscilla marina TaxID=1027 RepID=A1ZDY0_9BACT  ali  32  3........LSACIGGDQTSKDNSQFVVDSKGGIGEIVVVMDPKKWDEPLGKALRNVFARYIPALPQPESWFKLMKIPPSKFKSFMKRHHNIVILASLDNTSLEGRYLKGYFTQKSIDLIKKDPKKFMMRRKDVFAKGQRVMYLFGNNDTQLIENMTKNKDQLLNYFHDMEQKRLTKDLYNAEQYKLSNYVKDIMKVKVRIPAGFKLAK----KDKNFVWLRKPLRKADINLLMASRPYTSTKVF--------DEQNIIAWRDSLGKKYTNDPTLTESYVVTETRFEPITKRIIKDKKFAVEYRGFWKLKNGTRGGAFISYAFVDEAQKKVFYLEGFIYAPGMKKKDAIFQTEAILRTFE 348
37 1.000e-90UniRef50_A0A2A5HJJ4 Uncharacterized protein n=5 Tax=unclassified Flavobacteriales (miscellaneous) TaxID=403978 RepID=A0A2A5HJJ4_9FLAO  ali  28  10FLVSFSTLFYACDET------NERILPSMSGKSGELLVVIDTGYWSNQSGEAIRQTFMQTQVGLPQQEAIFDIIHVPHRSFARILQTNRNIIMVEIN-----------------------AQEKPAISIKENVWSEGQLVATIVAKNDKNAAEIIEKNSQNLLDYFNEKETQRLQKKYKVNKNSKLAKELEEKLKLSMHIDDLFYIAK----EDTNFIWLRKEYHPISQGFIIYTYPYDNDSIFN--------VHQLTAKRNAITKKYIPGGAEGSY-MTTYEEYIPKEREINLKGNYAKELRGLWHVQGDFMGGPFVSYSMVDEHRNRVITIDGYVYAPKFDKREYLRELQALALTV. 329
38 5.000e-90UniRef50_A0A1V5VK88 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin234 TaxID=1852810 RepID=A0A1V5VK88_9BACT  ali  24  15.IFFLLLCFTACESTGTQGKG----LLSSSGRSGEMLVVCSSSQWKGELGDSLQHFFMSALECLPQNEPVFTLSQVANQDFNAVYQKQRNILYIDIDKKYT----------------------EPEITVVKNKWASPQLIVNIAAADESEAIAFVSYYKDKITALFLDAEIKRFQRAQLAQQDRNIDKKLQETYKISMIVPNGFVFAI----KNENFCWLRKETKYWGQSILIYVQPYTDTLMLTNPY--------IITMRNQQTKQYVFGSLDSSYMIVDEKFIPTKSEFYDFNGMYAVKTQGIWKMIGDFMGGAFVNYSLLDEKRNRIITLDGFLYAPTDDKRDLLRQVEAILLSTK 334
39 8.000e-90UniRef50_A0A2J6HNT1 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6HNT1_9BACT  ali  21  10.VVTIAVIFTSCGNAGNNAAEKLMEKPGSSGATYEMLVVCGDKVWESSIGDEIRNYFNQSDSTINQNEPLYTTPHITQATFNTMFQNHRNVLQVVIDPSNDPKVQKIV-----------------------NKHSQPQRIFRFTVRNEAEFKKLFDDYKATIYSSYVEAERIRINRFFNQQRDGKMSHFLNEKFGLTLTMPNGFRVAK----DANDFVWLWRQTPKVDYGIMVYTEQYRDTSQLDP--------RAVIQLRDILTFEHIPGDLPESYMQVVTDKFPVASYPTIFNGIYATELRGLWETRKDFMGGPFLHYAIVDEQNNRIIHLDAFLYAPGQDKRDELLQLEAILYTLK 334
40 8.000e-90UniRef50_I4AHG7 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=I4AHG7_BERLS  ali  35  14FFLLTGVFLFSCSSDNKKVFSYKDFLPPSKGGRGEILLQMDSSKWEGDLGAAVRELYMAPMPGFPQPEPIFKIYHAAPKKVNDLLEEYHSIFVILSLESKSIDSDILRKKFAKESLDRIKADTTPYLIVKQNEHAKNQQVVYLIGKDDEQLIKHLKANEEKLREIFYKTERQRYLVAFRGGKQTGRMERYKKEHGFTIGIPEGYQEAKDIHEGDSGFVFMRDNANGRDRNVFVAYKPYLSQGQLNAD--------SILTWRRELGKKYMKDPDRGSYMTDQTDVMPYFSQEINFKGKYAIEIRALWKLSSNTSGGPFVGYLIVDEKKNRLYYIEGFIFAPTFKKRDYIREVESILWTFE 370
41 1.000e-89UniRef50_A0A2G2KAD5 DUF4837 domain-containing protein n=1 Tax=Kordia sp. TaxID=1965332 RepID=A0A2G2KAD5_9FLAO  ali  25  8.ILVLSLFLFSCKEDTKK---EKRYLPSSGGTTNILTIVSDDSLWNGAVGDATRAIFAAPVYGLPQEEPIFTLKQMKPKAFHDFVKKSRTFV-------------------------ELKKGTPKGIKFIKDVYATPQLGIVISGKNNEELISVLTENATLMTDKIKLVEVTHKVKEMAKNRLD--IKEVSDTFGIDLTVLFSYRIAK----KTDDFVWLRKEIKNGDMNLMIYEVPYG------TIKNDSLAINNIVKLRDSIGKTHVPGPVKNSY-MITEKHFSPYLGTTIINGKTALETRGVWDVKNDYMAGPFINYIFDDKKNNRQLVLEGFTYAPQIAKRDYMFELESIIRSIK 324
42 1.000e-89UniRef50_A0A1H3W2V8 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H3W2V8_9FLAO  ali  24  8.VIAVVLITLSCKDGNKKGH---RVIPESSGPLNTVAVVIENEKWEGRLGQAVRNVLAAPIDGLPQDEPLFSLKQIPPHVFTGFSRINRDIIKIEL--------------------------GEAGVTIQDNVYARPQKFIVVSGANIQEIEEQLQANAQTIVKAFKVEEIAEKQRRIRKSLFPATS--LKKKLGVDIQYSTAYRISK----DEDNFFWMRKDIPTGYTNLLVYDIP------LNSLKDKDSLVSRIVKIRDSIGQKYIPGPTDGSY-MITEKAYAPHLFETTLDNKPAWEVKGLWEVQNAFMSGPFITYIIEDKDNNRYVVAEGFAYAPSIEKREHVFELEAMIKSIK 323
43 2.000e-89UniRef50_A0A2G6PTQ3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6PTQ3_9BACT  ali  26  11..LSLLVMLSSCGEVGKERRNKLLEKPGSSGATYEMLVVCGTKVWEGAIGETIRTHFSQLDSTINQGEPLYTTPHITQETFNSMFQNHRNVLQVVVDPTNTSKLERV-----------------------EDKYSKPQRIFRFRIRNEADFMTLFDTHKELIYKAYVEAERIRINRFFYGQRDGKMAHFLQEKFGLTLTLPNGFQVAK----EAENFAWLWRKTPKIDYGILVYTEPYEDTVQL--------DKQAIVRLRDIITFDHIPGDLPESYMQVVTDKFPVSSYPIAFNGFYAMELRGLWETVKDYMGGPFLHYAIVDEKNNRIIHLDAFLYAPGQNKRNELLQLEAILYTLK 334
44 2.000e-89UniRef50_A0A1M3DBK4 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1M3DBK4_9BACT  ali  24  7FLLFTVLLFVSCIQTGK-------VLPSATGTRYEVLVVLDENVWKAPSGRAIVALLDQDMEALPQPEPVMSIIYCQPQQFGDLLKPTRNVLKIDVDPRFET----------------------PKIIYSKDVWSYPQSMVRINVANDSVLSRVIRQSGNNILQFFLSTERDRLIALSKSSINSKAQNEIKEMFGISLDVPNE----LSKITKGKDFYWVTNDHHVARKDLVIYSYPYRDKNTFTLDY--------LIAKRDSIMKANIPGELEGSYMGTELVQYKPIYNAININETYCAEVKGLWRMFNGAMGGPFYSHTRVDEINHRVITVEGFVFAPGAKKRNHIRQLESVIYTVK 327
45 3.000e-89UniRef50_A0A2N3ABB8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-1 TaxID=2013677 RepID=A0A2N3ABB8_9BACT  ali  23  8FLFFSGILLLSCNEPQQRIA-------RSVGATSEILVVTQNKQWQGSEGEALRAYFEQDQYGLPQSEPIFKLTNINVVNLSEMFKKHRNLIVVEIDPKLD----------------------KAVVETRSDLWSKPQRVIKITAPDTISWMEAFDANKEGFKILFDRSERERLMNIFKPTAKLKVMEPIQKKFGVKLIVPEGFYVAK----DETNFLWVRKETNDFSQALIFYSIPYRDTLALTP--------QQVIRVRDSVVKQHIPGPSAGSFMSTDKEFILPQVKNIHFITDFAVETRGVWNVEGDFMAGPFVSYTIIDQRNSRLLTLEGYVYAPNKPKRDHLRQLEAILYSLE 327
46 3.000e-89UniRef50_A0A2M7K4V1 Uncharacterized protein n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2M7K4V1_9BACT  ali  25  7.IVFISITLFSCDNTQK------DLLLNVTGKPGEIVVVIEKNTWSMSPGEQLKRILTTVQPALPQDEPMFRVYHIEPSNFSVLFKSNRNIIYVEKGDFKDSAT----------------------IHLKYDVWAKPQAYIEIIAPSDSELTTLIMNNEDKIIDFFITSERKRMQATYNTFKEKEITSKLLKHH-VNLTFPKGYKI----DVDTLGFVWITSETPNISQGVFIYEYNYRDTNTFTAKY--------IIQKRDSILKRFVPGQLPETY-MTTEHGYVPYVNEIFINGKYTFELRSLWKIQNDFMGGPFVSLSTVDKKRNKVITVEGYVYAPKYDKLEYVRQIEAILYTLE 322
47 3.000e-89UniRef50_UPI000D6B1EB0 DUF4837 family protein n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6B1EB0  ali  32  11FSIIAVTFLSSCNSKKEGKEKVADTLPSANGAIGEIYLLMDSAKWEGELGAEVRKIFNETMPGLLQNETRFNVSYIRPKSFNRVLKRTKNLVFITSLESNSSDTEKLKEFYGKAMQDKFVETGEAYMSAGTDIYARGQKVLNIVSGSDRELMKLLKKNKQSIHKFFADADIARINEKMI--FNTHLKNELKKEHGFSLNIPDGYKIAK----DTAQFVWLRQPDVKWDKYLIVAYKDYESEKEFDYD--------SVIHFRDSLCKKFIYGNKKDSYVITLKDRFRPDTEVTELDGKFARELRGHWQTYSQTMGGPFVSYTVTDDENKRLYYVEGFVYAPSKDKMPFIRELEAVLTTFE 361
48 4.000e-89UniRef50_A0A1B1FS04 Uncharacterized protein n=2 Tax=Flammeovirga TaxID=59739 RepID=A0A1B1FS04_9BACT  ali  29  10YISFSLLCLSSCDNSGAKTETEKSFLPSSKGKPGEMVLVIDSTQWGTKAGQLYTKVLGATRGILPQSEPQFTVTQVQPSGFNSILRQARNVMIVTTFDNKGRESRILKSFFGEGVIEALSKDPEKYYYVKKDVWAKGQTVMLFFAESEEKMAKVLEDPNKTLTQPFHDIENKRLAERITKERDRKITRFLKDKYNVDISLLQGYKIAKS----EEDFLWLRHPEIAFDNNIILMKMPYTDEKQFDADH--------ILKFRNELAKKYLYGPEDKESFVITESKVKPEIKNAKIDGRQAVEIRGLWRTNTYSMGGPFISYLFTDKSGANLYYLEGFVYAPSMDKRELMRDMEAQLKTFK 363
49 7.000e-89UniRef50_A0A150AJJ5 Uncharacterized protein n=3 Tax=Flammeovirga TaxID=59739 RepID=A0A150AJJ5_9BACT  ali  30  1........MFSCSKEGAKSDLEKSYLPMAKGKPGEMVLVMDSVQWKPQDGDLYKMVLGKSRGVLPQPEPQFTVTQVIPSGFTSILKQARNVLIVTTFDQNTRESAVLRSFFGKGVIEKLRKEQDKFHFIKYDAWAQGQTVELLFAKDEATLREILKDPAKQIAEPFHDLETKNLQKAINKTYSRVTDKFLRKNMNVSMKLLDGYKVAQN----DENFLWLRHPEQSFDKNIFISKVPYTDQKQFDPE--------QIVLDRDKLAKQYLYGDPSNNSFVVTEKLVPVESQNTKVDGRLAVETRGLWKTNNITMGGPFVSYTFTDKSGAYLYYVEGFIFAPGMDKRELVREMEAQLKTFK 346
50 7.000e-89UniRef50_A0A2D5K8S0 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5K8S0_9FLAO  ali  27  11.IVFLIAFLSACVKDGSK--SSDKVLPTSSGKYGEVLVVVDSTYENRKTGAVLETIFFKGVEGLPQKEPMFRMSTVAPRDFKSILKRSRNLVRITIADHR-----------------------ESQIKVESDVWAKDQLLIQLFAPNDEEAARILEKNKQNIRDYFNEKEIERLQAQFSIKPNKDIAKQILKRFDVSIVIPPAFVMMDTSG----NGLWLQKQKHEILQGIMIYEVPYTSDSTFSSNE--------MILSRDYFTKSHIQGVRDSSY-MTVYRDYKLMPKEINLNGKYAVEYRGLWNMKNDFMGGPFVHYTIVDEKRNRVLHIDGFVYAPKFNKREYVRELDAILQTFE 334
51 9.000e-89UniRef50_A0A1M6TQ84 Uncharacterized protein n=2 Tax=Reichenbachiella TaxID=156993 RepID=A0A1M6TQ84_9BACT  ali  41  31.................KKDSDKTYLPKAGGEPNAVLVVMDTTDWSGEIGESLRDIFSAYVPGLPQDEPYFKVRNINPLKFNSIIKRATNVIFVHTLDSRGRQSYQMSKYYSEATVERIKKDSSIFMLPQTDVYAKGQNVLHLFGQTKTQLIKHIQDNQSTLRNHFLKIENDRVASKIFKVREKQIEKRLEEDHDFTLNIPYGYELAKNL----KDFVWIRQLDTQWEKDIFVYFRPYDNQEPFE----------DVMAYRESITSMYMRDIQKPEIYMTLQDTLG-YVKEVNFKGRYAKEARGLWKYSDISAGGPFVSYTFVDEEQKRIYYLEGYVFNPGEDKRVPMQEMEVILQSF. 356
52 1.000e-88UniRef50_A0A2G6GY89 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GY89_9BACT  ali  25  38YFLAVMLGFSSCDSVGSTGGAAGHIMPNVNGTAGEVLVVMDDYSWEHEAGEIIQDILKEEIVGLPQSEPLFDVIQITPGSFQNAFQFHRSIVL-----------------------TTVGSGKEAKISFRENVWAKPQIVVQMQASSAEALRDLIREQESRLQAFLVQYDRKRQIENYQKTKDEGIQNLMTKHHQIKLAIPRGYNL----DFSKDEYSSVSIESSELSQVIQVYDYPVAGPEDLSTEK--------LIEKRNEMTQKYVIGPREGSY-MRISGLFPPVAYDLVIDGLQVVELRGLWELENGYMGGPFISHAMYDAARGRIVVVDGYIYYPNQKKRVKLKQLEAIVYSTE 360
53 1.000e-88UniRef50_A0A1V1ZJC6 DUF4837 domain-containing protein n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1V1ZJC6_9FLAO  ali  21  7.VAVFATLFFGCKDASK----NQRLVPASSGNLNHLTVVVDNLLWEDKVGEAMRDVLAAPVPGLAIDEPLFTINQLPTQVFSGFTTKSRIIVKV-------------------------EKGKEAGIKVGHDVFAKPQTVVYVTGTTNDEIIEQLQSHSEEIVKALKDEEIKEKQRRINLSLFDDT--RLKEELGVSLKLPSVYRMAK----DEDGFFWIRKDITTGTMDLMVYAVP------LSTLRPGDSLAMDVVKMRDSVGKTHIEGRLEGSY-MSTENKYAPFVFESQIDKKPTIETKGIWEVKNDFMAGPFINYAIEDKAKNRYVIIEGYAFAPSVDKRDYMFELEAIIRSAK 322
54 1.000e-88UniRef50_UPI0009E397D3 DUF4837 family protein n=2 Tax=Persicobacter TaxID=59740 RepID=UPI0009E397D3  ali  29  14..ILLMVAAFGCESTSSKKKKKE-YLPASRGVFGQILLVMDSASMKGPIGDALDEVFLSPYAVLPQSEPKFKILRITPEDFTASLLFQANVVRVYSSDNHSKSADLTKQAMPKSILSKLSSDPSDYMAVAKDVYARGQEVMFLYGNTQEELAGKIMMHADVIQQHFNEREKKRIRTDIYSSESKELGKHIQDKFGVKLRIPFAYKKA----DEGQQFIWFRNPGQKIDKSFFLTETPFVSESQLEPD--------SIIAFRDRVCKEYVLGNDDPDSYMLTQTILKPETKTVDFNGKYAVEIRGLWRLNEIAMGGPYVGYAIVDEAQQKLFYLEGFAYRPGGNKRELIRELEAILWTFQ 359
55 1.000e-88UniRef50_K5YDP4 Uncharacterized protein n=7 Tax=Parabacteroides TaxID=375288 RepID=K5YDP4_9BACT  ali  24  18.........TACNR-SSKPAKQSIFMKRATGFAYEVLVVMDKDAWKGEAGRLLYDQLTAPIPGLPQNEPAMRVTYAEPFQFNGLLHYVRNIIHVRIDESLYT---------------------KVSVHKEKDRWATGQEVVTLNAPSSRILAEYLEKQGTSLVAWLGEKERERQADYLESSHSVWVNDKVRARFNAQLYAPEEMCSYK----DTADFFWVTDHGTRGRIDMVVYSFPYVSGRTFTLDY--------LVAMRDSVLGEHIQGAFPGSY-MTTEKRFTPSYEAISKNGEYCGVVRGLWEMEGDMMSGPFVSHAHLDEKNQRVVVAETFVYAPGTKKAKLLRRGEASLYTF. 331
56 2.000e-88UniRef50_A0A1T5K2E2 Uncharacterized protein n=2 Tax=Bacteroidales bacterium WCE2008 TaxID=1945891 RepID=A0A1T5K2E2_9BACT  ali  22  1....MALAIVSCKPTK-------TLLPNVSGKAGEVIVVIDKNNWEGNLGNEVREVLGSDCPYLAQKEPLFNVANVSPGGFADLFKVHRNILIFNINPQNQTEG----------------------VVYRKDVWASPQCLIQVNAFDNESALKLLHDNAERVANSFEQAERDRIISNARKYEEHPLFKTVSEAFGGSPHFPTGYKLKK----KTDNFIWIADEKQYTIQGVLIYKYPASENENFSQE--------SIISHRNAILKENVPGMFDNT-WMTTATYIEPTVSFVKYRNRQFAETRGFWEVQNDFMGGPFVSHSFYGPGAEDVIVVEAFVYAPKYDKRQYLRQVESLLYSFE 313
57 3.000e-88UniRef50_D0MHI5 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=D0MHI5_RHOM4  ali  27  25FGITCLSFLLGCGN--------VDYRPLAIGDNGEIQVVIDSTLWAGPVGEALRMALGYYVQTLPNPEPFFQLRPIEPRIQDDLVKKFKNVLFVAALRDSSQISRLVQQAFSPEALQAVR-EGSAAVVPRGDLWRRRQLVYFIVAETDSQLVEAIRRATPKLREDFDEIARERLIEMFEKGRQFDIEDTLMAHHGFAVNVQHDYVLV----FDTTRFVWLRRVLPDTWRSLFVYYEENADPAKLTPE--------WIYATRDSLTRRYLQGNAGG--FVQIDYRQPLETRQIDFLGRYGYETRGLWHMVTELMGGPFVNYSFYDQKSGRIYMIDGMVFAPGFEKREFLRQMEVIAYTF. 371
58 4.000e-88UniRef50_A0A1Q6HGI0 Uncharacterized protein n=1 Tax=Bacteroides sp. 43_108 TaxID=1896974 RepID=A0A1Q6HGI0_9BACE  ali  22  11.LFVLAFAFISCGDQKRSVDDASILTPSSSGRPYEIMVVAEDSIWDGYVGRALDDVLNTPLKGLPQEESLFHVSHIVPEHYDRVTNLFRNIIVIDIGELYT----------------------KASFKIVRNLHAAPQMIMTIQGPSVLDVSVFITENTKFITDFFGNEEINRTVRALNKRHNIEFSKKVQDMFGCDMYIPVDINKMKI----GDNFIWASNDALTGIQNIVIYSYPYVSEKVFT--------KHAYVALRDSFMKVNIPGGQPNQYMATDYEH--VDVKNMKIQDSFVQEARGLWQMENDGMGGPFVAHSVVDTVNNRVVVVEGFVYAPEKMKRSMVRRLEASLYTLK 332
59 4.000e-88UniRef50_A0A2A5WVV7 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2A5WVV7_9BACT  ali  73  11..LIILSFLCSCSYNPQSNIENSSFLPRASGKNNEMLIVMDSTKFKGKIGRVLVETYGAYVKGLPQPESKFDLRHIKPRKFNSILKHAKNIVVAFTLEGKSLDSQILRKNFNSESLDKIKSDSELFYFSKRDQYAKGQTVLYLFSKTDEDLYYNISQNKIAILKYFEDELKKRVDREIFLKQEKNISKKLYEDHGIKIKIPYGYDLAKNS----KNFFWLRQLDPEFEKNIFLYYEDYGESQLKNFYEVFNTEKPSIKGIRNKISKSYLRDSENSKIFMSIQDVFPIQSQKINFKGNSSVESKGLWKLSDISAGGPFKSIIIYDSNKKRMYYLEGYVYAPGSKKRNLMQEISSILMTFD 363
60 6.000e-88UniRef50_A0A1Y1CM92 DUF4837 domain-containing protein n=6 Tax=Bacteroidia TaxID=200643 RepID=A0A1Y1CM92_9BACT  ali  24  11.CLFVVVSISSCKKTTKG------LRPVVTGKSGEVVVIVNDALYEGSVGDALKSVLNDTQIGLPQDEPLFDILQISHNEFSSMFKTHRSIL----------------------DLRVSSKVAENKLSVKNEAYAKTQSFMKIEAKSNEEMINLLSENKNKIVAYFHIGERERKIKVFKKNVVQEIFEKLKKNYNFTLSFPAGYTINK----EEDNFLWLSKETPTTSQGMFIYSYDYLSEDSFTKD--------QVIGKRNLLLRKFVPGPKEGSY-MATEMNFPISNRQFEFHDNYAAETRGLWKVEGDFMGGPFVNITFLDQKNNKVICMDSYVYYPNHDKRELLRELEAIMYSY. 326
61 6.000e-88UniRef50_A0A2W4P1D6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2W4P1D6_9BACT  ali  29  9..LVLAVVLAACD-----AKNNRDLLPRATGAPGELLIVIDSAQWRGPLGDALREVFAAEVPGLPHDEEYFRLISAHPSGRIDLLTHMRNIIYVFTLDENAQGSRRIMSNFTPQSLENIRTDTTFFHTTARDVHSRGQVVMYLFGPNEEKLIRDLKTHASTLVGFFNNVERERLQENIARKTTRPLTEFLEREYKISLRFPHGYVVA----DQQKDFVWFRRIETEVDKDIFVAIKPYESEYQLLPD--------SIVAWRDEVAKKYLYDPSNPISYVITEREVPVTAKQTRLNDQYAMEIRGIWRTNNKSMGGPFAGVAVANPDNGMLYYIEGFTYSPSKAQREIMRELEAIVHTFK 353
62 8.000e-88UniRef50_A0A2T2U6M1 DUF4837 domain-containing protein n=1 Tax=Bacteroidetes bacterium QS_8_64_10 TaxID=1919108 RepID=A0A2T2U6M1_9BACT  ali  23  47.LLALTLFAVSCGEG-------VDYRPDAIGEEGTVTVVMDSSHWNGEVGAALRRTLGRYITTLPQPERAFNVRELDSQNIYNQIKKHKNVIFVAVLDDTTQVADFMRRRLSKKVRQAV-QDGRALFTPRGDVWRQQQMVAYLTAQTAEELVQKIDAVGPKLRQTFNEATRRRQVEMFEKGRQHALEDTLMQRHGFAVNVQHDYQIIQDTTTASGGFVYLRRVLPSTWRNLMIYYTDEVDPSTLSPS--------WIKSTRDSLTRQYVRGNVAGDYRDIT-SRKRLASEQINFLGRYGFEVRGVWTMEGDSMGGPFVSYGFYDRASGRLYLIDGAVFAPKFDKRDFLRQMEVIAYTF. 405
63 9.000e-88UniRef50_A0A1M3M8C7 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1M3M8C7_9BACT  ali  25  17..........SCGQGG-------VVLPSATGTRFEILIVMNDNDWKAPSGRAVVALFNQDMPALPQSEPLMDISQIKFSEFSDLFKPSRNILLVEVNPRF----------------------EQPKIAFGKNTWSTPQSVVRVQAANDSVMEQIFKTDGQRILNYFLDTERERSIVMGKSYLNKKTMDEVEKMFGIQIDLPTE----LSKSQKATDFYWLTNDHARIRKDLVIYSYPYTDKRMLTKEF--------LIASRDSVMKANIPGEFEGSYMGTELKHDDPRFRAINVNDTYCAELTGLWRMNGGSMGGPFFSHTRVDEVNHRVITVEGFVFAPGSKKRNHIRQLEAVIYT.. 323
64 1.000e-87UniRef50_A0A1I0RK86 Uncharacterized protein n=1 Tax=Fabibacter pacificus TaxID=1267423 RepID=A0A1I0RK86_9BACT  ali  29  7.LFLVVFTVFACIQSEDKGESRSVALPDASGEPGEIVIIVNKKKYDGPLGDALKEVFLENVPGLTRSEPLFTVRVIEPFEFNRIFKIARNIVYVSSFEGNAAADKWLQGIYSEESRQRIMNNPDSFMQTSGDQYAEGQNILQLYGKDDATLIKNLKENASLIQNYFNMAERKRLAETIRSSASRAILNKVNNKLDINIKIPAGYELAML----EDDFMWVRFLPAVGNKNLIVYEKEYESQDEFTPE--------NIIKLRNEVGQKYVYGDPENSYMVTETKYMKPITRTIDFNGHYTVEMKGAWKTNNLSVGGTFVSYTFVDEETNKLYYVEGFVIHPNEDHRELIREMESLITTFK 368
65 1.000e-87UniRef50_A0A150XDU3 Uncharacterized protein n=2 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A150XDU3_9BACT  ali  30  9...LITLFIFSCSNSKDGNAKKEAHLPEASGEPGEIVIVMNKKKYEGELGEAIKTVFREPVPGLTRTEPMFTIRIIEPFEFNRIFKLARNLVYVVSLEGNSAADKWLQGTFSESSKEMILNDPERYMQTSENQFARGQKVLQLFAKDDKTLINNLLENADAIQNYFNIAEKQRLADDLRSTASRGIVNRVNDQLGISIKIPASYELAIL----EDDFMWARYLPSVGSKNLFVYVKDYKSQEEFEEE--------NIIKLRDEIGQKYIYGDPPESYMITENKYMQPVFRNINFRDKYTVEMRGAWKTNNFSVGGTFVSYTFVDEQKGKLYYIEGFVIFPNEDHRELIREMESLLTTF. 366
66 2.000e-87UniRef50_A0A1G7D9M9 Uncharacterized protein n=1 Tax=Ulvibacter litoralis TaxID=227084 RepID=A0A1G7D9M9_9FLAO  ali  22  7.CLISLFMLVSCNESGKK---DTSYLPKSLGNINTLQVVTPNDLWNGSVGEEIRKYFAAPTDGLPQDEPLFSMNQMPPETYTGFARKYRLALYVTIGD-------------------------EDKIAIKKDAYSKPQTIAFITATSEEGIIALLEANQERIIKAYHASEISERQRRTRVSLMKL--DSLQKDMGVTLKIPSAYRIAKA----TSDSYWIRKDLKSGSTNILIYQVPMDMIRTDTTEVVGD-----IIKIRDSIGSKFLPVEDDGQF--VTEAAYAPYLFTTEIDGKPAFETKGTWEVKNEYMAGPFVNYAVRDEAHNRYLILEGFTHAPSVEKRDLQFELESILRTAK 323
67 2.000e-87UniRef50_A0A2D9QCF5 DUF4837 domain-containing protein n=17 Tax=Bacteroidetes TaxID=976 RepID=A0A2D9QCF5_9FLAO  ali  22  8.FLSLLVAFLSCNNNGTK---DKSLVPDSVGNINSLQVITPNNLWNSTVGEAIRNNFAAATDGLPQDEPLFSINQMPPEAFTGFARRNRIFVYVVLSE-------------------------NEKVSLATNEYAKPQTGAIIQANSEEKLVELINKSAEKIIEAFHKSEIKERQRRTAISMLK--IDTLKKTMGVSMQIPSAYRIAKA----TDSFVWMRKDLKDGETNILVYEVP------LTMIKSDSTAVADIIKIRDSIGSSLLPVEDDGEF--ITEDAYAPYIFKTQIDGKFAYETKGTWEVRNDWMGGPFINYAVRDEKNNRYLILEGFTYAPSVAKRNLQFELESILNSAK 323
68 3.000e-87UniRef50_A0A1V6H7X5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin057 TaxID=1852802 RepID=A0A1V6H7X5_9BACT  ali  24  4FFFITLALLYGCRNT-------DVLLPNSIGSIFEVLVVIDQKDWKSEGGKALFDILNESAPALPQPEALFKLSKVPHNAFDHLVKPARNIVVVTVDSLLYT---------------------KASMKLAKNKWAKNQMVVFITAPNSSSLANYVMAKKRTIQQAFINSERANQMDYYKANANQTAMKKAYEKFGVRITLPTDLNKYK----EADNFLWISNGSIDANKNIIIYAYPYTDQKQLTEKE--------LLSRRDSVLKVNISGSVEGSYMGTEYDVIPPIMKEIWVNDAYCAEIHGLWKMKNGVMGGPFVSHSRVDELGSRIITVEGFVFAPGRDKLNNIRQMEAMVYSL. 326
69 4.000e-87UniRef50_A0A2N5Z4L2 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z4L2_9BACT  ali  23  8.IAVIIALLSSCKDNDQSN-----LLPNVTGKSGEVVLIIEAEHWNSDIGTEFKNTLSQSYPALPQPEPMFDLVHIPYNSFSNIFKTHRNLIFAKVD----------------------KNIPEPKILIQENLWAKPQLIINVIAPDAKSLEDVVREKRDLIVDRIMKKEMERYAANYKKYEQIVIADQLERKFGVRLTVPRGYSL----DLDTTDFMWINRGRGDVVQGILVYSYDIPEVELTTSY---------LFAKRNQFTKRFVPGPEAGSY-MAVETESTPYRREITVNNINVIELRNLWKVENDYMGGPFISLSFVDEKLNKVINIDGFVYAPQFDKRDYLRQVEAVLNSVQ 325
70 6.000e-87UniRef50_A0A2N2W284 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2W284_9BACT  ali  24  40..IYVVTLLHSCTGGPQ-------LMPNISGKAGEVVVVINKGDWESEAGAALRGVLAVDQQFLPQREPLFTMVNIPENAFTSIFQTHRNIIIVKI----------------------IASQQEPKIALQENVWAAPQIVVTISGSDELQIAEIISREQERLRGAMLMAERNRNIQNAKRYEEKSLRAVVTDEFGGSPYFPKGYSLKKRI----EDFIWISYETTYTNQGIFIYSFPYRDSTDFFKE--------NLITKRNEILGRNVPGQVEKSY-MTTNMLEDTGLKWIRYNKRDFAELRGLWEVQNDFMGGPFVSHFFIDKENKNIIALESFVYAPRYDKRNYLRQVESLIYSFE 354
71 7.000e-87UniRef50_A0A109RNN6 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A109RNN6_9FLAO  ali  26  7.LLVIVSFIISCNSGNNQK-----VLKEANGRINNLLVVMKNSEWQGKLGDELRKIIAEPVVGLPQPEPQFEVSQVPPESFGRMFKASRSVLKIGVAD-------------------------KNSFTISTDVYASPQKIITIIGKSEKELINEIQKNSKKIILEFKKSDLRAIQRKILKKYWDPSKIKTFEKQGYSLKIPRTY----NKVEDNGDFIWYRYHLFGGSMELISYTVPITSEDDENGN--------NIVAIRDAIGKKYMPGEIENSY-MITEKAYTPHIFEVTLDGKKAFETRGKWEVKGVYMAGPFLSYTVVDKPNNRLVVVEGLTYAPSINKRDYMFELEAILKTLK 322
72 7.000e-87UniRef50_R9IHW4 Uncharacterized protein n=22 Tax=Bacteroidetes TaxID=976 RepID=R9IHW4_9BACE  ali  24  18.........ASCKKGQKN-----LFTPTSSGRPYEVLVVVNKPVWDRPAGRALFDVLDTNVPGLPQAERSFRISNVDPQHFDRVLKIFRNIIIVDIQDIYT----------------------QPKLKFSRDVYASPQMIMTIQAPDEEEFEKFVTKNSKVIIDFFVKSEMNRQIALLKQKHNDVISTKVGSLFDCDIWVP----VELANYKEGKDFLWASTNRATADMNVVMYSYPYTDKDTFTKEY--------FIHKRDSVMKANIPGEREGMYMAT--DSMFVDVEDIVVKGEYAQEARGLWEMEGDMMGGPFVSHARVDRANGRVIVVEAFIYSPDKLKRNLMRQMEASLYTL. 325
73 9.000e-87UniRef50_A0A1F3QVN5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_31_6 TaxID=1797363 RepID=A0A1F3QVN5_9BACT  ali  25  7FLILLAFLLISCDE------MNERVLPSCTGKSGDLLVVVDSSYYNNKTGNAIQAIFSQEQVGLPQREALFDIIQVPHRSFARMFQTMRNVIMVNIEPQ-----------------------GKIKLTVTKDVWASSQLVVTITAPSDTIAAETISKNAAALLAYFNDKELERLYKKYQPNAASKNAQLLTKNFKLSLHIDDLFFVAK----KTEDFVWLRKEMSVGSLGIIIYTYPYVSDSTF--------VVDNLVAKRNQYTKKYVKGGVDKSY-MASYVEYVPAQKEINFNGIYVNELRGLWYMQGDFMGGPYINYTLVDEQRNRVICLDGYVFAPKFDKREYLRELEALIKTI. 328
74 1.000e-86UniRef50_A0A2E8MVX9 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2E8MVX9_9RICK  ali  40  8.LIIIALALAGCNTD-AGEKLKKDFMPIARGENDEIILVIDSAQWKAGIGDELRKTYQQYMMLLPQDEYEFSVNKVNPRKLNDVFRHAKNMIFVMTLDSKTAESRAVREYFTDNSLKKIQQDSSIFYTVRRDEFAKGQIVLYLFGQDAETLERRIGDNRAALKSLFASAVRERTRDEILAKPKKETIAAIEENHPYSIQVPFGYDLAKNLP----NFIWLRKLDSQSEWNVFVYEGDYTDRGVFNKVD----------EFRDEITSTYLRDSEKPEIFIKRQPEVPVLTQRVTFKDMFAVESRGLWKISDSSGGGPYVSYTFVDEKTQKIYYIEGYVYSPPTKKKHLIREVEAILSTFE 350
75 1.000e-86UniRef50_A0A2E3SMG8 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2E3SMG8_9BACT  ali  23  12..LIAIILLGACSETKTT-------KPNSKGKTLEMMVVTNNNQWNGSIGRQIKEFFGQEQLGLPQVEPLFTFFHLPEDALLDMYKANRDILIVDINSSF----------------------QKGQIETRKDHWAAPQRVIKITAPDLESFTEVFEENKYRMLELYHDVERIRIQRAFKSVQNAKIKQALNKNFDINMVFPSNFKIAKM----DSTFIWLRNETLKDSQGVMIYIEDYTDMNQL--------DHRNILRKRNQITRRYIPGPSNGSYMKVADEFIQPVAKDISLNGLFAVEIRALWDVKNDFMGGPFLSYTLVDEERNRTITIDSYVYAPKDRKKILVKQLEAIAYTFE 328
76 1.000e-86UniRef50_A9DRX6 Uncharacterized protein n=4 Tax=Kordia TaxID=221065 RepID=A9DRX6_9FLAO  ali  23  7.LIFVLALFSSCGDKNDKDV-AERYKPQSAGKVNLLAVVIDNDQWKGKIGDSIRSIYGAPTDGLPMEEPLFSLKQINPEVFKDPITTYRSILIIESSD-------------------------EKKFRIKGDVYAKPQQIVYISGSD-DEIIAQLTENAAKSIKTLKDNELLSKQQFIKGALNKD--KSLEETFGISLNIPSVYKVVK----KEDNFVWFERKVSNGTMNIIAYTLPYGSIP------KNDTTIDAIIKMRDSIGEAYVPGRDPETMYMITEKAYAPFLFEATIDNKFAFETKGMWEVHGFQMAGPFINYVVDDKDHNRLMVIEGFAFAPSEDKRDFMFEIEAILKSLK 325
77 1.000e-86UniRef50_A0A2N2ZJP5 DUF4837 domain-containing protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2ZJP5_9BACT  ali  24  5FLFFVVIFIISCDKKTDK-DSNQKILPDSNGRISTLNVVLDNNLWEGAVGNAIRDSLAKPTEGLPQDEPVFNISHLPPKTFSGFTTKGRNILIA-------------------------QLGNDNQFSMQENVYAKPQKVVFVVGKTESDLIGLIRENSEKIIENFKSGDVVETIRRINKSLLGD--EGLKDSLRISLPIPTAYRFA----AKTKSFFWIRKTIQEGHMNIVAYELPYRDFSD------EQAVLNFVIKTRDSIGKERIPGPAEGSYL-ITEEAYSPFIKKDMVDGRKCWETKGTWEVKGDFMAGPYVSYLIDDKANKRLVVLEGFVFAPSALKRDNVFELESILRSVK 325
78 2.000e-86UniRef50_A0A1G9QFG4 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G9QFG4_9FLAO  ali  21  9.ILLFLVAIVSCKDENQKN-----YKPNSIGAINSLAVVMDTELWQGEVGDKIREHFAAPVMVLTQDEPLFTIEQMPKRVFTGTTRNRRLVLYV-------------------------QKDTLNVAHIKTDLYASPQKIGVIKGTTEKEIIENIDEKADEIITAFKELELEVSQKNFLKSLNKE--KALEEKFGISIDLPSIYRIDK----QQDNFVWIAREIQKGNMNIIAYSMPSDSF------KNDSTLVKDIVRMRDSIGQKYIPGPDVKGTYMRTEPAFSPAIFPVEIAGRKAVEVRGIWDVKNYPMAGPFISYIINDKENDRILVLEGFTFAPATNKRDDMFQLEAILKTVK 326
79 2.000e-86UniRef50_A0A137RKE3 Group I intron homing endonuclease n=26 Tax=Bacteroidetes TaxID=976 RepID=A0A137RKE3_9FLAO  ali  23  8.LLALIVAFSSCNSGGKK---DKSLVPNSVGNINALQIITPNDLWNGIVGEAIRNNFAAPTDGLPQDEPLFSMNQMSPESFTGFARSNRLFLYVVLSD-------------------------EDKVSITTDEYAKPQAGAIIKATSEEKLVELINKNAPQIIEKFQASEIKERQRRTAISLMKT--DSLKKAMGVTMQIPSAYRIAKA----TDSFFWMRKDLKDGTTNILVYQVP------LSMIDNDSTAVGDIIKIRDSVGSKLLPVEDDGQF--VTEDAYAPYLFTTKIDGKFAYETKGTWEVKDDWMGGPFVNYAVRDEKNNRYLILEGFTYAPAVSKRDLQFELESILKSAK 323
80 3.000e-86UniRef50_R5I469 Uncharacterized protein n=1 Tax=Alistipes sp. CAG:831 TaxID=1262698 RepID=R5I469_9BACT  ali  22  14..LMSILLLASCNSKPK---DREKYLPNITGNAGEVLVVINKGYWEGELGSTLREILAGEYPYLPQREAYFKLFNATPGGFTGSYLLHRNIVIVNVSPEVDTTG----------------------IRMSRNSWAKPQIIVTVSATTPEEASELISGNRELIINTIEQAERDRLIASSKKYEDKEVRMAVTENIGGSPYFPTGFTIKKNTPE----FMWISQETTYVNQGILIFKFPYTDAEQLSPEYLKDKIYN--------LWQANVPGMRENSY-MTFNKVIEPGFRNIEYQGNTMVEMRGLWEVENDYMGGPFVCHIFPDRNRENIIILNAFVYAPKYDKRKYLRQVESIIYSFD 332
81 4.000e-86UniRef50_UPI000381CCC7 DUF4837 family protein n=1 Tax=Bacteroides propionicifaciens TaxID=392838 RepID=UPI000381CCC7  ali  23  25.LMLLSIVFVSCKQGNKRG----PLTPTSSGLPYELLVVIDQKYVDSPLGEAVTEVLTSNVPGLPQPEAAFKLMYTDPQHFDGILKPIRNLVIVKVDKIYT----------------------EPRFNTASDVYAYPQSVVTIQGPTAESLAAYVTQNGASIVDYFTKAEMNRQITILEKNHSQQIASTVKEMFGSDVWVSGDLKSTKT----GENFFWAGTNEGTSERYFMVYSIPYVDDDSFTPEY--------MIHKRDSVLRVNVLGESEGSYMTTVAEVTEV--KPINVQDEYTLEARGLWRVVNDRMGGPFVAQMRLDKQNKRLIFVDTFVFAPEKMKRNLMRQMEASLYTL. 341
82 4.000e-86UniRef50_A0A2D8SK95 Uncharacterized protein n=1 Tax=Owenweeksia sp. TaxID=2024847 RepID=A0A2D8SK95_9FLAO  ali  26  8.LLFCSLWLVACNTDNEGGSIFKDVLPESNGGRMDLIVVAKESLWQSVAGDMFRKDFSSPQPALPQPEPEFTVRQIEPDQFNSLLQRSRNIVILEKGDFTYT--------------------------IQENFWARPQLVVTLAAEDENELAKLIQSKGPEVFKKLKDQEINALQERLGKAVHKNLP--ILETHHVSMAIPTSFEV----EIKQDNLMVLWNKTIKTDQGIIVYFKPMDPE--------MGALGMDIIPMRDSLTQLYVQSEREGAY-MVTEDLVTPTIENTEIDGSFAIETRGLWRTKNDFKGGPFINYTVYDEKHNQVIFLDGFVFSPETKKRNFVLEMESILKTLE 326
83 8.000e-86UniRef50_UPI000DBE3197 DUF4837 family protein n=1 Tax=Lutibacter sp. 1KV19 TaxID=2138210 RepID=UPI000DBE3197  ali  25  7.ILVTIVFFISCGDNSNNKKVYK----EANGRINNLLVVMKNSEWQGELGDVLRKIIAEPVVGLPQPESQFEVTQVPPDSFGSMFRATRSVLSVGI-------------------------GEKTSFNVQTNVYAAPQKIITIIGKTKEDLIKEIEKNSKKIVSIFKEADIKSVQNKTLKQYLDPTKIETFKKQGYSFKIPKTYRKV----EDNGDFIWYRYHLNDNSMELISYTVPITSEDDENGN--------NIVAIRDAMGKKYIPGQLEGSYLM-TEEAYSPHVFEVQLDGKKAFETRGKWEVKNVFMAGPFLSYTVVDKPNNRLVIVEGLTYAPSINKRDYMFELEAILKTL. 322
84 8.000e-86UniRef50_R6VI17 Uncharacterized protein n=25 Tax=root TaxID=1 RepID=R6VI17_9BACT  ali  22  16.......MLSGC----KAFHTLTDAKKDAQGRPYELIVVCPQQEWTGEMGDSLRSILTAPVPYLNQTEPLFDVLRVTESSYTGMIADHRNILRIVVDPSLEQAATGV----------------------EYDLTASPQIVLTLQGPDDRSIVDYLSANRDKLVQVLEKAERDRSIEANNKFYNPGIRDAVERIFGVDMKVPKGYVLAK----QEEDFLWARYEYPTASQGFFVYSYPYEGPESLTPEA--------LVAARNRFAAR-IPGPSDGSY-MTTSDAFAPGYRMFRLEGRLWCELRGFWDVKGDFMGGPFVSYTTVDTENNRVFTLDCYVYAPDLNKRNYVRGVEHLLYTV. 329
85 1.000e-85UniRef50_A0A0M4H2Y1 Endonuclease n=39 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0M4H2Y1_9FLAO  ali  24  9..IACSLLLLGCNNSNNK--NGETYLPSSVGQINTLAVVIDNDLWEGAVGDTIRRYFAAPIDGLPTEEPIFSLHQVPPQVFEGNTRNSRNVLIVH-------------------------RGNKNEATISDDVYAKPQVVCEVQGKQVRDIACKVEEFHDQFILAFKNNDLKETRHRFNNALSKD--KQVEQTLGFKFVMPAVYQVRKY----GDNFFWIERPIKGGRASIILYEMPLGSIPADEEGRAKT-----IVKMRDSIGKKYIPGPKEGMY-MVTETYLAPSISEMKIKGRKTIESKGLWEVKDFALGGPYINYIIEDKAHNRLVVAEGFLYAPGVAKRDMLFELEAIIKSIE 326
86 3.000e-85UniRef50_A0A1G6R2D1 Uncharacterized protein n=1 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6R2D1_9BACT  ali  23  6WLLALALLVT--IGGCKEGKKGKNLLPNPLGAAGDILVVLEKSGDVDTLWSSIQNVLAEEYPFLPQPEPRFNLVKLPPKFFKGV-QAYRNILLLKVDKAIYP---------------------EAKMLLRYDAWSSPQVIVTLVGPSPKALSTYILKEREKIVALFEQAERDRQIATNNRLPDLKIQLLLKQKFGISLAMPSGYKVNR----KADDFIWISYETPFTSHGIMVYTYPYKSDSTFTKK--------NLINKRDFYTKKYIPGPSKGSY-MITGHFYEPQVTPTMFKERYYAILRGLWEVKNDYMGGPFISFTTLDEANNRIITIEGYVYAPKDEKRNYLRQVESILYSFK 328
87 3.000e-85UniRef50_A0A2G5L7A4 Uncharacterized protein n=3 Tax=Reichenbachiella TaxID=156993 RepID=A0A2G5L7A4_9BACT  ali  39  17........VVSCSDSKSTKQSDKTYLPKAAGEPNALLVVMDTTDWHTEIGGALRDVYSVYVPGLPQDEPYFKMRNINPLKFNSIIKRASNLIFVHTLDNSGRQSRQMEKYYSEESLSKIAQDSSLFMLPQKNAYAQGQDVLHLFGQTKEQLIAHIKANESMLRNHFVKVENDRMARKLFKVREKKIEQRLEEEYDFTMNIPYGFEVAKAL----KNFVWIRLLDTESEKDLFVYFQPFDSQDPF----------DDVLDFRETITSTYMRDIEKPELYMTLQDTLSV-IKEVNFKGKYGKEARGLWKNSDISAGGPFISYVFVDENQKRLYYLEGYVYQPGDDKRVPMQEMEIILQTF. 355
88 3.000e-85UniRef50_A0A258EXA4 DUF4837 domain-containing protein n=2 Tax=Algoriphagus TaxID=246875 RepID=A0A258EXA4_9BACT  ali  29  6FLLILALGIASCSQETKDRMNSS--KPKARGSIGEIVLVIDSTKWAGPVGEELRDIFQADLPGMFRSEPMFRLHRVDPRAMTRMLKMYTNLIYVTTFDDRSGGSQVINAQFSKESKEKAAADPGLYSLRMEDEYARGQEVLYLFGNTEEELVQNLKKNGDRLQNLFEVRERGRLEKALLARKNAAAQNEARKNLGIEINPPVSYQIAKS----EEDFLWLRQPSPRPDISLFFYQTDYTSEEQTFPE--------NILKLRDSIAAEHIFGPEDPTSFVTSEKQIPPAFRNMVINDNFTVEIRGTWKTNNISMGGTFVGYLMVDQKKGKLYYMEGFVYYPNEVHRDALREIQTIL.... 352
89 6.000e-85UniRef50_E4TL31 Uncharacterized protein n=1 Tax=Marivirga tractuosa (strain ATCC 23168 / DSM 4126 / NBRC 15989 / NCIMB 1408 / VKM B-1430 / H-43) TaxI  ali  33  13.LFISSFFVISCDDKGKDGDENQSTLQKARGETGEVIMVIPPSLWDGELGNLLREVFTSNVKVLPQDEKLYDLKPVDPSKFNSVFKASQNLIFVATLDNKKPEGKYMKRYFTENSLNQIEQNPKLFSFNQQDVYARGQEVLYLFGRNEEELINNIKENKSGIKEFFNDKEAERLVSSFKKTAQKGIMNYIEDSLDLELIVPVGFDVAQKS----NDFIWLRELDSKEEYNIWLVKMPYNDESVFNPDK--------IKSFRDSLGRKYITDKDIPDLHLTSQDEIDFEIDTINLNNQYALRIKGLWKYSDNSRGGAFVSYLFANEDSGDLYYLEGYLDAPGESKREPMRRLKAILSTAK 361
90 7.000e-85UniRef50_A0A1I7ETJ8 Uncharacterized protein n=2 Tax=Pustulibacterium marinum TaxID=1224947 RepID=A0A1I7ETJ8_9FLAO  ali  20  2....ALFVLQACETTKEK-----DYRPPSIGTMNSISVVINNAMWNGKVGDKIRELFARPVDGLATEEPIFSLNQLPPSVFTGNTRIGRNVLII-------------------------QNSEENVARISEDLYATPQQVAVVKGSSEDEIIKLLDQNAEAMIKNFKEHELLEQQSRMRSSKIKE--KELLDEFGITLKLPIVYRI----TTQKDKFFWIKRQIQKYEGGLLVYEVPYNSIP------KDSTLSDALVKMKDSIGKANIPGRDPDRMWMVTEKAFAPSITHTTIDNRPAIESKGLWEMKNFLMGGPYVNYLIEDKPNNRYIVLEGFVFAPSIDKRDYMFELEAIAKSIK 314
91 8.000e-85UniRef50_A0A1V5S4T0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin302 TaxID=1852811 RepID=A0A1V5S4T0_9BACT  ali  26  8.FLSVLISFTACN--------YISLKPNSTGAANEILVVIDDSIKNSAVGDSLFAILNQDVPGLNQSEPYFNISLTSTKNFASILKPARNIIIVSINNTYSR----------------------SKISHYKDQWSKPQSILKINGFDIADVANTISKYEDEILQYFIKAERERSISYQTRYSERDAMKKVKDKFGFSIVLPKGMNRFKN----EDNFMWIANSSREVNQNIVIYTYPYTENDAFTREK--------ILHKRDSVMMLWIPGPSPDSYMGTEYRYNPPIARETSLNGNYAMEVRGLWTAIGDIMGGPFVSISCLDEKNQQVVTAEAFVYAPNKYKRNIMRQLEAILYTI. 323
92 9.000e-85UniRef50_A0A2H3NQS4 DUF4837 domain-containing protein n=23 Tax=Bacteria TaxID=2 RepID=A0A2H3NQS4_9BACT  ali  24  18.......VFTGCEG-----AFEGDYRPRATGPEGEIMVVIDSTHWNAELGDAVRQHIGPYVETLPTPERSFDLQQVNSDRMFDIVQRHKNVVFAAPLNDDTPVSNFLRSRLSDDVLQATL-DGTPVVVPRNDLWRRSQRVYYMTAANSEQLAQAIEERGPEIRDTFHKVTLDRMREMFEKERQYDLEDTLMQHHGFAVNVQHDYQIAIDTTTENRGFIWLRRVLTDTRRELFVHYVDGMAPSDITPE--------WIYATRDSLTEKYLRGNVAG--FVRTDYRRPLNTEETEFLDRYAYITRGLWHFEGDGGGGPFVNYTFYDQETGRVYMINGAVFAPEHGKRDFLRQMEVIARTF. 365
93 9.000e-85UniRef50_A0A2D0N3S0 Uncharacterized protein n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0N3S0_9BACT  ali  25  14.LLGVVLGFASCSEDMRQGLRP---VPTAYGRINQLVVVADQDVWESRIGDSIRYYYGAAYPILPQPEPIFDIVHFTPYDMEAQLRELRTYLIVANLDEESPTSQMIRQDLGTEKVRRSQEDESYNVTIGRDKWAKGQLLAYQFGWTEDKLIDNIKANFPAIYKRIEQRERDRIATIFFQGQNPKIQDEVRSKMGADIKIPSDYFVAIS----DDEVIWLRKETDDLSSNLLIHKLAYSNEKQLSKEG--------IKAIRDSLGRKYISSTLPNTYMRVNDIDLPMLTEVKTIHNQYALEARGIWEIENDFMGGAFVSYLIHNPNKNELLFIDGFVHAPGKEKRDFMEHLEYIMSTTE 360
94 1.000e-84UniRef50_A0A1F3PPU8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFOXYA12_FULL_38_20 TaxID=1797368 RepID=A0A1F3PPU8_9BACT  ali  25  25...............QSCADTGDSWLPMMQGRPGEVVLVINSALYSGPIGTEFQKILKSPQVGLPQPEPLFDISVLPPGAVTDVIKQQRNLILVNVGSEV----------------------KKTEIVIKNDVWAKKQLVITVSAPNQEKMVALLKESGQKIVDIINSTERKRIIDSYKSLQDNSIDKRLRKKHNISLVIPGGF----NYYHDTTNFAWITRDPHDIRQVILVYYYDYAGPDAFKLD--------SLIKMRDEILQKYLLGPRDGSY-MSTEKREPCYLKEFNMDGKYTAELRGRWMLVNDFMGGPFMSLSRVDEKRNRVVTVEAHVYAPQFDKREYLRQIEAIVYSMK 334
95 2.000e-84UniRef50_A0A136M352 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium OLB12 TaxID=1619897 RepID=A0A136M352_9BACT  ali  31  11FPLLLIVIVFSCTEPGSEN------LPPSTGRTGDIFLIMDSVQWKGPLGRTLDSIFRAEMEGLPREEAIFHMRWIDPRKLNFVLRQRRNLIFAVTFDQNTIGARKIRNTFTSASLEKIDADPNLFSQNARDVFAKNQEVLFLFAQTEQQLIDHVRANKARLVEYFNLRERERLTSTLFKGAQKGIESILKKEFTCELKIPFGYQLAQ----QESDFFWLRQINPYDDKDIFIARKKYTSQTQF--------QKDSLIAFRDAICKKYFEDPERSDTHLLTETSVPVLFREINFHNKFAVEMKGLWRTNNLTMGGPFISFTFVDEPLGMLYYIEGFTFSPGKDQREIMRELETILYTF. 355
96 2.000e-84UniRef50_A0A2T1NMQ3 DUF4837 domain-containing protein n=9 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2T1NMQ3_9FLAO  ali  24  7.LAALVFVAFACNNKEKG---NQRYIPDSSGNLNNLSVVIDSDLWKGKVGDAIRDVVTANVPGLPQNEPMFDINQIPPQVFKDFATKNRTVL-------------------------KIAKGKDAGLKIANNVYAKPQKVVYITGQNNNQILEILNANKDKIISAFKTQEINWRQSQISKSVLNTGD--LEKNLGITINFPSIYRMAK----QEKNFYWIRKNLSTGTNNVMIYTLPFDSIDTNA------DIIEQAVKFRDSIGKKYIPGPLDNTY-MKTEEAYSPFLFTTTIDDKPAFEVRSTWDIEGTFNAGPFVNYMIEDKANNRYVVAEGFTFAPSVNKRDFVMELEAIINSIK 323
97 2.000e-84UniRef50_A0A2T4X8C6 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2T4X8C6_9BACT  ali  24  20WLVVIVLALSGCNSEGLQKSMEAE--RNAFGKINQVNVLCDQALWDGPLGDSLRYYYGAAYPILPQPEPIFDLRHLTLEQLRQLRKELRTYLIVGDLDEQSETSALIRQDVGKEKIRTLAAENGYGNSVAKNKWARGQTLVYLYGLTEAKLLKNITSSFPAVAKRLHQAERLIEATTYFSGEDLTLSEEVRAKMGVSIRLPEAFYTALA----DEKVMWLRRETSEISANILITKVPYTDQSQLTREG--------IKAIRNEIGKEYVSSSIANTYMRINDVDLPLFVETTRINGDYALEARGIWDIVNDFMGGAFVSYLIYDPAKPDLLFIDAFVHAPGKEKRDLMQEMEYILHTAK 368
98 2.000e-84UniRef50_A0A1X7K016 Uncharacterized protein n=2 Tax=Marivirga sericea TaxID=1028 RepID=A0A1X7K016_9BACT  ali  32  13.FICVSIFSVSCEDERKGGDQAKDSLQQARGESGEVILVIPPSLWESELGNLLREVFTSNVKVLPQDERLYDLKPVDPSKFNSIFKASQNLMFVATLDNQKPEGKYMKRYFTENSLNQIEKNPSLFSFNQEDVYAKGQEVLYLFGRNEEELIKNIQENRSGIKEFFNDKEAERLVSSFKKSAQKGIMNYIQDSLNLELVVPYGYEIA----VKEDNFLWLRELDSKEEYNLWIVKMPYKDESVFNPE--------NIKELRNSLGERYITDKDVADLHLTSQDEKEFVIDTINLNSQYALQIKGLWKYSDNSRGGAFVSYLFANEEAGDLYYVEGYLDAPGEAKREPMRRLKAILGTAK 361
99 3.000e-84UniRef50_A0A0P0F8A6 DUF4837 domain-containing protein n=82 Tax=root TaxID=1 RepID=A0A0P0F8A6_BACT4  ali  25  12...LVAFVVASCGLKGNHT---------SSGRPYELLVVVDAGVWDRAAGRALHDVLDSDMPGLPQSEPSFRIMYTSPKDYDSTLKLIRNIVIVDIKDIYTKGT----------------------FKYAKDVYASPQMILTIQAPNEEVFEKFVEENKQTIIDFFTRAEMNRQITLLEEKHNNFISNKVDSLFGCDIWIPSE----LNNSKTGEDFFWASTNTGSADRNFVMYSYPYTDKDTFTKEY--------FVHKRDSVMKANIPGYKEGVYMST--DSLLTDVRPINVHNDYTMEARGLWRMKGDFMGGPFVSHTRLDQKNQRIITAEIFVYSPDKMKRNLVRQMEASLYTLK 322
100 5.000e-84UniRef50_A0A2E2TS05 Uncharacterized protein n=3 Tax=unclassified Flammeovirgaceae TaxID=340671 RepID=A0A2E2TS05_9BACT  ali  36  8FIFSTIWFLVFCGETQDKI--AQEFMPTAKGEIGSIMLVMDQQQWDHDLGIQLRGILREPMPGLPQDEPFFHLNRVSPKKLNSTLKSSANMIFVVTLDSKTSESNVLKGFLTSESLRMIKLDTSLYMSIRKDEFAKGQIILYLFGNTEKDLSQKLKKNKERIQSLFEKRVRDRTVRKLFKSHEKSLEQVVQEAHSFQIRIPLGWQQAANEP----GFYWMRYLNGSKEQNVFVYYEPYTNIEIF----------DQVPEFRDRITKQFLRDSEKNNLFITRDDLNTVFLKKTQFKGRYAVESRGLWKINDNSLGGPYISYTFVSEKQKLIYYIEGFVAAPGKKKRTLLQEVDAILSTFK 353
101 5.000e-84UniRef50_UPI0009D6D0D7 DUF4837 family protein n=1 Tax=Eisenibacter elegans TaxID=997 RepID=UPI0009D6D0D7  ali  29  59..LCLAGVLSSCKRNEQNREKNTLSI-ESRGGFHEIVVVADSLTWTGRPGEALREALYDIIPGLPQPENRFKLIHIYPSALQSFLKLHHNVLFLTSFDNKSTENRRNLARLKPETIEAAKKDPTQFMSLSKNLYANGQQALFVYSPTQEQLANNIRQYQNRLRQHFHDLERERVTKMYSAQENKKLGKFITNHHPFALRVPMAYKLVKN----EENFIWLRFLEQRVDKSIFIVRLPYNNPKVFELE--------QFVSLRDSLGFQYFNDILPDSYIITENDNMEVEATKLNFNGLYAVEYRGLWLLKNQSRGGPFLGYLMVDKSNKELYYIEGFIDAPGEDKRAHIVELETIIRTF. 406
102 5.000e-84UniRef50_A0A2N2YSA6 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2YSA6_9BACT  ali  23  15.LFVFVLVFSGCIPNSDKPK-----LPRSIGNSSEVLVVLNQEQWDGQIGQVIRKYLEQEQYGLPQVEPVFKLSHITVANFSELFKKYRNLLIVEIDPSIT----------------------ESKMEVFNDLWAGPQRIFRIKCSNLQAFVEVFEKKEQIIMHSFGEAERARIMEVFNPTSKNNVSEEVIKAFNFNMSVPAGFYLAKS----ASGFMWIRKEVPAYSQGIIIMSEPYVSEAQFS--------IESIVARINRDLKQYVPGTSEGSFMMIDETYVLPKIQVTDFPSEYAIETRGMWNVANDFMGGPFISYSFTDKENENIFTLMGYVYYPNQNKRDLLRQVEAILYS.. 333
103 9.000e-84UniRef50_A0A098BXW6 Uncharacterized protein n=3 Tax=Porphyromonadaceae TaxID=171551 RepID=A0A098BXW6_9PORP  ali  27  10.LLASIIFLSSCNGGSGFF--------SASGATNEVMVIMDDSSWEGTSGRALFDVLNSNTKGLPQPEPNFRILHITPENFTSTFKMARNIIIPVISEMYS----------------------QPKLEAELDTYANGQVIMNIKAPDSISFAEYVTENKDVIVNYFIEKELERNAK-WLKSEIKIPVVRAQQMFGINIHFPKG----LSNYEEFNNFLWATNNAGRGRQDIVIYQFPYTSETIFEKD--------SLIKVRNEVLGKYIKGSFDS--QMSTSTAYPPDYRRFVVDGVFRAELRGLWEMTTDMMGGPFVMHAFVNENTGMVIVVETYVYAPESNKRNLMRNLEATLYTI. 321
104 1.000e-83UniRef50_A0A1I6PK83 Uncharacterized protein n=3 Tax=Lutibacter TaxID=358023 RepID=A0A1I6PK83_9FLAO  ali  28  7.FVVFISLLIACN-----PANDKKVLKEANGRINSLLVVVKNSAWQGDLGNELRKILAEPVLALPQPESQFEVSQVPFESFGSMFRATRNVLSINLGDENS-------------------------FTISTDVYASPQKIITITGKTDEDLINLIKTNSKKIISEFKTSDLATVQRNILKKYWDPENIKTFKKQGYSIKIPRNYNLV----DDTGDFVWYRYHDGANSMEIITYSYPIENENDENGNA--------IVAHRDSIGKKYIPGQVENS-HMITEEAFTPHIFEVKIDGKKAFETRGKWEVKGMYMAGPFLSYSVIDKANNRVVVVEGLTYAPSVNKRDYMFEIEAILKTLK 322
105 1.000e-83UniRef50_R7J944 Uncharacterized protein n=1 Tax=Parabacteroides sp. CAG:409 TaxID=1262913 RepID=R7J944_9BACT  ali  24  47.........ASCNSGS--------IVKRATGVPYEVLVVMDTNLWKGQVGEAVRDKLQESYPALPQAEPTAAVSYCEPASFNDFMRYVRNILLVDVNPSAYT---------------------KVSLVADKDVWSSEQQVMRLQSPSTDSLLWYLQGNTNDILAYIRQMEQKRYAQYLQENHNSLLAEKTRSAFQLDIYAPEEM----NSSQTDSTFLWFSNNANSGRMDLIFYAFPAENADELEESH--------LIAMRDSVSRLHIPGSFEGSY-MTTENRFPVEYESLQNGKQPSAVIRGLWKMQGDMMGGPFVSYAWYDAPRHRIVVAEGFVYAPETNKKLYMHRLESALLT.. 352
106 1.000e-83UniRef50_A0A2H1XPP7 Uncharacterized protein n=55 Tax=Bacteria TaxID=2 RepID=A0A2H1XPP7_9FLAO  ali  24  7.LLFLVIFATSCNTTTGK---DGYTLPTSNGNTNKIMVVVKALDWEGKIGNKIRTVFGEHQVGLPQPETLLSVSQIDPSGFSSFMRHSKAVLII-------------------------KQGEKETITVEKNRYAKPQIIVHATAKNKEGVLNMLDKRGKEIIKLFKDEDIEFTQKIFKKERIDETGFKTIKNIGFTIDIPKRFKLV----EDSGDFIWFRQHRGDGTNNVLIYTIPLGDE---------NKVADNITAVRDTIGKKHIPGSKKGMY-MITEQAYTPFTFDAIIDGKKAYETRGKWEVKNDFMAGPFINYTIIDKKNNRLVVFEGFTYAPSVNKRDFLFELEAIAKSMK 328
107 2.000e-83UniRef50_A0A1J5AUW9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium CG2_30_33_31 TaxID=1805033 RepID=A0A1J5AUW9_9BACT  ali  25  6HILIISLLIAGASACNNKSKNNKNFLFTSAGKTSEALVVIDNDLWKSSVGDTIKSYLSESEPWLVQSEPYFDLDHIPENIFKDLYTKYRNILIVKIRNDF----------------------EKSSMRVVNNVYAKPQTIIEIRSKNTSDFYDFFAENNKKINELFRKNELERLKNVFYGIRTDSLSTEIQKRFGFKMTFPRGYYLA----ADTAGFAWLRRVDADVEEGVFIYIKPYTDTMAFA--------VKNIIAHRDSITKAYIPGPVNGSY-MKTSSVFPAYYENVDFKGNYSTLLRSWWDVEGYAMGGPFISYTFVDTISNKIITLDGYIKAPKKDKRDILLHLEAIFDSFE 329
108 2.000e-83UniRef50_A0A0B0BYL4 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A0B0BYL4_9BACT  ali  21  22..........SCKSQGGTGDFN-----NAGGKPYEIVVSIDQELWNGEVGDTLRSILLEPVPMFNQVEPQFDISRVNPGALKDLILRHRNILIIQLNP----------------------QTAEPSSVARYDVYARPQIIVTLTAPDTNGMVRYLSENRQELQQLFEISERNRAVENNRKYGEKGIDREIRSLFGIDMNIPRGFSI---KGRSGEDFLWVGNDVRTATQGLVLYSYPYAGAEDFAPE--------NLIKRRNEFTGR-IPGPSEGSF-MATEDYIRPEVEYIRIDGKLWARMSGFWYVENDYMGGPFINYSTIDPATGRVFSADCFVYSPKDPKRNMMRQLEHIVYTV. 329
109 2.000e-83UniRef50_A0A2E4HCX1 DUF4837 domain-containing protein n=1 Tax=Cytophagaceae bacterium TaxID=2026729 RepID=A0A2E4HCX1_9BACT  ali  24  10..LLTAFMLFSCGEKKNTAPEKRKVTTFSNGRINTINVVMESDQWKGEVGDSLRAVLASPTLGLPTDEPLFSIKQLSEQTFTGFQREKRLILEVRQSDTTG-------------------------VAFKKNVYAIPQTVVVVSGPDDAAVAKALSENEAQIVATLKAQELNERQRQISKNLQRT--DSLEKVMGVSLKFPTAYRYA----AQTEDFFWMTKDLKIGEMNIMVYEVP------LYAIDKDTNTIARIVRMRDSVGSRKIP---VDGGKFITQTDFSPYLQKTTLDGLPAWETRGLWEVDKQSMGGPFVNFAIKDEKRNRYLVLEGFIHSPSLDKRDNMLELDAILKTAK 326
110 3.000e-83UniRef50_A0A2E7FG25 DUF4837 domain-containing protein n=10 Tax=Bacteria TaxID=2 RepID=A0A2E7FG25_9FLAO  ali  21  8..LVLLLITISCQNKNSA-----PLVLSSNGNINTITVVMTDQLWAGTIGQAVRDMYAYPAEGLPQQEPLFDLKQIPPEVFTGFAQSSRSVLWVGIRDQTN-------------------------IRIDKNTYAQPQTVAVFTAPTPTALTEIIISQSDEVIKTLRTQERAERLRRIRKS--TYANHGLDKKFGFTLTMPSAYKTLK----ENETTSWFQREIQKGHINLLVTTTPYDEDIVF------NQNLEKIIAQHDSIGKAFIPGRLPNS-HLITEKAYEPYIYNTTFGKKPALEIRGTWEVQGDFMAGPFLQYIINDKPNNRNILLEGFVFAPSTAKRDYVFEIETVLRSLQ 321
111 3.000e-83UniRef50_UPI0008D94700 DUF4837 family protein n=2 Tax=Rikenellaceae TaxID=171550 RepID=UPI0008D94700  ali  20  8WLTAIVLLLTSCDSG--------LVKVSSTGKPYEMFIVTPNEVWESAAGDTARAYFTSDVEMINQPEPRFTVYSVPPASYKATVRKHRNILILKTGSQYS----------------------QSDMTASYDVHSAPQLEVTITSPSTDSLAAFLHTYGEDLVRLYEITERNRSIARAQKYRNAEVSDLIEKKFGLRMSIPNGYTV----RIDTTNFLWVSYELPLASVGFILYTYPADSSAAL------NMAAGNIIAARNAAVMQ-VPGPSDGSY-MTTSTAAMPDQKILTIDGRQWAQVRGFWDVKGDFMGGPFINYTTYDSINNRIQAIDGYVYSPSVPMRDYVRQVEAIFRT.. 326
112 3.000e-83UniRef50_A0A1L7EC24 Endonuclease n=15 Tax=Flavobacteriia TaxID=117743 RepID=A0A1L7EC24_CELLY  ali  24  8.VFVTCLAVTSCKDGAST---KQDFTPASIGQVNSLTVVMSNELWEGKVGDNVRDQFAKSVVGIAWNEPIFTLRHLPETVFTGAVRKSRSILVVQKKDTTSLS------------------------YINKNTYSRPQNVAVIVAPTEDELIETINKNADHIISEFNKTDLQVTQGNFKRSLLQDTS--IEDMFGVTMDIPSVYSIGKV----EDNFIWLDRDIKNGTMNLIVYALPWDSFS------NNATFISDIVSKRDSIGKKYIPGPNEGTY-MDTEKAFAPSVFPAEIGGKKAAEIRGRWEIYNYSMAGPYVSYIINDKENNRKLVVEGFTFAPAAVKRDFMFELEAIIKTLK 325
113 3.000e-83UniRef50_A0A180EH58 Uncharacterized protein n=2 Tax=Lewinella TaxID=70994 RepID=A0A180EH58_9BACT  ali  27  18........VSSCAGDNAFTSRLNPI-PGAFGSINSVTVVADSSLWLNGASDSIAYFLEAPYIILPQPEPIFDVRFIEPEKLSAVFRELRNVVLADISDKNSPTTKMVVKDLSDAKIQQVKEEGFSTV-VARNKWATGQQLIYLMGKNREELLRGMSSTRAAVVKRIADSENLRMKEAFFQGVDKALMDTISQRTGARIRVPYGYELV---PVRSDDFVWFKRGTRKGSMNIMVTKVPYENQEQLSKEG--------LKTIRDQIGKRYVSSSLADTYMRVNDKDLPLFTETTDLNGAFAIEGRGIWEMENDFQGGPFISYLINDEANRQLVLVDGFILAPGEKKRDLMGELEQILATTK 359
114 4.000e-83UniRef50_A0A1F3MBX3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_49_14 TaxID=1797354 RepID=A0A1F3MBX3_9BACT  ali  23  11.VIVAITAISGCKNSNQLG------LPPCNGKPGEVVLVISEDLYNGAAGDTLARILATDEPALPQAEPLFDLIQIPPSAFNNMIRPARNLIIFEVDPAV----------------------AKPEIKVFRDYWAADQLLIRIFAQNREQLINLLDQSRSSLVEILRESEIDRQVGFNRKYSNIELSSQLIRKHEIEASFPKGFDIRK----DTEDFIWIHYDPADMTLGVLIWTYPYTDQKQLNYPE--------LVSFTDKHLKPRVPGPSTGSY-MAIDLTIPVLTRTFTLNGNFVTELRGLWETVGDFMGGPFISWTYVDEERNRLVTAFGYVYAPKINKRNQVRKVESILKTID 332
115 5.000e-83UniRef50_A0A2A4RRD0 DUF4837 domain-containing protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2A4RRD0_9FLAO  ali  28  7.LFAVSMLLFSCAPKEKRLT-----LVDSNGLMNQVLVVMDYDSWKGVEGQAVKNVINERVVGLPQKEPHLDAIQIPTNAFKNLFLSQKSILHVSIGD-------------------------KNEFTVRTDVYARPQKIITITATDSESLIKEINNRKDEILTTFRDFDIKATQYRLLKKQFNTKKSATLYKLGISMQIPSKYRMV----DDTGDFLWLRQHLHEGSMNLLIYELPINSVEDEEGK--------NINSVRDTIGKKFIPGQFEGSYY-ITEQAFTPITNTIEMAGLKTYETRGKWEVKNDFMAGPFLNYTLVDKVNNRLIVLEGFAYAPAVNKRNYMFEIEAVLKTLK 322
116 7.000e-83UniRef50_A0A1Q3GX67 Uncharacterized protein n=1 Tax=marine bacterium AO1-C TaxID=1905359 RepID=A0A1Q3GX67_9BACT  ali  29  12.ILGFVFLLSACGGDSNKSKSRKTKMIKSKGGFAEIVVIMDPRKKNAPLGEALKDIFSKNIPALSPPESWFKLLTVPPSKLSGSLKRHHNIIFITSLDNNTTEGRYLKGYFTKKSIEMIKNDPKKFMLRRRDVYAEGQRIMYLFGNTEEQLIENIRAKKDILLNYFHDREQQRITEKLYISEQAKLSKYVEKVVKLKMRIPAGFGLAK----KEKNFVWLRKRGNPSDISLIITSRPYTSAKVFE--------EANILAWRDTLGKHFVNDPEREGSYVTTQKVFDPILKQITIDKKFAVEYRGFWKLANGSRGGPFLSYAFVDEAQKRVFYIEGFIYAPGMRKKKAIFRTEAILRTFE 370
117 7.000e-83UniRef50_A0A2G5GFG9 DUF4837 domain-containing protein n=13 Tax=Bacteria TaxID=2 RepID=A0A2G5GFG9_9FLAO  ali  25  16..........ACGDKKSS---NQRILFDSSGIVNNISVVVSNDLWNGSIGETIRNVLSTPIYGLPQDEPMFKINQIPSSVFSGFVTKNRTIL-------------------------KIELGKESAFKIAKNVYAQPQKVIVVSGKTKSDVIELLKENAEKITNEFNNTELTEKQRLINKSLYN--AKDIQESLGLNINFPTAYRIAKTTATKEDKFFWIKKDFKSGDLNVLLYQVP------LNTINRDSTLVSQIIKIRDSIGKRFVEGAVEGSY-MATEDAYTPFNSETILDNKPALETKGLWDLKGGFMAGPFVNYAIEDKINNRWIIAEGFVFAPSVEKRAYMFELEAIIKSIK 333
118 7.000e-83UniRef50_A0A1B1Y8R7 Uncharacterized protein n=2 Tax=Wenyingzhuangia TaxID=1518147 RepID=A0A1B1Y8R7_9FLAO  ali  24  5FTLFTFLLIVACGGKEGKKSNNDYMKPGSTGRINHVIVVVEPEVWKGEAGKALREVIQQPIAGLPQTEYQFGVSTIPGSAFTKMFKNSRNLLFLQLAD-------------------------KEVFQSSSDKYAQPQTILEVKAPTTEELVTLIHEKANEIVNTFKDEDLKSVQEEFQKNKRSQKINAL-EKLGVSMDIPNKYRTVIDTLGS---FMWMRSHISDQTNNIIAYQVSLFDEN--------KPFLEQMIKNRDSIGKMYIRGNDVDKMYMITEAARKPSVKITTIDGKKAYESRGTWEVFGAFSAGPFLNYSIIDEKNNRVLVIEGFNYAPSVNKRDFVFELEAILKTIK 332
119 8.000e-83UniRef50_A0A2A5GXF4 DUF4837 domain-containing protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2A5GXF4_9FLAO  ali  23  9.VLLTTIVFTSCKNKNQKE-----YKPSSTGAINSLTVVMDNDLWKGPAGDKIREHFAAPLAGMIWDEPAFSINQIPKSVFSGAIRTTRSLLIVEID-------------------------TLSVAHIKTNLYARPQKTGVFKGRDVDELIQNIEKKYAEAITSFKTVEX--XXXXXXXXXXXXXXXXXXXXFGISMSIPSAYKV----GSEEDNFVWLDRQIPKGHMNIIVYSMPEDSFG------ADSTLVKDIVRMRDSIGEKYIPGNVPGKSYMITEKSFAPSIFPVQIAGKKAFEARGIWEVKNDFMAGPFITYIINDDVHKRKLVIEGFTFAPATAKRDYMFELEAILKTLK 325
120 9.000e-83UniRef50_A0A2E8WZ41 Uncharacterized protein n=12 Tax=cellular organisms TaxID=131567 RepID=A0A2E8WZ41_9FLAO  ali  22  21......FAVASCAGD-----AARVALPGKVGAAGELVVVADLEVWNSDAGDTLQAVMAQPYPVLPQYEPLMDVVHLEPELFDRFWKPHRNILVLEVADRIDT--------------------QEPNFTFYRNKYSRGQVYMVAKARSAEALAEVVAARAGEMVSLLHAEEAKRFADIVALSPNEVIAREVAGKWGLQGLWPKDARVAK----KTEEFWWVDRDNHDIQQGFFIHSXPYTSPDQLSLEH--------VLNRRDAXTKSHVPGPTPGS-HMATERRFXPSYEEVEFDGHFALEVRGLWKMENDFMGGPFYSLTIVDEARGRLLTVEGYAYAPYFDKRPYIREVEGVVR... 340
121 1.000e-82UniRef50_A0A132GW11 Uncharacterized protein n=1 Tax=bacterium P201 TaxID=1768112 RepID=A0A132GW11_9BACT  ali  21  10.VILIAAVMTSCTQTRSGR------KDRSVGGTSEILVVTNDEQWKGRIGDSIRHFFLDYQYGLPQPESRNDLAHINAEGFSDLFQKHKNIIEVVIDPSK----------------------EKAVAETAEDMWAAPQRYVKITAPDLGSWVELFDKQKEVYKQWFDKVERERILNVFRPTKDEAIENAIAKKFGFTLTVPQGFYIAK----DEPDFMWLRKEQERSSADIVIYQTPYRDTMQFETN--------SLIAMRNMMLGQYIPGPSEGSYMGTTEFVPPLVTQVKDFPAGFAEEMRGMWKVENDFMGGPFVSYTFVNA--DKLATVEGFYYEPNQKKRNMMLQLESIAYSLK 327
122 1.000e-82UniRef50_UPI00047EC3A4 DUF4837 family protein n=1 Tax=Alkaliflexus imshenetskii TaxID=286730 RepID=UPI00047EC3A4  ali  21  18.VLVLIAAFAGCKSEG--------YKPNMTGAMGELLVVMDDRWRNGPEGEAIQAVLRQPMEGLPQAEPIFNLSITPHRAFSGSMRTFRNLLITRIDDEV---------------------ENEGVRFFSESNWAKGQALAQINARTPEKFLELLDKEELRLIGFFLRAERQRSLDYYKQYANAQLVNNVQSQWNMRMTIPTTFTSNKS----TESFSWMSDETPTTSQGLFIYSFDYVGEGTLSREY--------LLNKRDSVLRANVPGPSQGSF-MSTEHTIPITYKRLKVNEHDAVELRGLWKVIGDLMGGPFVLFAHHDKANNRVVVTDGYVYMPEKPKRNLVWQVESLFYSVE 334
123 2.000e-82UniRef50_A0A2E1EP22 DUF4837 domain-containing protein n=5 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E1EP22_9FLAO  ali  24  9.FLIITCFLFACQNNK------TVYKPESSGNINTVTVVIENSLWNSSVGEAIRDAFASEFIGLPQQEPIFSLKQIPLSVFSDFARQSRNILIV-------------------------QKTKKDTFMLLRDQFAKPQIVGRFLGSNEEKIIDKIKNNKKNITQEIKNNDLKEKQRRMKISLLK--QEDLKSLFSIDLTIPSAYKLFKK---DKNKFIWFQKETKNGSINIIAYQLPQKKSLRF-------YSLDEIIKTRDSIGKLFVPGRNKNS-HMITEEAYMPYRKKVKLSGFKSIETRGTWEVKNDFMAGPFLNYIIQDTLNQRIVVLEGFVFSPSSKKREQVFELEAIFKSLK 322
124 2.000e-82UniRef50_R6XKP2 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=R6XKP2_9BACT  ali  24  10.CIAALISAVSCMNNTKT------LLPNVSGKAGEVIIVVGKDNWEGNLGNEIGGLLARDCEYLPQREPLYSLVNLSPGAFSDMFKLHRNIVIFNIDSTV----------------------VKQGVVYRTDVWAHPQCVIQVNASCADSAIVVLEKNGENITGAIEQAERNRVIANTLLYEESKLGDVVAKMIGGRVHFPVGYNLKKV----TDDFIWIADEKQYSTQGVFIYKYPATDEDPFSEE--------NIIARRNVFLKEYVPATAENSY-MTTSVFVKPGIKFLKYHNLDFVETRGLWEVYNDYMGGPFVSHSFYSKDGKDIIVLEAWVYAPKYDKRQYLRQTESLLYSFE 326
125 3.000e-82UniRef50_F3ZNL9 Uncharacterized protein n=1 Tax=Bacteroides coprosuis DSM 18011 TaxID=679937 RepID=F3ZNL9_9BACE  ali  22  11.LIIAIAVFSGCKQGGKRG----VLTPTSSALPYELLVVIDNSVKESSAGEALINVLTSNVPGLPQPESAFKLMYTDPQHFDGILKPIRNIVIVNIGKTYT----------------------EARFNTATDVYSFPQSILTVQAPSIESMKDYLDQNGMAIVDYFTKAEMNRQIRILEKNHSDAISNKVKEMFDCDVWVSGELASSKV----GKDFLWTGTNEGTSDRYFVMYSIPYEDDKSFTREY--------FLHKRDSVMQENIPGAEEGMYMTTVPEYTDV--KVINVQNEYTLEARGLWKIKNDMMGGPFISHMRLDQQNKKLIFAEIFVYAPEKMKRNLVRQMEASLYTL. 327
126 3.000e-82UniRef50_K1YGC9 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=K1YGC9_9ZZZZ  ali  23  10..IFAVALVASCKNGPQ-------LMPSISGKAGEVVVVINKTQWESDPGVALRSILAVDQPFLPQKEPLFNLINIPDNAFTGIFQSHRNIIVVNI----------------------TSAAKESKVVFQENVWAAPQIAITISAPDSKSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYEEASLRTLVSEEFGGSPYFPTGYNLRK----KTIDFIWISYETTYVNQGIFIYRFPYTDSTAFTKEY--------LIGKRNEVLQQNVPGELDNTY-MTTYLLQEPGLRWVSYNKRKFVEIRGLWEVENDFMGGPFISHFFLDKENQNIIALEAFVYAPRYNKRNYLRQVESIIYSFE 324
127 4.000e-82UniRef50_A0A1Z9GP95 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=A0A1Z9GP95_9BACT  ali  61  19..........SCGENNNKSQNNRSFLPKAAGENSEMLIVMDSATFQRGVGRSLVNTYGSFVSGLPQPERKFDLRYIKPRNFNSILKNAKNIVIAFTLDRKSIDSDILKKNFNEESLLRIENDTSLFYYKRRNQYANGQVILYLFGNNELQLMSNINKNKNFLLKFFEDEVKKRVSKDIFKKLENNLSKKIFEDHSIKIKIPYGYDLAKNIKDSEGNFFWLRQLELDYEKNIFVYYEDYEKNKLANFYKIFNDKNKSIVQLRNKISKTYLSDSENKNVYMTLQDVYPIQYQNIVFKDNIGVEAFGLWKLSDISAGGPFKTFVLYDKNKKRAYYIEGYVFAPSQKKRDLMLEINSILNTFE 368
128 6.000e-82UniRef50_G8R760 Uncharacterized protein n=1 Tax=Owenweeksia hongkongensis (strain DSM 17368 / CIP 108786 / JCM 12287 / NRRL B-23963 / UST20020801) Ta  ali  25  5WLLPILLLFVGCQDGSESQIFADT-LPTSNGGRLDIIVVTEESIWSEVAGEKFIKYFAPQQDGLPQAEPIFTVRQVPPESFNSLLHRSRNIVVL-------------------------EEGPEAKVTVEKDEFARPQIFIKFTAPSGTELAKLIIQNQKDLTKMLHDSEMEHLQKRVTAKPQPV--PKLLKDHHVSMKIPASFII----DQESENTLVLWNKSLKSDQGILIHFDPIMEDDALIGD--------RIIPLRDSLTSHFIKGDREGSY-MVVEDYIPPVFENLKIDGNFAIETRGLWRTKGDFMGGSFINYTVFDETNNQRIMLDAFIYAPEIKKRNLILELEAILRTLE 322
129 6.000e-82UniRef50_A0A2A4NYY1 DUF4837 domain-containing protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A2A4NYY1_9FLAO  ali  24  16..........GCQSGEPKRTYM-----SSNGRINNVLVIMKNSEWQGAIGDALRKIIAAPVLGLPQPEAQFDITQAPPESYGSMFRATRSLLIVSIENHNS-------------------------FSTRSNVYAKPQKIVTITGTSEEQIILQIEKNKKEILTSFRDNDLITTQSNNSKNLLDPATINTFNKLGISMSIPKKYKKV----EDTDEFMWYRHHLTNGSMEILAYTMPYDSTMD---------MSDQIVNNRNTMGEKYIPGSKKGSY-MITEEAYTPHVFDVTLAGKKAYETRGKWEVKGAYMAGPFLNYTVLDKANNRLIIVEGFTYAPSINKRDFMFELEAILKTLK 321
130 7.000e-82UniRef50_A0A1Y4CT88 Uncharacterized protein n=1 Tax=Parabacteroides sp. An277 TaxID=1965619 RepID=A0A1Y4CT88_9BACT  ali  21  22.IACAWLLLVGCTPGAKRKWTMQH---QAIGLPFEVVVVQEEASWKSSLGDALRAELESPYPALPQAEAFAKVSHCHPDEFSDFMRSVRNVVWVDVDADRYT---------------------KPSLRVEKDVWASGQQVFRLQAPSADVLAQYVHEAGDSIRALLREEEQQRYVAYLNQYHSSLVDQLAQAQVGLSLYVPEE----LASYTKDSAFVWVSNDAASGRMDMVLYAFPASSEADLN--------AARLVAMRDSILGRHITGSFEGSY-MSTEKRFPVSCENSTESGIPSVCFRGLWRMEHDMMGGPFVARAFWDKVKSRIVVAEGFVYAPETTKKMYIHRLESALRT.. 340
131 7.000e-82UniRef50_UPI0004799617 DUF4837 family protein n=1 Tax=Hugenholtzia roseola TaxID=1002 RepID=UPI0004799617  ali  28  56.......TFTACEDASKK---YKNLIPKASGSRSEIVLLMDAGKWKGDLGLQVREVLMDPLQGVIHNEPRFKLIKVDPTSGSDFLTTHHSVLVVLALDSKSAQSEAIKKYFSPQAIEQVMRDSVAYFIYKKDEFAKGQNLFFICGKNDKQIAKSLKENRLKIREVFEASERKRVLALNLKGKDEKLMEKYQNQHDFKIQIPLGYLEAQNHKKDDLGFILLRNLDPLGDRNLIISYRPYTSKAQFEPD--------SILAWRDWIGKTFIKDPEHGSYMESQADMLAPFYQEINRNGNYSREMRALWRLSSRTAGGPFISHTFVDEKRNRIFYVEGFVEAPQREKRELIRDVESLIWSLQ 398
132 8.000e-82UniRef50_A0A0M0MS30 Uncharacterized protein n=6 Tax=Prevotella TaxID=838 RepID=A0A0M0MS30_9BACT  ali  22  9.LLTAIVALCSCSGGPQ------SLLPKSGGRPYEVLLVASDRRCAAVAD----SVLTQDMPSLPQREPMFDVSLIDTTRFNQTTRLARCIVIVTVNPAVFTSTR---------------------IRYEKNVWARPQLVVYVNTPSASQLSQYMAKAGHRLTSLLTRAEINTAISTLRAGSNRKAESSIRSMFGWDMLIPADMKAGKT----GRNFIWLSDNRPDRMRNICVYSYSGT-----------TLDAHRALAARDSVMRLNIPGELDGMYMQTTPGS--VTAGLATEDGRTVMISRGLWEMRNDAMGGPFVSLSTVDSVNSRIIVAEAFVYAPGTDKRNLIRSAEAALYTL. 317
133 8.000e-82UniRef50_H6L326 Uncharacterized protein n=3 Tax=Saprospiraceae TaxID=89374 RepID=H6L326_SAPGL  ali  25  9.LLSIPLFFSSCTDAQRERLE---VTPMAYGSVDQMHLVCDEYLWKSPIGDSIRQYFEALYPITPQPEPILDLRHVESREFNKVLKTHRSIVILADLEEEEAGTALVRKVLGPKKVKKAFTDPSYRIMVQKNRWAKDQTVIFWFAPDRQSLFETVCRDYQKVINILHEKDTEKLVKQYFSGQTEEVEADIRQGLNLSLSVPKGYKIA----HQDSVACWLRKETNKVSSNIFIYSIENPGPNTLSPD--------SLKAIRNRLTKDYFSSWQEGSYMQIDDVNLPTYYEKIDFGEREALQARGIWFMANDFMGGPFVTYLIPDPDRNRIILLDGFIHAPGQKKRPEMRKLDVIFSTF. 354
134 8.000e-82UniRef50_L0G423 Uncharacterized protein n=30 Tax=Cytophagales TaxID=768507 RepID=L0G423_ECHVK  ali  28  12.FLFATGILVSCQDGENGNNSN---KPKARGASGEILLVIDSLKYKGPVGDALKNVFEEDIKGLVRQETLFDMRKVDPRSMTRILKMAYNIVYVTTFDDKKPGSRMISNQFSPASKEKAAADPSLFMLRNEDEFAQGQEVVYLFGNSEEELINNLRKNKNKLQNLFEVRERNRLGEAILARTSGKVQSEGEEILGLELTVPASYQFVK----EEENFLWARQPTPTTERSLIFYQTDYTSEEQVFPE--------NIIKLRDEILKTRVFGDPENSYLE-TEKQIVPAFRNMQIDGHYAIEMRGQWKTHSISMGGSFVSYTVVDETNGKLYYLEGFLYYPNETHKKALREIEAIL.... 354
135 9.000e-82UniRef50_A0A1I1YAC2 Uncharacterized protein n=6 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A1I1YAC2_9BACT  ali  23  11.ITVLVLFFSACKDKG------GIYKPNLSGSQGEMLIVMNDSVKESVGGKTLISVMQQSMLGLPQHEPLFDVSVIPHRAFSERLKPFRNLILVYI-----------------------KNGQKPDIKYYKDRWGKQHAMAEIYAQDGWQLDSIVNAEEIKLAGFFVKAERDRNQNYYRKYINRTLTEKFKNVWDAFMIVPVNFNENKP----GKNFMWMSNETPLTSQGLFVYSFEYTGFESITEPY--------LLNKRDSVLRVNVPGPSEGSY-MTTEDRVPVTYKRFEHNDHQIVEIRGLWRVEGDIMGGPFVSFAHIDPENGRVVVTEGYVYAPEKEKRNLVWQLESILYSF. 326
136 1.000e-81UniRef50_A0A1B2Z0U7 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1B2Z0U7_9BACT  ali  22  8..LFLLLILSACENANDKT----VYKPQSSGNINDLSVVIDSQLWESSVGESLRSTIGAPLYGLPQDEPQYKLRQIPSSVFSGFVKNTRLVLKVVKGVAADT-------------------------KFYKDPYASPQRMVLVSGMTNQDIIDQLTANQYKIEKTFKVYEIKEKQRRFRKSLFN--SSAITKQLGIGIQIPSIYRFA----TQEDDFFWFRRDIKTGTVNLLLYTVPYDQNSTREG------LAERVIRTRDSIGKIHIEGPVEGTY-MTTEKAYTPFFGTDKVAGLNSFKTKSIWQVKDAFMSGPFINYWIKDKANNRFLIAEGFVFAPSVEKRAYVFELEAIIQSI. 321
137 1.000e-81UniRef50_F0R265 Uncharacterized protein n=110 Tax=root TaxID=1 RepID=F0R265_BACSH  ali  24  12..VTLAVSMASCKGDGKSLIT-----PASSGRPYEILVVADDNCWKAP-DSALYHVLDSDVPGLPQSERSFRISRVPHAYYDRSMRLFRNIILTDINPELYT---------------------QTKFKYARDVYSSPQMILIIQAPSQREFADYVSRHGNVIVDFFTRAEMNREIKELKQKHNRVISAKAGSIFDCDIWMP----LELESYKEGKDFLWASSNLND--LNFVMYSYPFRDHDTFTKAY--------FIHKRDSVMKINLPGAREGMY-METADSMFVETRSISVGGDYAFEARGLWEMKNDAMGGPFVSHVRVDRAHARVVVVEGFVYNPGGLKRDKMRKLNAALYTLQ 326
138 2.000e-81UniRef50_A0A1G5JCT4 Uncharacterized protein n=4 Tax=Flavobacterium TaxID=237 RepID=A0A1G5JCT4_9FLAO  ali  22  10...LLIAVLFSCKEKTE--------KKEATGKINTISVIIDDLLWNGEVGDSIRNKFASPVIGLPKEEPMFTINQYPIRLLEGFTTNSRNIIVI-------------------------KKEAQNRFQLVENEFATPQNVFHISGKTGTAILNLIEAYAPEIIEKMRATEITANQKIIDTALVDT--QRLTDKFNASLHVPKGFNLVMRKRK----FMWFKKEITSGNSSLLVYQVP------ISAIRNDEDPTSNIIRVRDSVGSLYVRGTVPGS-KMITEGSYAPYLFDVKIKGKPAYETRGTWELKNDFMSGPFLNYAILDRANKRILVLEGFCYAPSKEKRDLMFELESIIKSVE 319
139 2.000e-81UniRef50_A0A1H4BEE0 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1H4BEE0_9PORP  ali  25  12.ILALLTLFTSCDGSGSFF--------SASGTTNEVIVIMDENAWEGPAGRSLFGVLNSNVKALPQPEPNFRILQLTPENFTSTFKVARNVIIPEISDIYSY----------------------PKLTADLDKYAMGQVIMNIHAPDTASFVEFVTENRESIVDYFITKELERNANYL-KNQIKEPVSRVKQIFGINMHFPKG----LPNITEHENFYWATNNAARGRQDIVIYQFPYTSETVFEKD--------SLISIRNRVLGEYIKGSFDS--QMATATVYSPDYRKMETDGLFRAELRGLWEMTTDMMGGPFVMHAFVNENTGMVVVAEVFVYAPEMNKRNLLRNLESALYTI. 323
140 4.000e-81UniRef50_A0A2E7MI72 DUF4837 domain-containing protein n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2E7MI72_9FLAO  ali  25  16..............GCKDAKDQRVYKPQSSANINSLLVVMDNALWNGRVGDAVRDYIGSEVYGLPQVEPNFDLNHVPMAVFSDFVRHNRTVLKVQMSEDSG-------------------------IKYYKDPYASPQKMAVIKAPNRQALVDLIQANASTLISNFKDLEFKEKQRRINKALFNT--KTIEAALDIKIRFSTAYRIAKA----EKDFFWIRRDTQTGSLNLLLYNLPIQDFEDN------QEFSAYVIRKRDSIARQFIPGPVAGNY-MTTEAAYTPFFKKRLFLNLPTLETRSLWKIEGAYMSGPFVNYAFLDKKNKRLFVAEGFVYAPSESKRDYMFELETVIRSV. 321
141 6.000e-81UniRef50_A0A1H3Z3Q0 Uncharacterized protein n=1 Tax=Flavobacterium gillisiae TaxID=150146 RepID=A0A1H3Z3Q0_9FLAO  ali  23  8.ILLISVLFFSCKEEKTNAIRKT------TGKVNNISVIIDDQLWNGEIGDSIRNKFASPVIGLPQEEPLFTINQYPIKLMEGFMTDSRNIIIV-------------------------KKGDKNYFSIKKDEYASPQNVFHISGKTGEDIVSIFEKNTSQIIQIIRQTEIEECQRINKKSLLEE--KLFTEKFNITIDVPSDYE----NMVQDANFIWLKKELVSGNTSLLIYQVP------INAIKNNKNLVSNIIKTRDSIGALYIHGKEPDT-DMITEEAYAPYFFKIKLDGKLTYEIKGTWELRNDFMSGPFINYAIFDTVNNRVLFLEGFCYSPSKEKRDSMHELESIIKSV. 320
142 7.000e-81UniRef50_A0A2T4WRD2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WRD2_9BACT  ali  25  8FLLFVSLTLVSCTNSESGIFGSEKVLPPSNGGILDILVVADDKVWDGPAGDAFLKHFTAMTYGLPQPEPLYTVRQVGSRDFGDLLKRSRYLVLLSLGDST-------------------------IFTSENDKWARDQLVFYLQAPSEALLRKHILAKNKEIDALIEQREMLRMSKRIAALTHKLYPDFLAENH-IKISIPKDFEI----SVEKKDLVIYWRRTKVNDMGIIIYRGPLPQEGAIIGEH--------LVPLRDSLTKLYVAGARENSY-MVTEDLIKPQSEPTEISNNFALKTRGLWRSEGDIMGGPFVSYSIYDETHKQLIYIDAFLLQPDKKKRKTLFELESILNTVE 333
143 9.000e-81UniRef50_A0A1I2HXM6 Uncharacterized protein n=2 Tax=Thermoflexibacter ruber TaxID=1003 RepID=A0A1I2HXM6_9BACT  ali  34  13.LAFTAIFLFACSMERSAENGN---LVPSRGDSGEILLFMDSTKWEGELGKAVREVFSARLAGTLREERIFTLRYINPLALNDVLKSHRNIVMVTSLESSSKETRKLKSFYTEESLKTIEQTDSLFMLLKYEQFAKDQILLFLFSKTDQGLXXXXXXXXXXXXXXXXXXXXXRLSQRLYKKEQTNISKQITEKHGFKVRIPFGYEVNEKSTDGKEGFLWHRLLDPEIDKSFFVAYKPYENQNQFEKD--------SIISWRNQICKKYLYGDPDNKSYVVTETLEPPVSKPLMVKGRYTMETRGLWKTNNISMGGSFISYVFTDNKKGRIYYAEGFVYAPSKTKREYIRELQVILTSIE 364
144 1.000e-80UniRef50_A0A1V5P3J9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin397 TaxID=1852812 RepID=A0A1V5P3J9_9BACT  ali  21  11.VFFITALFSSCD--------FSDVKTSSSGKPGEIIIVADSLVLKGEAGIILRDSLGQAFPGVPQYEPVFTTVTIPHANFRNILQAHRNVLMIEIGP--------------------VSGNKDYALTFKRDVWATPQLVMNLRAKDASYLQAALLSFTGTIVKQFSDEERFRAAEGLKQLPETEVGTLVQKEMKFFMPLQAEYYIAR----QKNGYMWLRKETANTSQGFQMLRLPYITDTVFQSN--------SLIYLRDSLCKANIPGPAAGSY-MVTDYNFPVTVESMKIDSCYGVAIRGLWRTEGDFMGGPFVTYAFLDEKKQEVVFIDSYTYAPKFDKREYVKAMEAMI.... 323
145 2.000e-80UniRef50_A0A1M4VRE2 Uncharacterized protein n=1 Tax=Flavobacterium fontis TaxID=1124188 RepID=A0A1M4VRE2_9FLAO  ali  23  7FGFLISLFGVSCTGKQSKNVAATVTKP------NQVSVLIDDQLWNGEVGDTLRNKLATPFLGLPQEEPVLTLNQYPVKLLEGFTSNSRNIIII-------------------------KREPKSQFRIEENEYVNPQMVVHISGRTVQELLDSIQKNDSLIIQRIKASEVRVYQQALKNDTLQNLTP-LQERFGLTMDVPARYKMVMS----GKRFFWLKKEITSGNLSLIVYQLP------LSKFKSSKISTRRIIKIRDSIGRIYIHGAVPRTYMM-TEKAFTPYQFETEVAGVKAIETRGSWELSREFMGGPFLNYALIDTANNRVVFIEGFCYAPSKKKRDLMFELEAIIRS.. 320
146 2.000e-80UniRef50_A0A2E4TAR1 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A2E4TAR1_9FLAO  ali  21  14FVVALALVMXACEGDGARVA-----LPGKVGAAGELVVVAXPEVWAGPXGDTIQALMXQPYPVLPQYEPXMDVVXLEPALFDRFWKPHRNILVLEVADRVDT--------------------QEPSFTFYRNKYSRGQIYMVAKARTAEALXEVLLSRSGEMVSLLHAEEALRFADIVALSPNEVVAREVLNNWGIQGLWPKDARLAK----QTEDFWWVXRDNHDIXQGFFIHSEPYVSTDQLSLEH--------VLDRRDAVTRKHVQGPTSGSY-MATERRFXPAYEEMQFDGHFALEVRGXWKMENDFMGGPFYXLTIVDEXEGRLLTXEGYAYAPXFDKRPYIREVEGLVR... 340
147 3.000e-80UniRef50_A0A0P0UA17 Endonuclease n=8 Tax=Flavobacterium TaxID=237 RepID=A0A0P0UA17_FLAPS  ali  24  9.LLVFVLCFAACGKDKHDDAD------SSKGNINEISIVISDVLWNGEVGDSLRKKLAAPVDGLTLEEPIFTLNQVHDKSFDGPMKKGRNIIVVD-------------------------KAVKKVFDFKRNNYCAPQNVFTIKGKSIDEILDLIDMHSDEIIRKIRETEIAENQQRNIKLGLLD-EKKIESQYNISINVPVTYSYA----LQNNDFVWLKKDIPSGNTNILIYKVPYDVIEH------DKTIVTNIIKMRDSIGSQYIHG-QEPSTFMITEEAYSPYLYMTSFKDKRTFETRGNWEMENDFMNGPFLNYAIRDDKHNCYLIIEGFIYSPSSPKRDLVIELESIIKSVQ 323
148 3.000e-80UniRef50_A0A2J6HLP3 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2J6HLP3_9BACT  ali  26  5FILLGMFLLMSCTQSDYQG------LPPATGGMSELLVVLQNQKWDSNVGEEIRLLFSSAQNGLNQPEPMYDLMQITHNEFKGLFEKNRKILKIVISDTVKT----------------------DQVLARRDVYAAPQMIIEVHAKTDQGVIDLLYSRFPSMVEMYKEVERERISDAFAKTENLKLRQDMIDQFGFYFIMPESFYNAK----EATQFAWYRLEHSRYSQCLLVYVREFVDSAQFSPN--------NIVRYRNKVCMENVPGELPGSY-MSTDTVFFPDARLVNFAETQAVEMRGLWRTEGDFMGGPFLNYTFLDEKDNQVITLEGYVYYPNEDKRDLLMQLESIIYSF. 324
149 3.000e-80UniRef50_A0A1V6JDZ5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin012 TaxID=1852796 RepID=A0A1V6JDZ5_9BACT  ali  25  4.LLTVIIVFLS--LITATSCSKSSSKKSSTGGTLEVLVATDSEQWNGKIGDTIRSLFARYIPCLPMPEESFTPLPILSKTLNDMYKAHHNIFIVSIDP----------------------KLTKPSINLERNYWAEPQLIIHFSCPSDTSFFCLFNQYYPSLYELYREVEKDRIQKLFTSNPAKEIITKLQSKYGIDMLIPGGFTVAR----EEENFIWIRRRKQDTETGFLVYYRPYTDTAQFNGK--------NIIRTRDSITRKYIPGAVEGSYMATSVDVIPPQFKRTKFSTGFAVETRGLWKVVNDFMGGPFISYTFADTKRQRIVTVEGYLYHPNSEQRKYMLQIESLLNTAK 333
150 4.000e-80UniRef50_A0A0Q4AZ26 Uncharacterized protein n=1 Tax=Candidatus Bacteroides periocalifornicus TaxID=1702214 RepID=A0A0Q4AZ26_9BACE  ali  22  10...CFLFLLSACRSGSNGR---STLLPNITGKPGQILVVAPVQIKDTPLADSLRAVLGAEYPMIPQHEPAFDLTFIPESAFDRVLQPFRNILFIRTSPDS----------------------AQSSLRLATDKWAAPQSVAYLSGPNIDSLAAWVGTHAYTLYQTFTEAEQKRLMEGYRKVHNADLSSLVAKRFGVWMDIPSGF----ATRVDKPDFCWLSLETKDISQGIFVYE---------WGNFGSPFAPDTLVAHQNYYTHRDVPGPSPNSY-MQVAEVIPPEVQALRFGGDTLVRMRGLWDVRGHAMGGAFVSYSHLSADGLRVITTVGYIYAPRFKKREYMRQLEAVL.... 322
151 5.000e-80UniRef50_A0A098S8R6 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A098S8R6_9BACT  ali  26  8.......TLQSCSEDVQRSMKA---IPTAFGQLNEIVIVMDDELWESPVGDTIRYYYSSAYPLLPQPEPVFDLRHFTPLELKKLRKELRTYMLVGNLDEDSPTAQMIRKDIGEEMSESARGDITKNNAAGRDKWAKGQLLLYQFAYSNQDLIKVLKENYPAIKKRVNKFEKKLESYAYLNGVNNNLINEVKESIGISIRMPSDYFMAINDGE----VIWMRKETDKTSSNIMLRKVKYEDQEQLSKE--------NLIAMRDSLGKKYVSSTIEDTYMQVNDEDLPVIFNTTKVNGNYAVEGRGVWEIVNDFMGGSFISYLILNPNKGELLFVDGFLHAPGEDKRDFMEQLDYVIHTIK 348
152 6.000e-80UniRef50_UPI00094F71BC DUF4837 family protein n=1 Tax=Labilibacter marinus TaxID=1477105 RepID=UPI00094F71BC  ali  25  18FIIVAIFILSGCKTESS-------IKSRSIGAPGELLIVMDKDIQQSPIKSVLVDFAKEEFPCIPQPEPIFRLTIITPNDFEGHFKAYRNILIVK------------------------QNQAEPAVKYKNNLWASHQQVVEINAADETKFKTVFEENRTQVLEYLYYGDIRTLQKANLKGADAATQRFVNDKYGVNIVLPKGYKLIK----DTANFSWFRFDRLETALHVVIHTFDLDSVGALNSD--------NLIELRNYVGETYIPGPSETTF-MQTETQLPVLTNRLMVNGIDVIELRGLWKVEGFFMGGPFVSYCIPDLENNKLLLIDGFVYAPQKNKAYYVRQMESILHSVK 334
153 1.000e-79UniRef50_UPI000466712A DUF4837 family protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=UPI000466712A  ali  21  8..IICMLCIVSCTEKKDENQKSQESMAHSNGRINHLSVVVDNELWNSNVGDTIRKYFGAEVPGLPQEEPLFTLRQMPKETFTGLAKQSRIFLWIEK-----------------------QNEGENKYGLLKNKFSNPQIGVVISGATNEDIATLIRENHEKIISKYKSIEIKEKQAIIKKSLER--IPQLQEKMGITLNIPSAYRIAI----EENEFFWIRKNIKHGSMNLMIYELP------LGTVTKDSNTVSSIIKMRDSMGTVKIPTPEVG--HFITEEAYAPYLYEIELDNRFTFETKGIWEIKDRFMSGPFVNYVIEDIANNRLMVLEGFVFAPSVSKRDNIFELEAIIKTVK 328
154 1.000e-79UniRef50_A0A0R2VPS4 Uncharacterized protein n=2 Tax=unclassified Sphingobacteriales (miscellaneous) TaxID=203473 RepID=A0A0R2VPS4_9SPHI  ali  23  9FLSAVLGIAVSCKQLEVKN------LPYSIGGVDEMVVVLNAVDSTDTLFQAIDQYLGAIYNNTPQPEYRFGVTYIDVATYRSTFQKHRNLLFIGDLETPGDFSQFISELVGVETLKKVRSAGASFYLPLEDVWAKPQYVEAIVAADRTLLLAGIDTIMQGLTDRISQRELEKIRKQFLPGHNNQVETVLREQQQIDMQVPSEFTMLKAS---NDNFIFLRKSTIDLTATIMIYYEPYTDSAQLNPTY--------LLHLRDSLGHQYESSRVPGSY-MQTEYRAPSEHNVINLNGYYCLESRGLWRLINDFMGGPFINYWIVDEANNRLVYIDAYVYAPDMRKRPQIRQLESVISTY. 349
155 2.000e-79UniRef50_A0A2E5XU57 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E5XU57_9FLAO  ali  22  5.CIILLFTFYSCQENGQKDVST---LPSMTGGINELVIVLEEHLWQGAVGDSLRAVLGAEVQGIPWQESIFDLVQIPPKAFTRIFETHRNLLFF-------------------------EKGNKASVGFQENTNAKGQLMALVTYQNTQELKVLLKQYASVIAYRFQEYEKERLRAQM---VLQTGLEKVFQKHKVDLNVPKDFTLV----LDTTDFSWIEYSPKDKEIIQGVLIYEIKPETPFTT--------WQLLAQRDSLAKQYVQGETTGSYMAVETQHYQPWIKHIESMGCNALEIKGLWKMQNAFMGGPFIAHFIQDTTSNRILAIEGFLFNPGKDKRDKMQLLQLVLESAK 319
156 4.000e-79UniRef50_A0A2E2P2S7 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2P2S7_9FLAO  ali  24  2.................GDKLNSDSLPSSAGKYGEVLVVLDTSYENGVVGEKIREIFQAEVEGTPQSEPLFRMSTVNTENFKSILKRSRNLFKVSI-----------------------EKSNQNKIKIDRDVWASDQLLINIYANSKESALRILDKNVEGIRDYYNQEEVKRLQKQYNNQLQSDLMAEVEEQFGISISIPPAF----IKMSGDSSTLWLKKEKKIGDQGLLIYSQPYSSSGVFS--------DSAMIENRDQKTKVFVEGARENSY-MKVYDELPVYSKEINLNGLYAKEYRALWHMENDFMGGPFIHTTVIDEENQKVIHLDGFVYAPKFTKREYVRELEAIIKTFK 311
157 5.000e-79UniRef50_A0A1V6I5J8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin028 TaxID=1852798 RepID=A0A1V6I5J8_9BACT  ali  21  8.ISLLSIVLYSCNSGSYKTVAY------AHGQAGDIIVVMNNQAWDTEAGDSLRKVFHEYVSGVPMEEHMFDLHQIPREQFVKGNKLHRNVIYQEVNSSIEQAS----------------------IKISRNKFAMKQVFVEIAAPNQHEFAKIVAQNKKKLVDIFLEADKARWIETLTKYTNKIASKRVQERFDIFLRIPSYYNI----EEDRDGFMWICKEAKNYSTNILIYSWEKSDTSVLTAEY--------LISMRNLILQNNIPGEKPNSYMTTETKYDYPEFSLLMHNSMQTGKLKGLWRVHGDFMGGPFVSYTKIDEPRNRLVTVEGFVYRPNQEVRDLIRELEWTCSTFD 325
158 5.000e-79UniRef50_A0A2C6CTZ0 Uncharacterized protein n=5 Tax=Lewinellaceae TaxID=1937960 RepID=A0A2C6CTZ0_9BACT  ali  24  30...........CGSDLAQSVTPT---PTAFGKINALTVIADSSLWQAGISDSVDYFFGAPYIILPQPEPIFDINYISPERLSGTWQQLRNIVMADLSDDNSPTTQMVLGDMTDEKIQQVRREG-FGTAVANNKWAVGQQLIYLMGKDLTELKRGLSTAYPAVVKRIKLREEDRITTYFEGAGNRSIEKTVLERTGARLRIPGDYQLA---PLEDTSVVWLRKDIPEGSVNIMMSTVPYENQSQLTREG--------LKSLRNQLGEKYISSTTPGTFMRINDHDLPLFMETTDLNGNYALEGRGIWEMENGYMAGPFVSYLVHDPEQENLLFIDGFVHAPGKKKRNLMEELTYVLRT.. 365
159 6.000e-79UniRef50_A0A1V6HH30 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin041 TaxID=1852801 RepID=A0A1V6HH30_9BACT  ali  24  16....FAFLLAACSSNPSGHK-------PSTGKTNELLVVVNNELHKGHVGSVISEFFGQILTGLPQPEKTFDVAFIYEPGFGQMFKTHHNIFIVDINASFD----------------------KPVIETHSDLWAKPQRIIKMTVHDEATFFEEFEEKKESFMMYFNANERRRAAQAFGSIEDLKIKKFITKKFDLNILIPKNFYVAK----EQQNFVWIRREGQEFSQGILIYTIPYHDTSVFLPDE--------IIKLRDRMTKDNVLGPSEGSF-MRVSMVEPPESHRIEFNGMFAVEMRGMWELDGDFMGGPFINYTVLDEQNQRIVTVDGFVYYPNKDKKNLTRQLESLIYTL. 328
160 8.000e-79UniRef50_UPI0006471C8E DUF4837 family protein n=1 Tax=Alistipes sp. ZOR0009 TaxID=1339253 RepID=UPI0006471C8E  ali  19  7..LIIALTLLAVTAGCNKKKSSSSSLPNPAGAICDVLVVLNEESWKAELGKTYKEVLEDQYPYLPQAEPSFKVNHVTKDVFASTAQKYRNLII----------------------NKFGAEYKEPKFIIQKDVYASSQVVITVQAPSPQEAAIYVKENGARLREIFDQTEKDRYAAVVKSSALAELTAAVKEKFGFELFFPSGYAL----RTSKPNFMWLSLETNYSSQGLLIFTSPYKSERDLSDKG--------IIAVTDELMKQYVPGPSEGSY-MITENMVPPKAEKVTYKGREWVRMRGYWDVEKEFMGGPFISYSTLIKEKNEVLTIRAYVYSPKKDKRKPLLQTEAIIFNLD 328
161 9.000e-79UniRef50_A0A2E9J9I5 DUF4837 domain-containing protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2E9J9I5_9ACTN  ali  22  6..LITALALISCKNDTKIVLA-------SSGNLNEISIVVEDQLWEGSVGKALKSSLTKSIYGLPQHEPLFKLRQIPPRVFTGFVTKSRTIIKIEHNKPKQT-------------------------KLIANQYAAPQTVVIISGMNSKEIIEEFKKHAREIIYKIKAGEIKEKQRRIRKALSS--SQVLDSIFKIKLDFPSIYRIARADR----DFVWIRKDTKSGSVNLSVSQIPF---------KRKPLDVSTIVATRDSMSKQKIPGPTENTY-MSTDLQYRPVISQATIGSKKTIQTKGLWEVKKQFMGGPFINFSVVDSINNRILFFDGFVYSPGTEKASYVFELEAIIKSLK 314
162 1.000e-78UniRef50_A0A1D9P9H8 DUF4837 domain-containing protein n=6 Tax=Flavobacterium TaxID=237 RepID=A0A1D9P9H8_9FLAO  ali  23  8.LLFVSIFFISCQQQNTTPKKT-------NGKINNISVIIDDLLWNGEIGDSIRNKFASPVIGLPQEEPLFTINQYPVKLMEGFMTDNRNIIVI-------------------------KKDTKEDFKIEKNKIAIPQNVFYISGKAADDILCLIQTHAAEIIKIMHQTEIEECQRINRKSLLS--TKFFKDSFNIKIEMPSNYELM----LQKEDFVWFKKEIISGNNSILIYQIPM------NRLETKRDKVSGIIQMRDSIGKLYIHG-KELNTDMITEEAYAPYFSNIVLDHKKAYETKGTWELKNDFMSGPFINYAIVDKDNDRIIVLEGFCYSPSKEKRDLMLELEAIIKSVK 320
163 1.000e-78UniRef50_A0A1J4TMZ9 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A1J4TMZ9_9FLAO  ali  26  15.........ISCNSNKNK-----LILKSSTGRINAALVVIDNKEWHNVVGETLKTIFTNPIEGLPQPESQLSITQISPSKFNSLFENNRNILVVGI-------------------------QSQSQFKMVRDQYASPQIIISVIGTNQADLINQIKTHQQAIIEAFKKGDLALYQKKLATKTWESNRFAVLKNT--EMVLPKEYLKVK----DTTNFLWLRKYLKDGTLNILAYKIPIVSKDSVSLSY--------LINERNKIGIKHIPGQFINTY-MQTAAEMQPSFKALNVNGLNAFELRGLWEVQNDFMGGPFINYTFVDTAHNQLICLDGFVYAPNQDKRDYIFELEAIFKTFK 320
164 1.000e-78UniRef50_E7RP30 Uncharacterized protein n=5 Tax=Prevotellaceae TaxID=171552 RepID=E7RP30_9BACT  ali  24  12.VITALLLLASCSGN-------LSLKPASGGHPYSVLAVGD-------VDSTLFAVLSKEVKGLPQPEPSFDVSEINEQSFNATWRLSRNIVIVRIDSLRYPSAQ---------------------IRQEKDVYAHPQLITYIGVPTADALKIFAAKNAERLNTQLTAFEMGAHIAVLKVKHNPKAEEKIRQLFGINMLIPAYMQASK----QGKDFIWLSNNTANGMQNLCIYRLEGTAD-------------RNFIAVRDSVMRANIKGETDDMYMTTVPRSCYISQSGTHSNGS--ILIKGLWEMHGDAMGGPFVSRVIR--SNGATYIAEAFVFAPETKKRNLLRQIESALYTIK 313
165 1.000e-78UniRef50_A8UQ14 Uncharacterized protein n=4 Tax=Flavobacteriales TaxID=200644 RepID=A8UQ14_9FLAO  ali  24  5YTVLFCVLLLACGDQKSDG---KIYLPESSGKLNTISVVVDNILWEDSVGENIRNIFATPLNGLPTNEPMFNMKQIPPQVFDGFAARNRIVLKIE------------------------KEDTEASTKIVNEVFAKPQTLVVVSGKTNQEIIAQLQENKAKIVDAFNKEEVKEKLRLINKSLLAD--EAMENKLGITIDIPWAYKISKA----DDDFFWLRKNNNSKTIDLMLYEVP------IETISKGDSTIVDIVKMRNIITKTKVPGEDD--IYMAVEDAYAPALFNTIIDNKPAYEVRGLWKMEGYTMGGPFITYVIEDKINNRYLVGDGYVYAPSLDKRDLVFELESMIKSI. 322
166 2.000e-78UniRef50_A0A2A5G5K8 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5G5K8_9FLAO  ali  24  30..........SCEPAKKSR------LLAYSGAPGKIVTVLTQEHWNGEIGELIRTTLGKPQYGLPQSEPTFDLLSKTPKTFQKYFKTQRNIFIVNISDTV----------------------KKSSVEIKTNPWASRQIAITLHAADNRAFIEMLKKHHEGIMQYYQRGDIEKLISRNKTKGEKLLNGQILENHGISIALQKDCEIV----VDSSNFVWIRLEYHQISQGLLLFYEPYNDTSQLTVNY--------IHAWRDSVLQERIPGPKTGSYMATDYQHIPPKSWEINLTGNYAXEIRGLWRMKNVFMGGPFICLTAVDEKYQRVVTAYGYVFAPEFDKLDYLREVEAMLKSVE 346
167 2.000e-78UniRef50_A0A1Z9SSJ4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1Z9SSJ4_9PROT  ali  25  8..LSVFLFFCSCSESNEK------LLPGSSGNINNISVVASNTLWESSVGDLIRENFSRPIYGLPQAEPVFNLNHIPSKIFSGFATKSRTXLKLHI-------------------------GNKESISNFKNSYASPQIIVQVTAPNKEALSQLILDNISSIYSSLYFSELKEKQRRISKNTNK--SPLLKNNLGLSLKFPSAYRIAK----EDSNFIWVRRDIESGSVNLSISKVKKGNRGIFS--------------LRDSISKAQIPGPVENTY-MSTDFGYKPITQEVNFGNIKTLESRGLWEVENQFMAGPFLNYYIE-VGNDEVIILDGFVYSPGTNKREYIFELEAIIRSLK 311
168 3.000e-78UniRef50_A0A2P7TGC1 DUF4837 domain-containing protein n=2 Tax=Sphingobacteriales bacterium UPWRP_1 TaxID=2116516 RepID=A0A2P7TGC1_9SPHI  ali  22  10.FVLFCLFAGSCTDEQVKNAIGDKTLPTSTGDIDEIVLLMPDNLWQGSAGDTLRHFLLQDFELLPQSEPMFDIRPLTMKQFTNMLQ--RSAVVVFMADMSNTGNDITMAVQEQLQQFKAAGKDAPPFFARRDVWATPQRVIYFYASSANELTTKIANNKGLIQQLYEIGNLKAYNNAYAAKPNDGIANMLAKDYGVELKVPNNFEEAQ----KKTDFAWFRNEATEEVLNLMLYTKPY------SGGKSPGLTLSTAIALRNEMSK-NITSQIQGSYQVADTTLGFVTRMVKMPSGNEALEVRGLWRMHKDFMGGPFLLYLIDDAAQQRLIVTDGFVFAPKIDKRRLMRKLEMVLRS.. 356
169 3.000e-78UniRef50_A0A2T0WER4 Uncharacterized protein DUF4837 n=9 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A2T0WER4_9BACT  ali  27  24.VCIASIAFWSCEESESS---KNSTKPKARGAVGEIILAIDSAKWDGPVGNVLKDIFLEDVQGLIRDESMFDVRKVDPRGMNRMLKMATNIVYVTTFDDRKAASQNINSLFSKEAKEQASADPSKYILRSEDEFAVGQEVIYLFGNNENELIENLKANKSKLQNLFQVRERNRLERVLLNRKSSEA-KVAGRDLGLEINVPASYQIAKS----TDNFLWLRQPTPRADRSMFFYETDYHSEEQLFPEA--------LLDLRESITKMHIYGDPRNSYLITERVDPSPVFSNFSINNNFAIEIRGGWKTNNLSMGGSFMAYVIVDDKKGKLYYMEGFLFYPNEAHREAIREIETLL.... 366
170 5.000e-78UniRef50_A0A1Y4C0C1 Uncharacterized protein n=1 Tax=Muribaculum sp. An287 TaxID=1965623 RepID=A0A1Y4C0C1_9BACT  ali  19  33...........................NVSGSPGEIIVVIEGAEWDAEPGEIIRNTLEAEYQVLPQVEPKFKLYDVTPSNFTNLFWIHRNILIVNISPDV----------------------KENKTLITKDVWARPQTVVKVNAKDREAATELLKKDISLIDNTFEQAERDRIIANNIKYQEAGVRNTVAALAGGSPYFPMGFTIKK----GDDKFIWISYETTSVSQYVFVFKYPGTGDDALS--------VERIIKESNAVLKQNVPGPVEDSY-MITAPLPDPQLKYIKYNKRDFAEVRGLWEVQNDYMGGPYVIHAFYDKDGENVIVLLGFVYAPKYDKRNYLRQVESIMYSFE 329
171 7.000e-78UniRef50_UPI000288F174 DUF4837 family protein n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000288F174  ali  23  8.VCFVLFAVMACKNNKNKVVLDEGAYARSSGRPNTLTIVMDNRFWEGGIGEVLRKNLAAAVPGLPQEEPMFTIRQMPSTAFTGFANKSRCFL-------------------------KIVNNKEVGFKILKNKYARPQIGIVISGRTDEEIINTFRTHKAEIIQTFKAVEILNKQQLVKT---PLVIKGLDTNLGISLSAPKSYRVAKAS----KDFYWIRKNISHGTMNITAYEVP------LNFFKDSLSITQNIISMRDTYGGDNIVVDEGGRF--ITEAAYSPYIKEINMANFDTYETRGTWEVKNKWMAGPFVNYVIKDTKKNRLLVLEGFVFAPSINKRDYVFELEAILKTVK 327
172 8.000e-78UniRef50_A0A2S1LU58 DUF4837 domain-containing protein n=1 Tax=Flavobacterium sp. AJ004 TaxID=1981981 RepID=A0A2S1LU58_9FLAO  ali  23  7.VVFFAMTMASCHNHQKDDAGQE-----STGDINDVTIVIDDPLWNGEVGDSIRKKLASPIEGLFQEEPLFTINQCTTKATTDFFCHNRNIVII-------------------------KKANANAFSIKEDEFAKNQTVIHITGKNIPELISLIEKKSDTIIKRLKQGEILECQKR--SAVAALDCKKIIERFRVSLKIPSAYTYAVTN----DHFIWLKKEIPSGNASILIYQVPMSSIL------KDQNVIQHIVKNRDSIGNLYVHGTQAGTY-MISEESYSPYIQQIKLEGRKAFETKGRWEMKNDFMSGSFQNYTIIDEKNKRILVIEGFAYAPSIPNRDIMYELESIVKSVK 321
173 8.000e-78UniRef50_A0A2E4QA02 DUF4837 domain-containing protein n=15 Tax=Bacteria TaxID=2 RepID=A0A2E4QA02_9FLAO  ali  25  6.CLSLIFILFSCNS---KADRSKAFVPESSGNLNNVTVVMPLSDWKGALGNTVRESMSLIYEGLPLDEPQYSLNYMKPQTFKGFARQSRNIIWF-------------------------QRDSITRFQLAQDQFARPQIVALVTGIDKEVQAFSFKQNAKLLRQAIEENERKEKLRRINKSP--TTEKKLEDRFGYYLNYSSAYKTVK----DTTNFIWIQKEIQKGHLNIIAYSLP--------EEKLKGMFTQKILNIRDSIGKLYVPGRLEGSYL-ITERTFRPYFYKTLLDGKEAYLTKGTWEVANDFMAGPFVNYVIRDSIANRWMVVEGFAFAPSVSKREYMFELNTILTTLK 320
174 1.000e-77UniRef50_UPI00025591E8 DUF4837 family protein n=1 Tax=Ochrovirga pacifica TaxID=1042376 RepID=UPI00025591E8  ali  22  7..LLSIVLLVACGSDGEKKRDAADLKAESNGRINHVIVVVEPYDWKGKLEESFVELISDPIPGLPQLEYQLNVSTIPHSAFTKMFKNNRNVLKLDI-------------------------GQQENFRIYTDKYARPQTIVEVAAPDKKALVALIQKRGAEIVEAFKEGDIKSTQKEHASNRYTKKIDAL-NKLGVSMTIPNKYRMVMDTLGS---FLWMRSHIADQTNELLVYQAPLFDES--------KPIVNQIIKNRDSIGKMFIRGNDVDKMYMITEAARTPVVKEVRIHGKKAYETRGTWEVFGAYNAGPFLNYSIVDEKNNRVIVVEGFNYAPSVNKRDFVFELEAILKT.. 331
175 1.000e-77UniRef50_A0A1Q6HKA8 Uncharacterized protein n=1 Tax=Bacteroides sp. 43_108 TaxID=1896974 RepID=A0A1Q6HKA8_9BACE  ali  24  6FFFACSVLAVACSCGGNGGKQKSSVRRTAGSAPYELLLVTDKDWLKGMYGSLLTDVVMQDIPGLPQSEPNFRLTSINPADFNNTFKVFANILVVDISSKY----------------------KNAGVKIMRNVHVNPQLIITMYAPNNETFVNLLSEQGNNVVNMFVNEELGRERDYLRSAYSGKVLTKVKQMFGCQIYAPKD----LNDLKTGLNFLWATSEGRLNNLNMCFYSYPYTSDSTFTLNY--------FVEKRDSFMMVNLQGEHAQQYM--SLDRRSLTSRYISVDGHFVQEVRGLWQMENDMMGGPFVSYSQVDTINNRVIVAEGFVYLPNKKKRELIRMLEASLQTLK 330
176 1.000e-77UniRef50_A0A2H0JT91 DUF4837 domain-containing protein n=1 Tax=Bacteroidetes bacterium CG12_big_fil_rev_8_21_14_0_65_60_17 TaxID=1973924 RepID=A0A2H0J  ali  24  22HLLAGVLLL--CGAVMQAGCESLEYRPMAAGREGEIIVVMDSARWGGPVGDAVREHVAPYLGTLPAPEREFGLRRLSMTGQGDAIRAQKNVLIVAPLSDNTDEARFLKARLDSSSIAAVM-GGDTAIISRRDLWRQRQQVMYVLGATDDDLVRALESQGEDVRYQFNTITRERMREMFEKGRQPDLEQQMLDKHGFAVNMQHDWFTAIDTTSDSTGFIWLRRVSSESWRSLFLYYVDDFNPANLTPE--------WVQAARDRLSETWIHGNAGG--YTTTDYRRDLTSENIDFKGRFAYETRGLWEVKPFGMGGPFLNYTFYDEDTGRLYMLDGTVFAPGYDKREFLRQLEVISHTF. 381
177 2.000e-77UniRef50_F0IGU8 Uncharacterized protein n=7 Tax=Capnocytophaga TaxID=1016 RepID=F0IGU8_9FLAO  ali  28  9...FITLLLISCNEGEKKQ-----YLPQSVGSINSLTIVIDPPLWNGIVGDSLRHYFASPVEEISGAEPIFDIQQIPEDIFKGMTRASRNVLIVTTD-------------------------SKNRFDIRDTLFAKPQKVAFLIGETTDDLISEIKRFAPEIILTFKQNEMKEVQNRFRQTLNNT--KAIEQILNIHLTFPSVYNIVK----QENNFFWLERKVKNGTANILIYEVPKGKICANNKDCT-----EQIIHMRDSIGAQYVPGPEEGMY-MITSTAFAPTYSRIHINSYSTIESKGLWEVKGFILGGPFSNYIIEDPKRERCVVIEGFIAAPGTSKRDLLFELETIIKSV. 322
178 5.000e-77UniRef50_A0A256WIZ4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_77 TaxID=1972459 RepID=A0A256WIZ4_9BACT  ali  22  30............................STGGINEILVVTNNNQWKGEIGDSIRSTFTQDMLLLPIPEDEFKLVNIDDAAIKDLFKKHHNIFIVNIDP----------------------KIKDAFVETRTDLWAKPQIIIKVNAPNLHEFMVSFEELKENAFDLYVKNERERISTSYSKFKNINISKALKKHFHIDMNIPKGYSIANINDSKA----WIRKETAANSMNILVSVRPYQSTKDFDYI--------QVKRNRNDLTRTYIPGSVPGSYQTISDEYFDPILKEISFNDMFAVEFRGLWRVENDFMGGPFISYTFVDEKRKKLISIDGFMYAPKQRKAPLMRELEAILWSVK 329
179 5.000e-77UniRef50_A0A0R2TPP9 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium BACL29 MAG-121220-bin8 TaxID=1655598 RepID=A0A0R2TPP9_9FLAO  ali  23  7..IFFFLIIVSCGDNPS------SYKPRSSGNIHTVTVVMENALWNSQTGDHVRKVFASEFLGLPQQEPLFSLKQISPDIFSDFTRSSRNVLMVLKTKTDT-------------------------LRISKNKYAAPQVVVEVLGKNNKEIINQINLHAAKAIKAFKQGEIQEKQRRIKKSILETDE---LKSLYINLTLPSAYKVVKKEKESK---LWLQRETEKGSVNVLVYFIE-------NDKLIKKLNKDKIIQIRDSVSKAFVPGRNEASY-MKTEEAYEPYFFKTTIKGLKTLETRGTWEVVNDYMAGPFLNYIVQDKINQRLIVMDGFAFSPSIQKRQYMVELEAIFRSLK 318
180 6.000e-77UniRef50_A0A2E3BVZ6 DUF4837 domain-containing protein n=6 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E3BVZ6_9FLAO  ali  27  29.LFIFWALIFSCADNNQK------LLPGSSGNINNISVVINDELWDGEVGEEIRENFSRPIYGLPQIEPVFSLNHIPTKIFSGFATKSRTILKVDISEREGLAN-------------------------FKNTYASPQRIVQVTGNTSQKIISILNENINSIYSTLYFNEIKEKQRRISKNLNQ--TQSIKKHTGISLRFPSAYRVAKS----DSNFVWIRRDIETGSVNLFISRY-------------TNKNNKSIIEVRDSISKHNIPGPTENSF-MITDMIYKPNTQGVYLGKNQAYETRGLWEIDGQFMAGPFLNYLMIDSNEDEYIMLDGFVYSPGSNKREYVFELEAIMRSV. 335
181 8.000e-77UniRef50_A0A2E0JKE1 DUF4837 domain-containing protein n=18 Tax=Bacteroidetes TaxID=976 RepID=A0A2E0JKE1_9FLAO  ali  24  27...........CNSSTSKAXV-----PESNGNINSLTVVMNESHWSGELGEKVRNVFSAPYEGLPFDEPKYDLYYMPPKAFSGFARSSRNIIVFS-------------------------KDTIDKINLVKNPWARPQVVTLISGEDQDVMGFYLEENQDLILRTYSENERTEKLRRISKSPNKD--QDLTRKFNISLDYPSVYSTVK----DTTNFIWIEKEVLKGHLNLIAXTLPLDID--------LKNLQIRIPKIRDSIGKIYVPGRLPNSY-MITEKAYRPYFYLTKINEMESILTKGTWEVENDFMAGPFVNYIVKDTQNNRYLVLEGFAFAPTESKRNYMFELNTIITTLK 329
182 9.000e-77UniRef50_A0A2S7UA77 DUF4837 domain-containing protein n=20 Tax=Flavobacteriia TaxID=117743 RepID=A0A2S7UA77_9FLAO  ali  24  6YIFILLITLTSCNDAP-------VIVTDSAGRMNDILLVIDNDLWENEVGDSIRQILAAPVDGLVREEPQFSLNQIEPDSFAGLLMKNRNYLKVEV------------------------SNKEPGVSVTTGLYANPQTGVIIRGKDAAGIIEQIVNNAQQIKTIFNDGEIKEKQRLMKKVGLNV--DQIKERFNIELIAPRSYRYA---APDDKDFFWLRRNIKEGTMDIMIYEV------GRHKIPQDSNVVASITKVRDSVGSLKVP---VDNGKFITERAFSPYVNESQVDGKFAYETKGLWEVSGQFMSGPFLNYAIYNEEKNNWLVIEGYIFAPSAKQRNYLFELESILKSVK 319
183 1.000e-76UniRef50_A0A1F3KHG8 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3KHG8_9BACT  ali  25  10.CLLIVLFLSSCDNIGTSGS-------KATGGTSELLIITDTEQWQGRVGDSLKAFFNRYVYALPQPEPQYDLLHASIKKFENLYISHSTILILHSDKTVTT----------------------PTIDVKRNQWASPQVIITLIASSDSALLSAFSQYKAAIDELFKKNQFERAQNLYKISSGKEAEALLKSKFNIDILIPGSFSIA----LKSNDFLWLRRKKQDTELGLIFYQLPYRDTAQFGLSH--------IIRQRDSIGFNYIKGPTDGSYMASSVDVIPP-IREVSEDKETGYRTRGLWMMKKDFMGGPFITYTLYNKKQNKILTAEGYAYNPNGEKRNFMIQLEAILQSI. 333
184 1.000e-76UniRef50_A0A2J6ICD4 Uncharacterized protein n=2 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6ICD4_9BACT  ali  21  10.ILIVSTLLFSCTQQTKSK------KPRSIGNTSEIIVVVNENQWDDTIGVSIKKAFAADQYGLNQSEAMFRLSHVKQKDLSDLLRKHHNLFVVNID----------------------RSAKKPLLEYSDNLYSEPQSVYKLTASSEDEFVRIFNNNVDRFIQSFQKTDRDRILEVFRSTQNAEAVTQVKKKTGIKMVIPKDFYLAKDL----NDFIWLRKEQVDMSQALFIISDEYIDTLQFSKESILSRIKTSL--------KNNVPGAVYNSYMSIDEEFIPPVSKVITFPGEYAVEMTGAWKVVNDFMGGPFKAYTFYNSSTNKIVTIMGYVYKPNSDKRNLLKQVEAMIYSIK 329
185 1.000e-76UniRef50_A0A1V5W0Q0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W0Q0_9BACT  ali  23  15.LSTCMLFITSCSEGGLMGGSNLG------GKSGELLIVINDEYKNSQTSETVTEIMNQYEIGLTQSEAPFSILMISRNHFSSVFRSHRNILFIDIN----------------------KKFISPLVQFKKNVWTKQQNYIGVGVESPEKLLEILKLRHDNIIDFFVQAEIERFKLAYQSMPGNKVKTLVQQHLNIRLDIPEGYEINK----QAPGFMWISFESNEHSQGLLIYERAYRDTMQLE--------KWKLLQYRDSITKAYIPGPSKGSY-MTTEYIVPIQYKVGRYNNDYTVELRGKWRVEHDFMGGPFVSYSFVDNSKKRLVTIEGYVYYPNKSKRNFVRQLQAICQSV. 331
186 1.000e-76UniRef50_UPI000931579D DUF4837 family protein n=1 Tax=Porphyromonadaceae bacterium FC4 TaxID=1720317 RepID=UPI000931579D  ali  21  15.FLLGVLLISGCNKKTKKNPFG------ATGTPSSLMVVLPDSLDAQEVKDSIAAAFGKPVFVLPQKEPMQDLMYTPVGNFSSMFRSLRNILFVSIDPKMYT---------------------QPSVSIVRDHYATGQLLIHAKAESLTSFYRLLRVRGEQLSKYVYNEELKRWETVLEQTYSSPFARMVEEKFGITVNVPEEMKYY----HEGEDFAWASNMDTKRRLDFVVYSFPYRDENTFTLDY--------LIHKRDSVLAKNIVGQYDGSF-VTTEKRVTPSFRGFTYKEAYRAEIRGLWAMVNDMMGGPFVMHALLDSAQQRVIVAEAMVYAPSAKKRNLMLYNEAALYTL. 332
187 2.000e-76UniRef50_A0A2E0FHK4 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E0FHK4_9FLAO  ali  24  17FMAVTTFLFQSCGEELK----LDDMLPEYSGQPNEVYVFCDNVIWKDTVGAFVLEHLEERTKNLPQPEKRFTVYQFQSDDMNKARLTHRNIIKLVVDQRN--------------------ENKKAAIIRKGSRWAKNQLLYEFKGPNVSDMLALIRKELPGVLEEIDLKERERALVKFRKRTNLTAQKKLSEALNLDLVIPKRLSLHKTVIDSAESFAWLEAKGKSPDQGIFIYSYPYVDDSAFTYKH--------LISKRDSVLKKQVPGSRAGQYLKTLKMDGKPDYKEINLLGNYAVEMRGQFTMHNGFMGGPFISLTTYDENRNRLVTVEGYCYAPQLKKRDFLKEMESIVYSI. 349
188 2.000e-76UniRef50_A0A1T5BTV0 Uncharacterized protein n=69 Tax=root TaxID=1 RepID=A0A1T5BTV0_9FLAO  ali  23  9.FMAILGLSIACKEEGKA-----DYLPESVGAMNTLTVVIDNELWKSSVGDAIRENYTAAAQGLTWDEALFSVTQVPQQIFSGSIRNTSSVLYV-------------------------MEDSLNVAHMKSNMYSKPQNIGVIKGRNKQELIDNINKTSAEFIKDFKTLEISKAQKRFEKSLNKE--KALVDKFKISMKIPSIYRV----GREEDNFVWISREIQKGNMNIIAYTMPE------NGFHNDSTFARDIIRMRDSIGNLYIKGSDVKNNHMITEKAFTPYVFPAEVSGKKAAEVRGIWEMSAYPMAGPFLTYIINDKENNRKLILEGFVFAPATKKRDYMFELEAILKSVQ 326
189 2.000e-76UniRef50_A0A0A2GWN7 Group I intron homing endonuclease n=15 Tax=Bacteria TaxID=2 RepID=A0A0A2GWN7_9FLAO  ali  23  9..LVTATILFSCSNGDGK-----RILTESVGNINNVKVVLTKDQWQGTIGDALRDVLADPVYGLPREEPKFSIDQIPPEAFGDFL--LKNRIFVQIKPADSAT-----------------------VTIVNDKYARPQTGIIITGKSETQIANLIIDNEEKIVTALKNQELVANQRRIKKALKNT--DSLRKTFGVRFNFPNAYRYA----EQKPDIFWIRKDLKRGNMNITVYEVP------LQAIDKDTLTIKNIIRMRDSIGGKKIP---VDDGRFITERAFSPYLQETEIDGKFAYETKGTWEVDGRYMAGPFVNYAIRDEENGRYLILEGFIFSPSQDQRDNMFELESILKTAK 321
190 3.000e-76UniRef50_A0A1Z9DG00 Uncharacterized protein n=2 Tax=unclassified Crocinitomicaceae TaxID=1986672 RepID=A0A1Z9DG00_9FLAO  ali  19  20.LAALAFVFTGCDSPEEAAAARAAMLPGKVGPSGEVVMVVSQGAWNRGIDAAVDSVFRRPVRVLPQYEPRFDIIRLDPEEFDRFWRPHRNLXVFDIADRIDTQT--------------------PSMRVMRSRHAKGQIYVEVKGRTAEAVAELLLDEGEMLADLLEDEEAKRYAELLALDRNAVLEQKIREAHGLTSVLPRDAQLVQS----RGGFLWVERNNHDVQLGIVVHRTPYAGPSDFT--------MDRLLQRRDSLLQARVFGGKEGSY-MTTEYRLSPRYEEVSFRGGFAAKMRGLWKMEGDFMGGPWTSMSWVDSERGQLVTVDGYVYAPYFGKREYLREVEAMVRSF. 358
191 3.000e-76UniRef50_A0A133Y197 Uncharacterized protein n=2 Tax=Bacteroidales bacterium KA00344 TaxID=1497954 RepID=A0A133Y197_9BACT  ali  24  1........MTACNEKQG-------ILPKSGGRLYEVLVVGDTD-------DIIRNVLEADVEGLPQHEPEFDVSSIASSQLNATLKLARNLVTVSINPDLYTTTR---------------------IRYEKNVYAQPQMVIHISAPSRKSLREDLNAQGKSLLTLLKRAETNATLLQLEHQRNAKAEHTIQEKFGHSLWIPMDMLSTK----EGKDFVWLSNNSPTGMQNIVVYR------------SRTAKSTHEFVANRDSVMRKNIKGETDAMHMKTVLK--TVRGVRIKEKGREITIYRGLWEMEGDEMGGPFVSHSIGD------LTVEAFVFAPGMKKRNKLRQIEAALYTLK 292
192 3.000e-76UniRef50_A6EL97 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A6EL97_9BACT  ali  22  9.IALFVITLSSCDNNQKTTK----ILKESVGKINGLQIVIDNELWNGPVGEIIRERFAAPTDGLPQDEPLFSMRQMTPEAFTGFARTSRLFLHVSL-------------------------GNEEKVGLNNEVYASPQMGAVVEALTEEGLVKQLEENSDAIINSFKEAEIKERQRR--TNIQLLPVPSLVEKMGVTMRLPSAYRFVR----ENDDFFWLRKNLKSGSTNIIVYQVPL-------NTIRKDSAIADIIKMRDTTGSSLMPVEEGGLF--ITEGAYAPYLFETELDGKFTYETKGIWEVKDQYMAGPFVNYAVMDEENDRWLILEGFVYAPSEEKRDLQFELISILKS.. 320
193 3.000e-76UniRef50_A0A0A2GBY2 Uncharacterized protein n=4 Tax=Porphyromonas TaxID=836 RepID=A0A0A2GBY2_9PORP  ali  21  19.IAIFSVAFLSCKGGSNTFN-------SASGSPGELLLVMDEDLLSSPSGEIVKGMLQTEVTALPQIEPWMKVQTVATRNFEDFLRNTRNIVIVQNDGSVYTH---------------------NAVKYSYDEWAKGQLVVVLQVPSKDSLQALAEQKGEMIRNLLLRHELYRYAEMWEKSFSTKADTYSQEMFGYRINLPEDFQSYK----KGDNFLWVSNNAYSKRMDVVIYRYPYSDKEDLSKE--------RLLALRDSILGKNIPGATPDSYMTTTEGSTKHRFIKKT-NGAIISELKGLWETSGSAMAGPFVAHAFAVPEEGMMYYIEGFVYHPNENKRELIRRLQATLFSF. 335
194 4.000e-76UniRef50_A0A2K8X6Y1 DUF4837 domain-containing protein n=5 Tax=Nonlabens TaxID=363408 RepID=A0A2K8X6Y1_9FLAO  ali  23  7.ILAICLAFISCND-------QAIVVQDSAGRLNDILVVIENNDWDGALGDTIRKEFARPLDGIVREEPIFTLNHVKPTAFKGMLKKSRNYLYLKKSDSSG-------------------------VSVKKDVYANPQLGIVVRGKNKKEIAQVISENADKMIALFNQGEVERKQYLMDKVALNT--DRLTERFGFEIIVPRAYHFATYNGEMDNDFFWLRRNITEGTMDLMIYEVDR------NRIKRSDSTVMDIVKVRDSIGAIKI---LTDGGPFQTEPAFSPFLNESQIDGNFAFETKGTWEVKNMFMAGPFVNYAIYNKEKDNWLIIEGYVSAPSSKQRNYLFEIESILKSV. 320
195 5.000e-76UniRef50_A0A2E2Y6M0 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2Y6M0_9FLAO  ali  24  11..VLFFIILSSCSTNPDGTIKDTRILPPASGTHSELLLVMPDELWVGAAGQAFRDLYLADQEGLPQSESYFDASRVEPKDVNRILQKTKSIMWVEKSDT-------------------------SFVKMQKDLWARPQRIVRVTAQSEKQLVEEIKGSAKQVIDAFKEHDMSVIQGRLRKSAYAYTHENL-KKIGINMLLHKGF----DPTLDKENLKIFATKTVKTIQYIMVSERPMTEGMV---------SVDDIIAHRDSIGKKYFEGTHVDSY-METELLIPPFTETTEISGMFALETRGLWRMENDFMGGPFLSYTIYDEKNNRILTVESLLYGPTAKKRNVVLEMEAMMRSI. 330
196 9.000e-76UniRef50_A0A0A2EP04 Uncharacterized protein n=5 Tax=Porphyromonas cangingivalis TaxID=36874 RepID=A0A0A2EP04_PORCN  ali  19  9YVLIAISLLTGCGRSKGRQTPFE-----ASGRALQLVAVLPDAHNNEEFKATIEETFSGPIGILPQEEPACDMMYTSHSGFDKLFRIFRNILYIDIDEQKYT---------------------RAGLHISRDEFAGSQLIITAKSPTLESMKELLISQREYLSDLYYKEELSRRRRDLAHTYSSKMTKMIEDSIG---GVTANPMVEIKYVNGKKGFVWGSTQDPKGRIDIVVYDFPYTDPNTFTTNY--------LVRMRDSVMMANIPGEYPNSY-MSTEKRFPQKFTAFELDGVYRAEMRGLWQMEGDMMGGPYVMHALVDNANGRVVVIEAFVFAPGKDKRNLLLNGESVLYTL. 328
197 1.000e-75UniRef50_A0A2E1JG20 DUF4837 domain-containing protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E1JG20_9FLAO  ali  21  16........FASCQSDSSKA-----FVPESNGNINTLTVVMDKGSWXGDLGKKIKKVLTEPYEGLPFDEPKYDLYHLESSIFTGFARSSRNIIVFNKD------------------------TTDQGFRIIKNLWARPQITAIITGEDEAVMSFYFEEXKDLLMRSIDENERIXKIRRMSISPNKD--KELKERLGIALTFPDAYETVK----DTTNFVWIEKQVVKGHLNIIAYTLPLDID--------LKKIEERIPKIRDSIGEIFIPGRVPGSY-MITERAYLPYYYKTKVNRLDAILTKGTWEVQNDFMAGPYVNYIINDTINKRKIVIEGFSFAPSESKRNYMFELNTIITTMK 322
198 1.000e-75UniRef50_A0A2E0YAY7 DUF4837 domain-containing protein n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2E0YAY7_9EURY  ali  24  22FIIFLISITLSCNNTPTT------YKPLSSGRIHSLSVVVDSKEWNSRIGDKIRKTYADEYLGLPQVEERFSLSQIDYETFSGFARTSRNIIYIN-------------------------KRNKQGYKIIKNKYARPQLFLEISGLNEAEIINQIKASKDVGIEVFTKGEILENQRRILQSPL--TQKDLKNDFGIELTMPSAYQIFK----KDKNVIWFQKPTKYGTSNILI----------SNLKPVKSIELEQVIKIRDSVSKTFVPGRIEETY-MITEKAYLPVFKKTFIKNFESFETRGTWEVQGDFMGGPFINYLVKDSVNNRTLYIEGFVFSPSQRKRDNIIELEAIIKTLK 332
199 1.000e-75UniRef50_A0A0C3RGQ5 Uncharacterized protein n=16 Tax=Bacteroidales TaxID=171549 RepID=A0A0C3RGQ5_9PORP  ali  24  7.ILVSVVLFASCKNAMKNMS------PAVSGKVNEILVIADKNVWDGQVGDSIRAWFQQDQEGLPQVEPLFDMLNLPELHFDKNIKGHRNILKVEISPSVDSAS----------------------IQYMNSPWAKSQVYFKIKAPNNKEFMEIFEANKSRMLGIYTKAEKDRLVSIYKRTADSRIFNLFKKKYDILLYCPTGYYVNK----DTTGFVWISSETTRDSKGICFFTEEYRDQNQFN--------DRVIIETVNEKLKQFIPGPLKGSY-MAIDTDIRYTAVQYDYQGNYAIMIRGLWTVINDFMAGPFVLNVVLDQEHNRIIYLMGYVYYPNENKRNMVKQVEAILNTME 323
200 1.000e-75UniRef50_A0A2E0VT09 Uncharacterized protein n=1 Tax=Saprospirales bacterium TaxID=2026790 RepID=A0A2E0VT09_9BACT  ali  20  8.VLFLTVILSACTSDKKDHPLKKGGIETAFGKVNQILVVSDSSLWTGPVGDTFFYYFAGPYILTPQPEAIFDITHFTPQAFSGSRKEFRMILLVDMNDPDEATARMIRNDLGEQKLEQIRRDKGCSVVVGKDKWAKNQTIFYVVGFGEDKLADCIASHFPVVAKRINEEDKEIIATVYQADLNYDLKAEVLGQLGLELRVPGDFKKAKNNTQ--LDAIWLRRDVRDAHIGIIVHKRPYTSKKQLSKAG--------MKEIINELG-TMVSSWIVDSKMRVDDVNLPMFIETTSLDNKYAVVGRGIWEMDNDFKGGPFVCYEILDEKNGQLYVLYGYVFAPGEDKRNYLQEVEHIIRTAK 359
201 1.000e-75UniRef50_K4IER5 Group I intron homing endonuclease n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=K4IER5_PSYTT  ali  23  21........VYSCNDNKTSA-----YKAESSGNLNQLSVIITNEDWQDSIGEKIREIFAADVDGLPQQEPKYALRQIPPMAFSGFARKNRTFL-------------------------KIEKSKETGHQILLDSFAKPQFGIAITGSNQQTIIEELEQNKDSFLGKLHDTELKEKRRRMSKAPKKV--DVLTKSLGVSMLFPSAYRYAK----QEDNFFWMRKDIKNGSMELLAYEV------SKSTIERNGDIIANVIKMRDSVGK-NIPGPTEDT-HMITEEAYAPYLFETEIDGKFAYEIKGTWEVKGFFMAGPFLTYAIRDDKNDRYVILEGFVFKPSSSKRNQMFEIEAILRSAK 327
202 2.000e-75UniRef50_G5SNZ2 Uncharacterized protein n=3 Tax=Paraprevotella TaxID=577309 RepID=G5SNZ2_9BACT  ali  20  16..LCLACMCFACGGGEKKAP-----LGPSKGLPGELLLIVDASLWKTSARDSLEDVLKGSVPGLSQHEPMFRMIRIFPENYSGQYSTMRNIIEVREDPQADGVE----------------------MGVAYNVKAVPQTYVNIKARDAASLNHFLMTHREQITDLFLASEMQWEAARLKKKYSKIVDDASRELFGYTVKVPADIAKVK----KGEQFIWASSDRQTQDMNYVCYSLPLADSSMLLTK--------RWVELRDSVMKRNIPGSTPENWMTTTRENGEPLVVQRSVDGRQVYEMRGLWEMRKGALGGPFVSLAYPDSAQGRLLVTEGFIYSPDTNKRDLVRRMEAALRTL. 335
203 2.000e-75UniRef50_A0A2D9Y392 DUF4837 domain-containing protein n=20 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2D9Y392_9FLAO  ali  23  8..LICALVIVSCKQEKKDTSDKPTVMAKSVGKINEVSVIVEPQLWKGNLGDTIRKYLAAEVPGLPQEEPLFSMRQMPEDAFTGFARKNRTFL-------------------------KINKGADKDFQVLESKYANPQIGFVISGKTDEEIAALIRDNADRIIKDYKDIEXX--XXXXXXXXXXXXXXXXXXXMGITMDIPTAYRVAI----EEDKFFWIRKDIEHGSMNLMIYEVP------ISKVDKDSNTIASIIKIRDSVGAEKIPTE---SGNFITEEAYAPYLYERTIDGKFTYETKGTWEIKDRFMAGPFVNYMIEDKKNNRYLVAEGFVFAPSTYKRDNMFELEAIIETIE 325
204 2.000e-75UniRef50_A0A2A5XU12 Uncharacterized protein n=13 Tax=Flavobacteriales TaxID=200644 RepID=A0A2A5XU12_9FLAO  ali  23  9..LLFSSLIIACQSNTSQA-----FVPESNGNMNALTIVMSKSSWGKNLGKQVQTSLTEPYEGLPFDEPKYDLYHLDPSIFSGFARSGRNIVVFNKD------------------------TTEQGFKLIKNLWARPQIAAIITGEDDEVMSFYFEENKSLLMRSIDENEKVEKIKRMSKSLNTD--KELTERFGITLTFPDAYQTVK----DTANFTWIEKKVVKGHLNIIAYTLPLDID--------LGKIEERIPKIRDSIGELFVPGRVPGSY-MITERAYLPYYYKTKVNSMDAILTKGTWEVQNDFMAGPYVNYIIKDTINKRNIVIEGFSFAPSESKRNYMFELNTIITTMK 321
205 3.000e-75UniRef50_A0A2E0DIW3 DUF4837 domain-containing protein n=2 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E0DIW3_9FLAO  ali  24  4.LIFVFLVFLSCENRKNK-----PYIPQSSGNINHVSIVMKEKDWDSRLGEDVRNIIGDIYQGLPVDEPNFKFFHISPKQFSGFSRHSRNIVYF-------------------------QNDTINKFTIYKDLYAKPQLFFLIQGEDEDILANYLTENKSLIINTIKDGERREKISRIKKSPSK--SNVLSERVGISLIYPSVYKKVK----DTFNFVWLEKQILKGTLNIISYRLPESSLS-------DSPKLNEIIRIRDSIGQLYIPGRLGGTY-MITEQDYKPYFYKLNMDKKTIFQTKGIWEVKNDFMGGPFINYLLKDNKTNEWIIVEGFAFAPSVSKREYMFELNTILSTI. 316
206 3.000e-75UniRef50_A0A0R2RW78 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium BACL21 MAG-121220-bin10 TaxID=1655592 RepID=A0A0R2RW78_9FLAO  ali  22  5YAFIITVVVLGCGQNSNEKKTA--YLPDSVGGINGLQVVIAEDLWRGPVGDTIRSIFASPAPGLPQEEPLFTLNHLPLAQFSDFARTYRNVLHVALAETDT-------------------------LAMRKNAYAQPQIIAFVQGKEPQDLIQALIEQKTTLTQTFLIQEIKERQRRTMISPLAIAG--LTRDFGVELNIPSAYHIA----AESSAYYWLRKELKNGSTNIFIYEAPLESFPEGTNPAI------AMQHIRDSIGAMLLP--VEDGSKFITDNNYQLHTESTTIEDRMCYVTKGLWTIDDAFMAGPFVTFAIRDETRERYLILEGFTYAPSMSKRDLQFELESILRTV. 322
207 4.000e-75UniRef50_A0A1J1DZL6 Uncharacterized protein n=1 Tax=Ichthyobacterium seriolicida TaxID=242600 RepID=A0A1J1DZL6_9FLAO  ali  28  5FIILTLLSLISCFDDNSK---KDIFLPESVGSTGELVIVIDDDLWNFSIGKTLRKILAKNKKGLPQNEPIFRI--LKTSENNDIFSKHKNILFVGN-----------------------TSNEKVVYEKHIDLYAKPQIVQKLNGNDIESLMELIEKNAENIVYNYMDHDIKYLQKNIDESKLYLVPELNRK--NIDIKIPNSYFRA----DSTDNFFWYRKETRKSTFSIMLYIIPITD--------KVNFQYVNPVYLRDSVTKKNVKSDIVGAY-MQIDKAYIPYVDTVDINHKTAVEMRGVWEMKQDFMGGPFVNYLIKDIKNNRVICLDGFIYSPSTPKKNMMLELEAILKTVE 320
208 4.000e-75UniRef50_A0A2E2FNE8 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E2FNE8_9FLAO  ali  21  8.FICSVVLLTGCSSSSQKMIPAFSGSVGEVVVV------VPNPDWNGRVGDALKAVYQEPQYGLPQQEPMFTVINVQKANFTSVFETFRNIVRVHIDP---------------------QMQGKANYEMKKNQWAKDQIVVELYAPDKDAMVTLLEENKSNLQEIFNLKEIDRLIKRNNKFGSQKEVETIEATLGVSMVLQKDVRIAKL----DSNFMWLRRERPKGSQGILVYSYDYTDQEQFS--------DSNLFAVRDSLIGTHVIGTSEGAHMVTDYKYAPPLVREIDYRNHYAKEMRGLWRMTVDIMGGPMYSLVFLDEQNNKIILASGYVFAPEFDKLEFIRETEAMIKSI. 333
209 4.000e-75UniRef50_A0A255ZZS4 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A255ZZS4_9FLAO  ali  23  19...................DRDSTALPQATGAVNSLSVVIPDQLWDGEIGDSIRKKFAAPVDGLPQEEPQFTINQYPLRALDGRL-TARNVLII-------------------------KKEDRSEYKMVRNEFAEPQHVAHISGKSIPDIITVLDEHVNGIVSQFKANEIAYSQRKIDTS--KLETELLKKRFKIDLLISNKYKVALSKR----NFIWFKREILSGNTSLVVYRVP------TSAIFKGGNVAGNIIRVRDSISRKYIRGKERGS-KMQTEESYAPYFAVGRLNGRRIYETKGTWELKGDFMNGSFINFAIRDKKRNQFVIVEGFCYAPSTEKRDLMHELEAMIKSVK 319
210 5.000e-75UniRef50_A0A0A2MS41 Uncharacterized protein n=7 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0A2MS41_9FLAO  ali  24  17.........TACEKTAKQGEF---ILPASTGNINSVSVIIDDVLWNGEIGDELRKKLAAPVDGLQEEEPLFTLNQYSPKFLGGNVKLGRNIVIIS-------------------------KAPGPEFKHVMDKYAVPQNIFYISGHNLNEIIETIELHAPALTSSISYSEIIEYQKTNAKALFDD--KKIKQKFNISLQIPNSFSYALM----KNKFVWLKKDIPSGNSSLLIYQVPFSSF-------KKGDAVHNTIRIRDSIGSKYIHGMMDKSS-MQTEESYYPYVSKTTIDGMPAFETRGTWELQNNFMNGPFLNYVIKDVKNHRYIIVEGFVYNPSSAKRDQIFELESIIKS.. 322
211 5.000e-75UniRef50_A0A2T2V334 Tryptophan synthase alpha chain n=1 Tax=Bacteroidetes bacterium QS_9_68_14 TaxID=1919111 RepID=A0A2T2V334_9BACT  ali  22  314.VVVLGLGSAGCIDGT-------DYRPEAAGPPGEVTVVVDSTLWNGAVGDAFRETLGAPISTLPQSQPSFNLRQIDPQTLERV-KGHKNVVVAAALGASSQEAEYLSQQFSQDALQAVRDGG---VVPRPDLWRRQQQVFYMAASTPSGLAETVRQRGPALVDSLNLATRRRAHDRMFEGRQTALEDTLMQNHGFAVDVQHDYQIVNDTTFTGGGLALLVRRLPDTWRRLFVWYKKDAQPSTITRD--------WVLSKRDSLAGIYLQGGRRGA--AVVDRRRTLQVESVDFLERYAYETRGLWYMAEDSTGGPFVNYTFYDQQQERIYMIDGTVFAPDYDKREFLRQMEVIAHTF. 661
212 7.000e-75UniRef50_A0A2W7NG94 Uncharacterized protein DUF4837 n=1 Tax=Cytophaga xylanolytica TaxID=990 RepID=A0A2W7NG94_9BACT  ali  26  25.................NACKSDPVKRSPQGTTGDMLIVMDDTIKASPAGQLLQEFMTQPMLGLPQEETLFTLSVAPHRVFGDQMKASRNIVVVEQNNANFRDT----------------------IIYHRDYWASNQAVVNIYGANSTKMHDMIKNAEIKLLSYFLKSERDRSIAHMKKYPHHAIVDQIKTTWGKSLVIPNSFKERKM----TPDFTWVSHETDITSLGIFIYQFDWVGDGTFSKEY--------LLNKRDSILQKNVPGPEAGSY-MGTEFQFPIIYKQFTLNNEKVAEIRGLWKVVGDMMGGPFISHAHYDPTTNKVTVTEGYVYSPEKNKRNFIWQAEAILYTY. 331
213 8.000e-75UniRef50_A0A0Q5USY6 Endonuclease n=121 Tax=Flavobacteriia TaxID=117743 RepID=A0A0Q5USY6_9FLAO  ali  21  17...........CNQKEVKNSDKQ-----SVGNTNSLAVFIDDKLWIGEIGDTIRKKFAAPVDGLPQEEPLFTINQYPLHAFEGSLAKNRNILYI-------------------------KKEAKNDFNFSENQFGVPQNLIRISGNSTASIIGHLEKNAAEIIARMQQTEIEVTQNQIKASLMDD--KKFRNKFNISLLVPKTFKVV----LEKDKFLWLKQEIQTGNSSILIYQVPLHSI------KKNDDAINNIVRARDSIGGLYIHGTTENS-QMITEDSYSPYLINTTIGGLKAFQTKGNWELRNDTMSGPFINYSIIDAKNNRILVIEGFCYAPSTPQRDLMHELESIIKSI. 320
214 4.000e-74UniRef50_A0A0S2I0G1 Uncharacterized protein n=1 Tax=Salinivirga cyanobacteriivorans TaxID=1307839 RepID=A0A0S2I0G1_9BACT  ali  22  6FIAIIATFFASCTDMSTATGG---------GREGEVVVVLDKKFHETKAGDYIDTVLGAPVYGLPQYEPMFKVYMIPWNAFSNTFRAFRNIIKITISSGVS----------------------KPKVTVKR---ADMQVVFHFKAPNESAFVELLMKNEQQLLDLLNYTEKKYAKYKIRQGVNKNLRKYTLKNYNLHTTFPKGYEV----RLDTSNFLWVSFETKDMSSGAFIYHFPYEDTNTFSKEY--------LLNKRDSLLELYVEGPTRDTYMTTEYRFIPPKFTELMVEKKYYTEIRGLWTVVNDFMGGPFIQISRLDKKRNRVVVFDGYVYNPGGNKRKFVRFLEAIGYMIK 323
215 5.000e-74UniRef50_A0A2D7MSP4 DUF4837 domain-containing protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7MSP4_9FLAO  ali  19  16FIVVSTLFFIGCND----VIQQEKFLPESTGSVNQVIVVTTDTIWKGGVGDSIRKYFAAPLEASTIAEPEFTLTYLPQPIWKGAITKSRNVLYVLTD-------------------------TLEAAHIKKNLYARPQNIAVVKSKDLENLKNNLFKVAATAKYIFRETELELAQARFLKSLSSKA--LFDERLGFSLRLPSIYQL----GVDQDGFLWYDRPVEGGTINLMAYSLEKG------YFADRDSFLDQILGLRDSIGKKYVPGPDVPGTYMISERTFAPYVRPTEVGGFKAVEVKGIWEVQNYPMAGPYLMYLVNDTINKRTVVLEGFTFAPSKPKRDFMFELEAIMKSIE 336
216 7.000e-74UniRef50_A0A2E4EES0 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E4EES0_9FLAO  ali  23  6..LALSLFHSSCEEPQSS-------LPGYAGGFGELLVVVPNSIWKSPLGDSIYNYLGAMQYGLPQDERQFNIIHVTPQKFKSVLQTHRNICIVSID-----------------------SNTVRPITLEKSKWSRGQIVITLSAKNSARLLNTVREHAPRAAEIFASAEVNRHYLRNKKFGSKTLNQEIGDQQQLTITTQKDMII----ENYKEGVSWLRLERHQISQGILLFSLPYTDESNFA--------DSNIYHVVDSVLKVNLPGPGENQYMQLNFRYIVPQGTEINFKDQFGKEYRGLWRMENNAMGGPIYLLVFLDEKSDRVVYAYGYVYAPQFNKREYLREVQGVIHSI. 327
217 8.000e-74UniRef50_A0A2A5XHW5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium MED-G21 TaxID=1986267 RepID=A0A2A5XHW5_9BACT  ali  25  8YVFSFAIACGSCGNKNKSATATQSILPSNTGNLSELVLVISDELWADTAGRIITDVLQENIKAIPQQEALFDIYNIEAKDFSSIFKTHKNVLWISKSED--------------EKFERIDQ-----------MWSKDQLYVHLSSASEEALINNLKEHIYTIRSWFVDKDQQRRLQKLKTSADKEMEKQLQKSYGLNMTIPKGYQIASS----EKGFIWLRKDNPKANINIWIHSQAYINTEQFNKQY--------LMTLRDSIGKVHVEGSRPQSF-MATETLYNPDYRLVK-NKPYTIATKGLWTMVNDFLGGSYTAYAILDEEKQRIIYVEGFIYCPSERKRAHIFELEAILSGLE 333
218 1.000e-73UniRef50_A4BXZ1 Uncharacterized protein n=11 Tax=Flavobacteriales TaxID=200644 RepID=A4BXZ1_9FLAO  ali  24  1....................................MVVTKASDWTGDLGTAIRSAFGELVVGLPQPEPTLSVSQIAPNAFGSMTNISRNILIIG-------------------------EGEKEDFYIKKNVYAKPQTIIYVYGTDDASIIKVFNEYKNEIISAYISSDILMTQNIFKAKQLALSQLKTLEEIGVSFTIPEEFKTVK----DTGDFLWLRQHAKTGSNNILVYSIPLEEES---------KVSENIIPIRNAIGKKHIPGSDAETMYMTTEEAYTPQTLETVVDGKKAFETRGKWEVKNDFMAGPFVSYFVVDKKHNRIVVFEGFTYAPSVNKRASLFELEAIAKSMK 290
219 1.000e-73UniRef50_A0A1N7MHV9 Uncharacterized protein n=6 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A1N7MHV9_9BACT  ali  27  13.LLFLAMAFWACEETEENKNSK---KPKARGAIGEIIIAIDSAKWQGQVGDALKDIFEADVKGLIRDESMFTVRRVDPRAMTRILKMATNIVYVTTFDDRSSASQNINALFSKEAKEKASADPSLYMLRSADEYAVGQELIYLFGKNDQELISNLRANKNKLQNLFHVRERDRLEKALL-ARKSSAARVAGEKLGLSINVPASYQIAKA----ENDFLWLRQPTPRTDRSLFFYEMDYTSEDQVFPEE--------IIKLRDKIAQAHLYGDPRNSYLIIEKVDPSPVFSNFRINDNFAVEIRGGWKTNNLSMGGSFLAYVMVDTEKGKLYYMEGFVYFPSQNHREAIREIETLL.... 355
220 1.000e-73UniRef50_A0A1B2YT19 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1B2YT19_9BACT  ali  26  6FVIIILSVLQSCGEK------NAVYKPGSSGRINSITVVLDNKSWDNKIGDKIRALYADEFMGLPQIEERFTLKQMPYETFDGFSRTSRNIIFIN-------------------------KKSELDYEFQNNKFANPQIYLEIRGTSLQSIIEQLDLSSNEAIRKFSNGEIEENKRRILKSTMNDL--KPIDKFSISIKMSSAYSLYK----EEKNFIWYQKPIDKGHSNLII-------TELFAGKDVFDYTIDEVTSLRDSVGRSFLLGRNENSF-MITEKEYLPLQKKINYYGIKMLETRGTWEVQGDFMGGPFINYIVEDKVNNRVLLVEGFVFAPSKRKRDNIIELEAIIKSIK 319
221 3.000e-73UniRef50_A0A2E1N338 DUF4837 domain-containing protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1N338_9FLAO  ali  26  7.FLSFLTLIISCKEN-----NPELLLPESNGTINSISVVIDDGLWESEIGALIRKEFAYPIYGLPQMEPVFDLKQIPTSVFSGFATNSRTILKVGLSQT-------------------------ERFTTYKNKYAKPQLIIDLSSVSQQKLKEQISNSKAKVLSRLYAHEIAEKQRRVLKSKNP--TKLIKEIFGFDILFSSSYRIAKSS----KNFLWIRRDTEKGSVNFYISKI-------------KNKENLNINHIRDSISKKFIPGPIE-KTHMSTDKSYSPKSNEIQLTESKVIETRGIWEVKNQFMAGPFISHIVSNQKNEELYILEGFVYSPGTTKRDYIFELEAVFKSIK 316
222 3.000e-73UniRef50_A0A2T2THL8 DUF4837 domain-containing protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2T2THL8_9BACT  ali  21  19............GMSSAGCLEGSNYRAVAAGPSGEVTVVVDSTRWNGAVGNALRQTLGQSIETLPIPEPAFDLRQMDLTTQNEQVKRHKNILVAGALGTSSQEAEFLRQQFSEQARQAVERSGGT-VVAQPDLWRRRQQVFYVAAPTPDQLAATIRQQGAALRDSLNVATRRRMSDMFEEGRQFALEDSLLSRHGFAVKVQHDYQIATDTLFTGEGFVLLVRKLPDTWRRLFVWYRDRADPATISRD--------WVLSMRDSLAGEYLQGAQQGAAY--TDRRRTLNVEEVDYLGRYAYETRGTWYMAVDTTDAQFVNYTFYDQEQERLYMIDGAVFAPDYDKREFLRQMKVIAYTF. 371
223 6.000e-73UniRef50_A0A1D7XYB7 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1D7XYB7_9FLAO  ali  21  2......................................VIDNDLWDTSVGETIRSTVGGPLYGLPQDEPQLTLRQIPTSVFTGFVKNTRLIL-------------------------KIKKGLAATTKFYKDPYASPQRMVTVSGMTNQEISDQFIANQDKIVKAFKAQEIQEKQRRTRKSLFNST--AVTKQFGINIQFPSIYRIAK----QAEDFFWIRRDIKTGTVNLLIYTLPFDETLT------KEALAERVITVRDSIGKQHIQGPVDGSY-MTTEKAYTPFFGDTKVANLTSFETKSIWQVKDAFMSGPFINYWIEDKANNRYLIAEGFVYAPSVGKRDYIFELEAIIQSI. 283
224 8.000e-73UniRef50_E0NPM9 Uncharacterized protein n=1 Tax=Prevotella marshii DSM 16973 = JCM 13450 TaxID=862515 RepID=E0NPM9_9BACT  ali  22  10.CMAVVWMLASCGNRSGKA-----LLPSSSGRPYEVLLVGN----EPQLRTLVRSTLTTEIQGLPQSEPAFDISTIATEQLNALNRQARNIVIIVID---------------------RKSGGHLRLTHQRDVYASPQVIVRLTAPDVATFKREWPQTAPRLTTLLERAELMAALRHLKHQSNAEANRRIEEVMHCQLLVPSDLTAWK----QGKHFLWFSDNGNDGMRNLCLYTLPLGTD---------------ILHGRDSIMQANIPGEEPHMRMTTVNS--TVNKWRIKGKNGERIIVRGLWEMEHDAMGGPFVLHVMTDSIRHRLLVAEAFVYAPAGKKRNKVKELEAALYTL. 315
225 1.000e-72UniRef50_A0A238WG14 Uncharacterized protein n=2 Tax=Dokdonia pacifica TaxID=1627892 RepID=A0A238WG14_9FLAO  ali  24  8..ILFLGVFISCEKTSKKPS-----LEGSVGNTNTIKMVVDKDLWQGRVGDTLRSILAAPVDGLPREEPLFTLDQITPDKFTGFVSKSRNFL-------------------------STKLGEPSSFSIEEDVTARRQTAVMISGEDEDAIIEVFKTNKDKIIEAFKTRELKNTQARIRSSLKK--TDSLKATFGVNMRFPTAYDYVK----KEKNFFWMRKEIKRGNMNITVYEVP------LHAIDQDTFSVARIVRMRDSVSGANV---GLNQGRFVTELSLAPQLFESEIDGRFAWEMKGTWEVRGRLMAGPFINYAIRDEKNNRYVVVEGFIFSPSLDQRDNMFELEAIIKS.. 319
226 1.000e-72UniRef50_D1PXT3 Uncharacterized protein n=1 Tax=Prevotella bergensis DSM 17361 TaxID=585502 RepID=D1PXT3_9BACT  ali  22  15.VVLLASLWGACSDTK-------WVQPKSGGMPYEVLVVGDT-------MDMIRKALGRDVVGLPQHEPQFDVSTVKRGGLNASLRLARNIVILDIDSGVFTNTR---------------------IRYEKNKYARPQMIVYIGTPSLLALRHDMSQQSRFLCKLFERVESNAAIEHLKTHRNAETEKQVEQLLGVKMWIPED----LTASRKGKNFVWLSNNSTANMRNIVVYR------------HGANPDVTTFTALRDSVMQSNIKGETDGMFMTTVQE--TVSGIKIRENKHDVLIFRGLWEMKGDCMGGPFVSHTVGD------ITAEAFLFAPGKKKRNQLRQLEAALYTLK 313
227 2.000e-72UniRef50_A0A2L2WKX1 DUF4837 domain-containing protein n=1 Tax=Prevotella sp. MGM1 TaxID=2033405 RepID=A0A2L2WKX1_9BACT  ali  21  11..LVLVLSFAGCDGG-------ISIRPKSGGHPYEVLVTGEDPAAVALLKNIIEK---DAVPGLPQSEPKIDVSTVN-GEIGQVIKYARNMVVVVIDGNEYTATR---------------------VRYERNVFAEPQITIYVGAPSVERLKADLERTGRTVSGLIERFETATAISELKKTSDRKVGKEVAKSFGVDIYIPMGLKPVRRSR----HFMWLSDNSATSMRNICIYTYVGTD-----------MSPETVIVKRDSILRVNMPGETDGMY-MRTERKAVAQAAGIVENGQVRTVVKGLWQMEGDAMGGPFVAHAVADSVNGRVIVAEGFVYAPGKKKRNIIKQLEAALYTLK 319
228 4.000e-72UniRef50_A0A2E6IMP3 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6IMP3_9FLAO  ali  24  9.CVLLLALFVSCANKKKDRK----LTPPSIGETNSIIVVAETNLWQSMFGEFMRESMWAEIYGLPQKEPHFDLMHVTPSDFE----------------------QGDNKIFKNKAILRIVQSDYSGVKFFEDLYSSPQLYCEITASSEQDLIEILRKNSEHMLKKFKAVEFEEKSIQLNNISKK--NSQVKRALNVKIDLPRTYRIA----TERENFFWIRKDNENVSLNLMLYSIPTKSQNLKSLDLKFVS------RKRDSISTSFVPGQFGGKRFMIIEPNYKPSFTQGFFENLIVYEMRSLWKVKETFMSGPFVNYCFVDKKNNRLLFADGFVYAPSKRKRDYLFELETIIRSIK 330
229 5.000e-72UniRef50_A0A134BYE4 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A134BYE4_9BACT  ali  22  9.LLLMGAILTACQSRSG-------LLPKSGGRPYEVLLTGDQD-------SIVYQMLTTDVEALPQPEPSFDVSTTSATTLNTITQSARNIVMLSIDSTVYSQVRL---------------------KMERNVYASPQLILHIYAPSISALRAKQDLLGRKVRDILLQNEMENTVAQLKTHRNVKMEKMLQHRLGITIWIPADMTASKW----GRNFVWLSNNTTSGMQSICIYTLPQ-------KIIKKNITSEVFTHIRDSVMRENIKGETDSMYMQTVTESLIFRQF-----------IRGLWTMKGDAMGGPFVCRIKTDSIHQRLIITEAFVYAPETKKRNLIRQSEAVLFTLK 309
230 8.000e-72UniRef50_Q7MTA9 Lipoprotein, putative n=17 Tax=Porphyromonas TaxID=836 RepID=Q7MTA9_PORGI  ali  18  14.FFAIFAMACACQGGTAGKSFT-----NSTGSPGEMMLVMDDQYLGSPVGEAIYEAMTEVAPALNQNEPIMAVSRVSEKDFTGFLRYIRNVLQIDINPDIFT---------------------KTSLKYGYDQWANGQLVVLINSPATDSLTAYVESNKSAIQNLFIRHELFLFGQLWQKDCSADADQRVQRMFGYHINVPAD----ILSHKEGKDFLWMSNNQMRRRKDFLVYTFPYRGASDL--------GLDRMVEVRDSVLKANIEGSDAGSYPVT--ERMLLKHRYVYPGDQKRGEVHGIWRMEGGMMSGPFVAQAFVD--GDRVVVVEGFVYHPNEKKRDLMRQMEAALYSM. 329
231 9.000e-72UniRef50_UPI00083FB0A5 DUF4837 family protein n=1 Tax=Rhodohalobacter halophilus TaxID=1812810 RepID=UPI00083FB0A5  ali  22  21.....................ESDYRPMSIGQIDEVFVVMDSTKWDSETALAIEETFGKAIETLPSYEPTYRLIFRDFRNNDELLRELKNIIFAAPIDEESNVASFIRAVLSDEVEERVRS-GESFAFPLEDRWVRDQWALILTSNDDTELSEKIRNSEESLVGHLMDREFDRRIEVYRRGEQVALSDSLWENHGWRMRIQHDY----VKTIDTTNVQVYRRSLPDNDRWILAWWKDDVPTADF-------LDYDWINSTRDSLLQKYVQGTREGSYVTTEYRDPRVVTTKEMENRLTGFETLGTWRMTNDFMGGPFVNFFYHDPETERLFMLEYGQFAPSVGKRRFVRQFRAMGRTFE 351
232 1.000e-71UniRef50_A0A1V5JPP7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA012 TaxID=1852815 RepID=A0A1V5JPP7_9BACT  ali  22  7FLFIMVAFIASCGDSSLTRT-----LPNVTGTTGEVMVVMDKFMWDGSPGKAIREQVSPLLVGLPQPEPAFNILPVNPSGFRDIYVSHRNIIQVTIDPGI----------------------QKPAVTYTRNKWAETQLVVNISAADTASLXXXXXXXXXXXXXXXXXXXXXRLITWLTNSAGKHRSVLNTGEARWELAIPAGWK----PDFNRDDIMMLSLETPSTTQSVMV------SVTGRTTPRIGCFELADLTQKR---MSAEVKGPDGGSF-MVIEQRMPVSCRSFRRYDTDYIEMRGLWTLEGGFMGGPFISYAFIDSTTARAVIVTGFVYAPKEEKRELLRQVEALMYTVK 324
233 1.000e-71UniRef50_A0A1F3GUX3 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3GUX3_9BACT  ali  28  17........FTSCDDGGGFL--------SASGTNNEMMVLMDDASWESTPGRALFDVLNSNVKALPQPEPNFTILQIEPDNFTSTFKMARNVIIPEISSIYSY----------------------PKLTADIDKYAMGQVIMNIHAPDSASFAKFVTDNRESIVDYFVTKELERTGKWLKREVTAPLS-RAQQVFGIDIYLPKG----ITNVTEHQNFYWATNNAARGRQDVVIYQFPYTTEKVFEKD--------SLIAIRNQVLGKYIKGSFD-SEMTTANRVYPPDYRTMVMDGTFRAELRGLWEMSTDMMGGPFVMHAFVNDNTGMVVVVEVYVYAPEMNKRNLMRNLEATLYTI. 322
234 2.000e-71UniRef50_UPI000D6CA91D DUF4837 family protein n=1 Tax=Gracilimonas sp. 8A47 TaxID=2079485 RepID=UPI000D6CA91D  ali  20  6FLILGAFILASCESD---------YRPASIGSMDEIIVVMDSTSWDSETALAIEETFGAPIRTIPYPEPKYKLTYRDFRTNDQLIQEFKNIIFAAPIDSENNIASFIRAILSDDVENRVRS-GDSFAFPLEDQWMRDQWTLILSSTSDQELAEKIRNADQSLVGHLESRSIRRTAEVYRRGEQTDLNEMLWDNYGWQVRMQHDYIPVI----DTTDAVVFARYLPDNNRRMWAWWADEISD-------FSVVDQEWINTKRDSLMQIYMQGERDSSYVTTDYRRPIEMTAVERDDRIVGYETMGMWQMVGNFMGGPFVNFTYFDPETERLFMVEYWQFAPGVNKRRFIRQFQAMGRTFE 349
235 2.000e-71UniRef50_A0A2E6SU15 Uncharacterized protein n=5 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E6SU15_9FLAO  ali  21  6.IILLVVFFFSCSEESGKNSDDFSYLPEAVGGYSTVNIIADQPLWDNGLKAQVQPVFERQIEGLLNPETEFDITTVRSKVFNRLFKRQRALLIFVTSKKVS----------------------QEGVSVKKNVYADGQIVVQLAAKTSDAAITLFKNKKDEIFQVIDHHRTTMIQKLARKKNNDQLEDRLLNNHGIGMIIPKSYRLGMDSLNFFYAFKQFNHKNCYYQTGVFSYFFNYTDQGIFTPEK--------FIALRDSVTKIYIEGDSVRSY-MQVYKDFPVATKNITINGQFAYEVKGWWDMKNGTMGGPFVSVATVDEMRNRVIVTDAFVFGPNFNKRRFIKELEAICLSTK 343
236 3.000e-71UniRef50_A0A1Z9P093 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TMED220 TaxID=1986713 RepID=A0A1Z9P093_9FLAO  ali  27  15..........SCQEDKS-----ERYVPKSNGKINHVTVVASEDIWNGEVGGLIREKLSLPYEGLPIDEPIFSLKYLPINSFSGFAKSXRNILLISKDSTSET-------------------------KFLKNKYAKPQVVAFFADINEKNLXIKIKNXCDSMIXEFNKNEANEKRARILKALSKD--KXLFKKFNFDLKYPSIYKTVK----DTFNFIWIEKKISKGTLNIIXYTLPYENFNKINLE--------RVINIRDSIGXIYXPGRLXKTF-MSTDRDYMPYFDKISFSELNXFSIKGMWEVKNDFMGGPFINYLIDDFKNDRVIVLEGFVFAPSISKREYMFELKTILRTLK 318
237 1.000e-70UniRef50_A0A2E6BTE4 Uncharacterized protein n=4 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E6BTE4_9FLAO  ali  22  6..LILVLILSSCLSFDNTS------LPSYTGAVNEVVIVIDDPLWEGACGDSIRHYFNSEVPGLSWIEPLFDIIQINASDFGRIFETHRNLIIV-------------------------QKGEKTNIYFNTKPYSRNQWFCIIEYETARDLQKILGEYLPIISHQIEQKEQERYDLV---GPPKKPLPSAAKKFNLNFGLPNKYK----SVLDTNGFSWFEYNPPDKEIIKGVFIYEYAGVRPFNATT--------LLMARDSVLKQFVLGVSDSSY-MTTEHQYAPHVSIHNHDNLKILRVKGLWKMSNAFMGGSFVSNFICDTANNRVLALEGFLFSPGEDKRNRMKELEWIISDFK 315
238 1.000e-70UniRef50_F9D1K5 Uncharacterized protein n=5 Tax=Prevotella TaxID=838 RepID=F9D1K5_PREDD  ali  20  16.CVVTLLMMMACTG-------HDGLLPKSGGRAYEVLVVGDRQ-------KAVARALSTDVDCLPQSEPEFDISNVDSAHFTAALALARNIVMVHIDPQLYTVTR---------------------IRYERNVHATPQLVVHVGAPSAAALQTGMQSQGTALRRLLNRTELQAAIARLQHHRNVQMEKQLQRQFGATMWIPADMTASKR----GRSFLWMSNNTASELLNIVVYR------------TRRCRTIQAYTAQRDSIMGANIKGETDRMAMQTMPGS--VRRYTATYKGRPVVVHRGLWEMAGDDMGGPFVSHTVDD------ITVEAFVYAPGTKKRNKLRQLEAALYTLK 314
239 1.000e-70UniRef50_A0A1F3P0N4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_37_12 TaxID=1797365 RepID=A0A1F3P0N4_9BACT  ali  28  9.LTFLLIYSASCQSDKKS-----SILPASIGREGEILVVCDSLLWKSSAGIALKNTLKDTIHYFSGCEPFFNITYIPMEKFSDFWKRHKIILFAGVLDGINATGKFINHRLPQKKI--INGLDSLFYFREKDLFASGQQIHFLVEGNQDALAGKILQEGKFILENLLDTEIKNKMLIFKNKFPETFPKSNRE---FSLHLPTEFLLIK----DTSGFVWWRYAENIRDRNIFISWKPYLSQKQFS--------DSALTEWHCETGKKFIYGNDSKNSFLTLQEELPLVSRWITYQGNTGKEIRGLWKTNNNTMGGPFMALVFTDKKFQTLFFVEAFLYAPNEPKRNLMRELEGLLWTVE 344
240 2.000e-70UniRef50_UPI000D0F6782 DUF4837 family protein n=1 Tax=Prevotella sp. Marseille-P4119 TaxID=2079531 RepID=UPI000D0F6782  ali  22  12.LAFLSFVLAACNGRKS-------MLPASGGRPFEVTVVGD-------ADSILYKALSVEIEGLPQPEPMFDVSNIKPSELKGVLRYARSLIIVDVNP---------------------KKYDKLRIKWYNNRYAEPQLIALICAPSAQCLCDTLQGYAKQLTARLKEHELKAYTQMIRRKHNPNMEAEVKRMFGFDIPIPADMTSCKR----GKDFIWISNDSPTAMQNICIYKHAFG--------------------KRDSVMQVNIKGETDSMYMSTVHNACSVTYKYDEREDIYTHEWRGLWQMHGDAMGGPLVARSIWGYYPRDVVTVEGFVYAPGKQKRNLVMQLEAIVY... 316
241 2.000e-70UniRef50_UPI0009310DA8 DUF4837 family protein n=1 Tax=Flavobacteriaceae bacterium A100 TaxID=1917170 RepID=UPI0009310DA8  ali  23  7.VLAIAIGLLSCSKEKAK-----PILKNSNGLINQVLLVMDEGLWNDKEGAALKEFTDRDVLGLPQKEKQFKIIQIPTVSFKNLFRAQKNILIV-------------------------KKDSVNTFDIQYDVFASPQVVITITGTTSEELIKQINTHGEEVIQTFKASDLKALQHRLHKERIDISKIKTFNENKFSFEITKGYKFV----DDTGDFVWYRKRVTDEKTLNLMAYVSVLPEEV---------NDSTLIEYRNAIGKKYIPGEFEGTHY-ITEAAYEPDTFKTELAGLKGYVSYGKWTVKDDWIAGPFINYTLIDQKNNKLYFLEGFCYAPSASKRDLMFELEALLKTV. 319
242 4.000e-70UniRef50_A0A1E5T2R3 Uncharacterized protein n=2 Tax=Fabibacter misakiensis TaxID=1563681 RepID=A0A1E5T2R3_9BACT  ali  31  1....................................................MKAVFRETVPGLTRPEPMFTIRVIEPSEMNRIFKVARNLVYVISYEGRSAADQWLQNTFSEVSRDRIFSNPDLFMQTSEDQYAKGQKILQLFGTDDDALIKNLNKNSKIVQNYFNIAEKERLSKSIRSSESRVVLRKVNDKLGVNIKIPSGYELAML----EDDFAWVRALPAVGSKNLVIYSKPYTSESEFEQE--------NIIKLRNEIGKQYIFGDPENSFMTTETKYMEPVFRNINFNNQYTVEMKGAWKTNNFSVGGTFVSYTFVDDDSKRLYYIEGFVIHPSEDHRELIREMESLLTTF. 298
243 7.000e-70UniRef50_A0A060RDU2 Uncharacterized protein n=1 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060RDU2_9BACT  ali  18  6FFLFAILVMTSCESSGGGIRS----LPPATGTPYSLLVVSSKAVWDSSVGDTVKSIFAQDVEMLNIPEPLYSIINVAPSQVTSVLDRYRNIFYLIVNKEKY---------------------DRTHINVEFDKKAEEQTIITIYSPSIDSMTNYIGTNGDVLLALLDKSERDRYITRAKKYSSESLKKQIYEKFGFLIDIPSNYKI----RNEKDDFIWISYDPSSLSIGFTIYTFESGD----------GLDVVRPLVARNE-AVMNIPGGNEGSY-MTTEMEIEPTYKRVIINGQPWIEMRGFWKMHKDFLGGPFVNFTTQDPATGKMVGIDCYVMSQSYKMRNYIRQLEAMVLTLK 326
244 8.000e-70UniRef50_A0A2E2T936 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E2T936_9FLAO  ali  20  8.LILMGYTIAGCDSSSS------DFKPGYSGSFGELLVVVPEVLWNSPTGDSIFSLFNKPQYGLPQNESPFTVIHVKSEKFSSVLTGHRNVFFVDIKKKYT--------------------GQEATYVLQKSKWAKGQVVVEFTAPDNASFLALLTSDIENILDIFTTAEMNRLVQKNKKFGSKEIRKEILKSQGYQLYAQKDMRIEKT----KENLVWLRREMPKGSQGILIVKQPYTAKKQF--------LDTSIGLAIDSILKAEIPGPKTGDYMGIADQYIQPKYKELNFKENFCKSATGLWEMKGNFFGGPFYELTILHPNKKEILFVYGYVFAPQFDKREYLREVKAVMHSID 335
245 8.000e-70UniRef50_A0A0U1CG90 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0U1CG90_CHLTH  ali  21  22.VLMVSPLLLSC---SGKGGSKGGGLFGATGKPLEMVVVVPDSLDSDALRDSVKVAFGRPMEVLPQAEPLLSVMIVRESGFSQMFKSLRNILYLTVDGGRYTG---------------------PSVGLSRDQYANGQLLLHARAESLGSLYRLLHLKGGEMANLIYQEELVRLAHSFDQTYSSEVAKLVRERLGWYIRVSTD----LDYTHEGDHFVWASDQGVKGRTDFFAYSYPYEGAKSLELE--------QIIAARDSVLKQNVVGAYEGSF-MSTEHRVPQVIRRVEANSIARTEVRGLWAMVGDMMGGPFVLHAIHDEVNGCVLVVEMVVYNPGGPKKNLMLLAESQLYTLE 343
246 2.000e-69UniRef50_A0A239RNB8 Uncharacterized protein n=2 Tax=Prevotellaceae TaxID=171552 RepID=A0A239RNB8_9BACT  ali  21  8.IALAAVLLAGCTGS--------ATRPKSGGRPYEVVVVGD-------ADSTVWRLLSTDAEGLPQAEPEFDVKQLARKDYKGLYRYARNIVVVDIDSARHP---------------------RPSLRLERDRYAVPQYILHAGMPSARALKS--EKVGQNIFSVFDKAERQRALSYLQRRRNLQAEQTISRMFGARLQVPAELKASKR----GKDFIWLSDNGTAAMRNLCVYKVSRSSLSAG-------------MEYRDSVMKANIKGETDDMYMRTV--PYSPTFYVMENDS--GLLTRGLWEMQGDAMGGPFASRAVR--TKGGFLIVEVFVYAPASKKRNIMRQLEASLYTFK 304
247 7.000e-69UniRef50_UPI0009DA07CB DUF4837 family protein n=2 Tax=Myroides TaxID=76831 RepID=UPI0009DA07CB  ali  22  10..FIILFCLISCSKNDSKEN-----LPISTGNYNHVLITINDNLWQGNVGDSIRNYLAAYLDRIVPFEPLFSLEHITPNQFSGHNKLARNIIVFSDNH------------------------NEMIYNIEKNKFSNPQNYIVVLADSKENLITNFVSNVDSIIKAVHLTELEAFQNALNHEVLHK-EDLISSPFNVNIQLPLSFKLVQ----KGKDFRWFKKDVASGSSSVLFYAVP---TERIESNAINKSILNAILEAKDSVSGKYLHSIEEGSY-MKTNEGFTPFNTNVDINGVSALEIKGIWDMEKSFMSGPYITYVFKDNTTNRYLFIEGLVYNPSMNKRDMLLELEAIIKTAK 328
248 7.000e-69UniRef50_A0A257K6G1 DUF4837 domain-containing protein n=1 Tax=Flavobacterium sp. BFFFF2 TaxID=2015558 RepID=A0A257K6G1_9FLAO  ali  20  31.........TSCQSKKEVEPTEAPL--------NQVAVLVDDKLWNGELGDSLRNWFASPVEGLPQEEPEFTLNQYPIKLFEGYSAQSRNILVI-------------------------KKTAQSEFKIIEGDHAFSQNTVQVAGHTLSEIIDTLIVHVPEIRQKFRATEIAECQKRLAK--NHASTRRPNRKFRVQMNIPPAFEVAFS----RKKFLWLKKDIISGSVSLLMYQVP-------AYKVSRKQPLKDLIQLRDSIGRKYIHGTVSKS-RMITESSYSPYFYKTKIDGHRAYEIKGNWQMKRNFMEGPFLMYAIQDRVNRRYLIVEGFCYAPSKEKRDIMFELESAMKSLQ 333
249 8.000e-69UniRef50_UPI000981C5B6 DUF4837 family protein n=1 Tax=Prevotella ihumii TaxID=1917878 RepID=UPI000981C5B6  ali  21  9FILIGQLLCVGCKEN--------ALTPMSYGHAYEAIVVGDKD-------SMIYQLLSEPMVGLPQSEPTFDVTMVSKANFKADSRLVRNVVIVEIDK---------------------QKHKAVNVSSRRNVYAAPQLILTIDAPSKEALHNFLISNGKKLRNYLVKEELHRTQVHLAKHRNVEAEAKIRKLFGIDIQVPVELQASK----EGKNFLWLSNNATSGVSNLCLYTINEGD----------------FRQQRDSVMQRNILGERNNMYVQTSA------IVSTSINKEVSTTIRGLWEMKNDAMGGPFVAYMRKHKPQRHILVAEAFVYAPESKKRNKLRALEAALYTWK 308
250 9.000e-69UniRef50_G6B1K5 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=G6B1K5_9BACT  ali  23  6.LFFATLTLMACTRGKQT------MLPDSGGRPYEVVLIGDSD-------SILYKVLTEPVTALPQPEPTFDVSNGT--SMNATLRLARNIVVVETDH----------------------KLKQIKIKYERNVYAEPQIIVHVSTPSMVHLQRAMRSQANNIRNLLKRNEIKNAITLLEHKHNTKLEAEVQQMFGIDMRIPSDMRASK----KGKDFIWISNDSPTAMANICIYTS----------------------ENRDSVMKVNIKGETDDMYMTTTQGSIVTTYVSSDTDTLTIR--RGLWEMHGDAMGGPFVQHIIKHIDKHTTIVAEAFVYAPGTKKRNVLLNTEAALYTIQ 300
251 1.000e-68UniRef50_A0A264Y707 Uncharacterized protein n=1 Tax=Prevotella sp. 885 TaxID=2022527 RepID=A0A264Y707_9BACT  ali  23  50..MALCLLLCSCT-------VRKSLMTKSGGRPFEVVVYGDED-------SVLYHSLTSPIPALPQPEPSFDVTISKNSQPKGADLLMRNIVIVTINP---------------------KTFSRTSVKYERDVYAKNQIVIYVGSPSVSQLRKDMTTSS-IITDLLTRQEMGVMVATLKDKHSPKMEETVRRMFGIEMLIPSDMKSYK----EGKDFVWISNNSPTSMTNICIYTS----------------------ENRDSVMRKNIKGETDNMY-MTTNKESVISSIAKTQDRQVTVR-RGLWEMKGDAMGGPFVSHTLHDIAGHKTLTIECFVYAPGTKKRNTLMRTEASLMTVK 342
252 1.000e-68UniRef50_A0A0P7WJM1 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HLUCCA01 TaxID=1666909 RepID=A0A0P7WJM1_9BACT  ali  21  10.ISLAALITAACGGD---------YRQRAQGLPSEVYVLMDSSRYEGPLEQALRDVYGEYMLTMPRPEPRYDLKFVGLRTQADLAQKHRNLLIVATIDEESNVGAYLRSLLSEEVQQRVREGGLYEI-PLQDRWYRDQWILIQTADTPEALERRIRNNAGAHLRSLHAAELNRWTEEYRRGEIKDLADSLFTHRGFSFRIQHDYF----PGVDTTDFISVRRYLEDNDRWIWVWHKDDVDDLDFVTN-------RWINSTRDSLLQIYIRGSREDAF-VRTDYRQEYQTELLEINGSQAYESRGVWVMSDFSMGGPYLNYVFHSPEQRRLYMMEFAQFSPRYRQRRFLYQFEAMARTF. 347
253 3.000e-68UniRef50_A0A133XTR0 Uncharacterized protein n=2 Tax=Bacteroidales bacterium KA00251 TaxID=1497953 RepID=A0A133XTR0_9BACT  ali  22  5....LFILLSSCKSGGSGLPGIT-----AAGSPGEVLLVMPSSWLKGEIGEQTKSMLRMEVPSLPQTESWLRVQTVSSDDFGQFLRNTRNILIVDYNKDIYTTT---------------------SVKYTFDPYAKGQIVVTIQTPDMQSYHKYITERGREICELFLLNELYRMASDLVEDYSPTAMNYCEEIFGCRINVPKDVLSYK----KGENFLWLSNNAMKKRYDFAIFKVPYDTSSSL-------PSARQLIALRDSVLGKEIPGSDPSS-HMTTSDYAIEYRLAELPSGKRIVELRGLWEMPPDIMAGPFIAQAFFSTNEAALYYVEGFVYYPNEDKRDLVRKLHSALFSF. 321
254 6.000e-68UniRef50_A0A2M9R757 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium UR159 TaxID=2008672 RepID=A0A2M9R757_9FLAO  ali  23  6YILIFIFLLTACRKKEIQIGKIDP----SSGAINEVTIVIEDSLWNGATGDSIRKVLAAPIAEISAPEPIFDLAQYSPKNFGRRAKMSRNIILFSENESH-------------------------QFVLKKSLYATPQNFFFIRGKNPEEMTKTFISQADSIIKTFKQTELNEQQLFIAKNPLQAI-DSVKEWFAMTIKVPETYQVKENIKNE---IVWFQKDLHSGDVNLLIYEV-----AIPENHVEINHNINEILEMRDLIIEQYIYGNQPDSYIYTDYNFVPVVYMR-NQKKLPAVEIRGKWAMENDFMTGPFISLVIKDDYYGRYLFLDGFVNNSFQNKRNQLLELEAIIKSI. 324
255 6.000e-68UniRef50_A0A1G0N5V8 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium GWA2_55_25 TaxID=1798422 RepID=A0A1G0N5V8_9BACT  ali  22  20...................PSCETPKLPATGGDDEIIVFADSTTW-AALERTLRTVFEDTVH-TPIPERWFTLRRVDFSEFGQYEKQ-KNRIIVAPLHGEGAVGEYVRNSLDPKVRTLV-EEGKEFFFTKFDSHARNQLLMFLTGTDFSALSASMELHAADLLYYFQNVVMKREAATLRRYHKKDIEKRLEERYHWTMTIQHDYYIAIDSAESR--FFWIRRATPDMERWIFVHWVEAPDPAILT--------DRFVLGLRDSLTREFLQTVDNNAYVQIA--PYYLTIEKVNFLDRFAYETRGNWRFSDKSGGGPFINYTLYDEGTKRIYMLDGSIFAPRVEKKKLLWQVDALLRTF. 346
256 6.000e-68UniRef50_A0A0E9LRX8 Uncharacterized protein n=5 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A0E9LRX8_9BACT  ali  20  1............................................................MEGLPQIEPIFTVSITPHRAFSGAMRTFRNLLITNIGPDV---------------------EKEGVRFFSESSWAKGQAMIHINAKTPEQFLELVDKEELRILGFMLKAERQRSLRYYTKFVAGDLTDRVNDKWDIKMIIPNIFTV----KSDKDNFSWMSHETPSLSQGMLIYSFDYVGEGTFSREY--------LLNKRDSVLRHNVPGPSDGSY-MSTEHEVPVTYKSFKNNGHEVVELRGLWKVVGDLMGGPFVMHAHLDKASNRVVVTDGYVFLPEEKKRNYIWQLESLFYSL. 265
257 9.000e-68UniRef50_J6GYV7 Putative lipoprotein n=19 Tax=Porphyromonadaceae TaxID=171551 RepID=J6GYV7_9PORP  ali  19  14..LIASILAFG--SCKSSSKNSSVLQQSAIGKPGELMLVMDKDYFESPMAMQLYDLLEEDAPALPQSEPSLRISRVPTPSFEGSLKLVRNVFLLDIDPQRY---------------------SKVSLKYSYDDWAKGQIVARMTSPSADSVQNYLKTQGEGLMNLFIRHELFLYGEVIAKTYSQKATELVDSLFAHRVNVPED----IRNKRVGKDFLWMSNSSMRSRHDILVYTYPYHSPKDISLDA--------LVAKRDSVLKANISGEFEGSYP-CTEQNYGLLYRRVQLPEEETAELRGLWKMEGGMMGGPFVSHAVVDKAAGKVYVFEGFVYRPNEDKLHLIRMMESSLYSF. 336
258 4.000e-67UniRef50_A0A2A5EFR9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A5EFR9_9BACT  ali  20  2.................TPEEKKALLPYSSGRLAEVIVVTDSKSLDSSFKEDIKRVFHKRIKGHPPPEPMFKVLFTDESFFKGYFKNHHNIFILLHENRANRLKEIIGEVTVDRMVNRLKTEPQTFGVKQEDVYAQNQSIFWVLASNKEAMQQKLLDYDEELLQLAYKHETHSAKFKLIGDISVKRDRFYQKSIGFGVRKPKAYKVAI----DNDEFVWLRKSTQELEQGLLLYEAPYRTKEDLSTD--------SLIKFRNRLVKKYIPGELKGSY-MKYSTMMPPVRTDENFKGKYGVEIRGWWDVEGDFMGGPSYIKAVVDEANGRIVFAEGFLFFPNEEKAVHLRELEVLVNTL. 335
259 4.000e-67UniRef50_F8N802 Uncharacterized protein n=2 Tax=Prevotella multisaccharivorax TaxID=310514 RepID=F8N802_9BACT  ali  22  23.VLCILLLCSSCGRNGS-------MLPPSGGKLFETLLVGDS-------GGIISSALQTDVPGLPQSEPQWDVSSVRASAFDASLKVARNIVVVKTSPALYSSVR---------------------VRYERNVWADPQLVVTVTAPTARMIGDSISSVAPTLLRLLGRAEMRRALSLLRTHRNVKAERMVDSMFHIRMWIPLDMTACR----KGKDFLWLSNNSPTVMNNLVVYRTP---------------SRADFIACRDSALGRNIKGETDRM-QMTT-------VAPTVMQNKGATFFRGLWEMEGDNMGGPFVSRRVPEAHGKGNVILEGFVFAPAKNKRNAIRQLEAALYS.. 316
260 5.000e-67UniRef50_UPI000B84003A DUF4837 family protein n=1 Tax=Myroides guanonis TaxID=1150112 RepID=UPI000B84003A  ali  23  12FLVSFILLLFSCKEKTQEGASK---LKDSQGEFNHLTLVLKDSLWNTETGDSIRKYLAASLDGIIPSEPLFIIEQFSPRIFVDKNKLARNLII-------------------------MDEESDCLFTLERSKYATPQNVFTIQAPSAEEMIDEFKINVDSIISTFLNFEINEMQHKI-KRGSKLDDTVLQDVFGVKMVIPDTYKYV----LQEDNFIWIKKDIASGNSNLLLYEV------SIDRIENSKSIIENIVEVKDSIAALYVHGTEPNSF-MKTDEGFAPFNKKLVLDNLQAFELKGTWDMRKSFMSGSYLCYVIRDDYFNRYLFIEGFTYNPSLTKRELLFELEAIIKTV. 329
261 6.000e-67UniRef50_A0A1V4R1K7 Uncharacterized protein n=1 Tax=Candidatus Latescibacteria bacterium 4484_107 TaxID=1956171 RepID=A0A1V4R1K7_9BACT  ali  24  10....LSMGLWGCKGG----------LPEGLGSLSEVVVLTDSTDWDA-CGDAVEAVFGRTVH-TPEWEPIFALRMGDAAKF-DFFKSWRNVFLLASLEGGGEATRLVRSLLSPEVLERIGQ-GEAYVFFKTEVWAKDQILVIAAARDRFALRQKLVEDQDAIFTTMEGHLNRRVGEWLYAEGEQELEQALFEQFGWTLRIPAGYAVQKKVPEE--GFVWLRKRAPDRWLFVWW----------GAAFEGMELSGDWFREKRDEIGRLFYEGDSV---------ARILSVEETLVAEWPAIRVRGLWANREKAVGGPFVSTCFIDRDTDRVYIVDGAVYAPGVQKAPYLRQVDLIARTF. 329
262 7.000e-67UniRef50_A0A1Z9UQX9 Uncharacterized protein n=2 Tax=unclassified Flavobacteriales (miscellaneous) TaxID=403978 RepID=A0A1Z9UQX9_9FLAO  ali  26  5YLLIFMLLFFSCN-----LKNNNYLLRKGTGKLHEIIFVVDSNLWDSETGMIIKNNFFTDIEGLPQKEKLFKLIQINHKDFSSIYKTHKNIILVSLDDRVSS--------------------------FYKDKWSINQLYFELFQKNISDLNNYLKSNLKKIKLKIIEENFRRNFEKISTNSNKKIEKKISSNYKIKMAVPDGYKIA----EEKEDFFWIRKDYPKENIISNIY------FNTINFKNINQLSKHNLIFLRDSIGAIHIKGNNENS-HMTTETLYDPIYSKFN-NNPFDIKIIGLWTMKNGFMGGPFSSRALLSFDSKKLIYVEGFLYSPNKSKREYLFDLNTVIKNIQ 320
263 8.000e-67UniRef50_A0A2E9UH83 DUF4837 domain-containing protein n=5 Tax=Balneolaceae TaxID=1813606 RepID=A0A2E9UH83_9BACT  ali  24  13.....AACLFACNSD---------FRERAKGDTREFVVVMDSVDWDSKTSNALRETFGKYVFTLPNPEPYYDLTFMQIRSRSQLERIYKNIIFAAPIDDSTTVAAQVRAFLDESTEQRVR-NGESFAFPLVDQWYKDQYALILSSSNDSALATKIRNTESALLSNALDKELSRWSRFYKKKEQTQYSDSLWNDHGFMVRIQHDY----IKRIDTTNFISYRRFLPENDRWMWVWWKD-------NVKAISFLDDDWINRTRDSLNQQFIKGRTDSMF-ITTEYRRPVESNSFQKDRYLGYETLGTWQMINGAMGGPFVNFTYYDESTSRLFMVEYSQFAPSRKKLRFVRQFRAMGRTFE 348
264 1.000e-66UniRef50_A0A085EP03 Uncharacterized protein n=5 Tax=Flavobacterium TaxID=237 RepID=A0A085EP03_9FLAO  ali  23  18..................SKNKDNFSRHSTGKINSISIVIDDQLWNGIVGDSIRNKFAGPVEGLPKEEPIFDINQYPTDVMEGFVTKSRTIIVV-------------------------KKGAENHFWLQKNQYASPQNIFHITGKSVTALLELIDKHSPGIIEIIKKGEILAHQELLKDSV--VVSKTIQNQFQLDLKVPKGY----SFSVKNENFVWLKKEISSGSTSILVTQFPMKNFSH------GGDMLSRVIKIQDSIGTVYIKGTVPDS-NMYVDMSYPLYLLKTNLNDKLTYETRGTWRLKNSFMFGPFLNYLIMDSERNRIIYLEGFCYIPSQERRDYMHELESILKGVK 320
265 1.000e-66UniRef50_A0A259TXY3 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A259TXY3_9BACT  ali  21  28.........................LQPAVGAIPEILVVTDSATWAGTVGDAVRQELAKPIMTLPNQQGAFKLRYQPASQFLSQIRETRNVIFVAPIGVETPIGEYIRARIPEGQQGAIESGNSVAVTIRENLWAAGQIAVTATAANDSLLASAIIERGDSLRAAFDRNVLATTTREMFAGRQNEIETELLASRGWTVAMQHDYVQIQDSTLRTGDFIRFRRVIPDSWRDFFVFTQDGVSEL---------PSDDEMDRLTDGLLEVFARGEEDDSY-VQQDFRRPMVRETLPLAGREARETRGLWFMVEDLMGGAFIRYAFVDPETDRLYLYYGMTFAPSRDKREFLRQMEAIATTF. 358
266 1.000e-66UniRef50_A0A1Z9BLB5 Uncharacterized protein n=1 Tax=Rhodothermaceae bacterium TMED105 TaxID=1986665 RepID=A0A1Z9BLB5_9BACT  ali  20  19.LVITLLVAAGCNME---------YKPKAKGSLDSILLVVDTTQHNASLVPAIREVFEQAIPHVPGYEPQYKMHIASFERESDLIENRTNVVIAAPLXEQTPTGSLVRSMLNESFEQNVRNGT-SFAFPAKDVWARNQWVLVLTGVDTVAMKQAILEADTRLLEPLQTYELERWTRDIYKGEQVELADSLMAHAGWSVRMQHDY----VWXFDTTRFVQFRRPXXDNDRWIWGAWEELXDPGVITP--------XWIQAKRDSIMATYLKGSRPXSY-ITTETRRPVSTSXLXESEXXAFETLGTWTMVNDXMGGPFVXFTYXXPEXERVXFVEYGQFAPXXGKRRFVXQFRAMGRTFK 356
267 2.000e-66UniRef50_A0A0S4NL21 Uncharacterized protein n=7 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0S4NL21_9BACT  ali  26  7.LLILSSFIISCSN----------LKPKATGDETEIITYIDSLLY-IQLEQPLKSVFHR-LLYTPQPESLFIIKPEFQIQSIDRLKYRKNLMFVSTLDDKSEIGLYVQNMLDPASKELIQKDS-AYIFIKKNLWSNGQIILVLIAKDRENLLKHLTKDRNEIYIYFRDEFFAREMEGIISEGHKDIEKYLLQKYGWTMFVQHDYYIAKDSAQEK--FVWLRRRTPDMERFIFVHWID------SVYEPYRFFNQIWIAEKRNEITRKFYRTTRDDAWVIIADDPESIYFFPVNFNGRYAIRVQGLWRFNDFTGGGPFISYVFYDSTQKRIYFLDGSIFAPRYEKKKLIVQIDALLHTFK 349
268 8.000e-66UniRef50_A0A1B6YD23 DUF4837 domain-containing protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1B6YD23_9BACT  ali  22  7......VFLFTCIAATILSACDGDFRSRAQGSINEVIVVMDSAHFDSKTAEAIRATYGKYQFHMLNPEVNYNLSFTDIRSNSQLLKGMKNVIFAGALDDTTDVSRAIRGFLDAGVEERVRS-GQSFAFPIKDQWYKDQYALILSSTSDSALAEKIINSERSLMADILERELSRWYDVYEKKEQTQYSDSMWINHGFKVRVQHDY----VARIDTTDFISFRRNLEINDRWFWVWWKDDVTDINF-------LDSDWINATRDSLNQQYIKGSTENKFVTTEYDRIQMRMNSFQKGRYLAYETQGWWTMENAAMGGPFVNFTYYDPATNRLFMIEYSQFAPSRKKLPFIRQFRAMGRTFE 352
269 9.000e-66UniRef50_A0A1V6HUU2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin035 TaxID=1852799 RepID=A0A1V6HUU2_9BACT  ali  22  18...................CTEQSKMPVSIGNINSVIVVVRDGVSKTQAAKTLDSILTQEIYGMPQSEQLFDVSYVTEGNLNDLLKKNRNIIYLIISDTV----------------------KKEGIFKSEDVFAAPQTILFIRSSNPDSAQKLIQKSEKVILQALTNTEFRRIYGIMTKSPAIELKKKINQNFGIDLQLINLFFEAKS----TNDFMWLRLETNDYSQALIFMKEPFNAENQFNPAH--------IRSWIDNTLKLQIPGQFEGTYMKIDDSVIKVKVDRVIINDIERIVFSGLWGVEGDFMGGPFRSHTFVSKDKSSLITVYAYVYYPNEPKRDLMMDLEAILHSIK 323
270 1.000e-65UniRef50_A0A2N6A277 Uncharacterized protein n=1 Tax=Salinivirgaceae bacterium TaxID=2053305 RepID=A0A2N6A277_9BACT  ali  21  6FVLAILLLYSSCTDTMSTAYGGGGEGEVVV--------VLDKKFQETMAGDYIDSVLRAPVYGLPQYEPKFKLFVIPWNAFSNTFKAFRNIVKVSISSKYKEPEVTVKRKG-------------------------MQVVFHFKAPNESEFAKLIMKNQQRLYDLLNYNEKQYASYKIQLGKKKSLTNYFRKNHDLEVVFPDGYNI----RLDTSNFIWLSFETNTLSSGVFIYYYPYTSDSTFTKKY--------LLHKRDSLLKLYVEGPTRETYMTTEYNFIPPQFQEIMVEKKYYTEIRGLWTVVNDYMGGPFINITRLDEKRNRVVTFDGYVYNPGGDKRKHVKWLEAMGYMMK 324
271 4.000e-65UniRef50_I6YT04 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=I6YT04_MELRP  ali  27  19......................CDAKKSATGNEDEIYVFADSTEYE-QIEASLLTVFSK-IIYTPQPENLFILIRKDISELDK-YKNKKNIIITAPLGSGSNTSNYIDGLLNQQVKEMVRQDS-VFVINKYDLWARGQLVMILTAKDLNELGKKILNEHENLLYYFQKISNERLFKYNSRYERKEIEAKLLKNYGWLIYVQADYHLAIDKPEH--NFVWLRRAPTDMERWIFVHWIDNASPLLLNKD--------SVYAIRNRITEKFYRTSDDSSYVLIEDNYR--TTKEVNFLGRYALMTQGLWKMKDGSMGGPFINYTFYDEPTKRLYMLDASIYAPKYYKKKLIQQVDVLLQSF. 341
272 1.000e-64UniRef50_A0A1H6SAB7 Uncharacterized protein n=3 Tax=Myroides marinus TaxID=703342 RepID=A0A1H6SAB7_9FLAO  ali  20  6YFIILLFMLFSCKERTANDKEI-----NSTEEPCQVLIVINDRLWSGSVGDSIREYLATPIEGITPPEAKFLISQISPNLFSSRTKGRRNIIVFSDN------------------------YNNNGFQLEKNKFANTQLYFTVSGDSKAGLVNELRKNADSIVNTILTSEFEVITNKLLKGSLVDA-NFFQDKFRVNLTLPTTYKLVSNS----DHFVWYKKDVASGSSNVLIYDIPIERI-----ENTDNTVINNLLAVKDSVNGKYIHSIEDNSFLSPNEGNM-PTNKQFVRQGRTVYEFNGDWDMQNSFMSGPYMSYAFRDEKAKRYLFIEALVYNPSMGKRAILMEMEAIVNTL. 323
273 1.000e-64UniRef50_F4KM39 Putative lipoprotein n=4 Tax=Porphyromonas TaxID=836 RepID=F4KM39_PORAD  ali  20  33...........................QASGKPNEVMLVMDRDYLADSVGTAVKAMLRSYVPAMPQVEEQMDVTTVDPKDFDTFLRYVRNILIVDIDAGRYT---------------------QNSVKYAYDQWAHGQIVVTIQSPSPDSVCFLMADRGRAVLNLFVRHELAVQASNLVKNFSRTADQLAVKHIGYHLNAPEDIVSYKV----GENCLWLSNNTMRRRTDMLLYKVPYHGEALTVPY---------LVALRDSVLAANVPGPVEGS-HAVTAPHILMTRRVAIEGQPMRTELRGLWELRGGAMGGPFVQHAFVTPSGDELVVAEAFVYHPNEAKRDVMQQVEAALFSV. 329
274 2.000e-64UniRef50_A0A1F0FTB2 Uncharacterized protein n=3 Tax=Porphyromonas TaxID=836 RepID=A0A1F0FTB2_9PORP  ali  21  25.........FSC---SGKGSSKGGGLFGATGKPLEMVVVLPDGYDTEALRDSVKQALSMPMMVLPQNEQLLTVMITGERDFSQMFKSLRNILYITIDEERYTG---------------------PSIGISRDQFAGGQLLIHARAESLESIYRLLRLKGKSIADMIYKEELVRLSHAFDQTYSSEVAKLMKEQIGWTIRVNTD----LEYTHTGDHFLWASDQGVKGRTDFFAFTYPYEGPQSLELD--------RIIAARDSVLQQNVAGAHEGSY-MSTEHRVPQVVRHVEANGIPRTEVRGLWAMVGDMMGGPFVLHAIKDEANKRVLVVEVVVYYPGGPKKNLMLLAESQLYTLE 338
275 5.000e-64UniRef50_A0A1S1JAK8 DUF4837 domain-containing protein n=9 Tax=Flavobacterium TaxID=237 RepID=A0A1S1JAK8_9FLAO  ali  21  27...........................SVSGKTNTISVIIDDQLWYGEVGDSIRNKFASPVLGLTQEEPIFTINQYPARLLEGFVTDSRSIIVVKKAVADK--------------------------FEVTHSASLPHNTFRIYGKSVDDIICSIELNSAQIIKVIRDTEIKKIQEDNSKSLLNPAI--IKNKFHVDLQIPVGYEYM----LHKKNFIWLKKDIISGNTSLLIYQIPIRSFE------KSSNVVDNIIRMRDSVG-YYIKG-KEPKTRMITGEAYAPYFSTILLDGKKAFETKGTWELKNDFMAGPFINYAIVDEMYNRILVIEGFCYSPSNEERDLMLDLEAIIKSVK 318
276 2.000e-63UniRef50_UPI00069132AC DUF4837 family protein n=4 Tax=Porphyromonas TaxID=836 RepID=UPI00069132AC  ali  20  15..LLVVSGLSSCTDMKQSPF-------DSTGKSREMIVVLPVNETESDLREFSKEVFNEPVPLLPQPEASVDLSFTLQNNFTTIFKAYRNILIYDIDPNRYTQGVL---------------------RLSRNVWAKGQNVYTAQSPDLVTAKALIRLQAPKIMEEVYRSDVLRHITDLERTYSSKFAKEVEKYIGVTINAPVEMKWTRVN----NGFVWATDQGNRGRMDMVVYTFPYTDVNTFETSY--------LIHKRDSIMRQWMPGEYKDSY-MQTEHRADPMAVKGEVNGTARVILRGLWNMHGDMMGGPFVMHAMVHPNGKEVLVAEAFVYAPEVRKKRLMLLNESALYTL. 333
277 2.000e-63UniRef50_W7YFY6 Uncharacterized protein n=2 Tax=Saccharicrinis fermentans TaxID=982 RepID=W7YFY6_9BACT  ali  21  1...................................................MIADFANEEFPCIPQPEATFKLSNIKPNDFEGHFKAYRN-----------------------IIIIRQKKIKNTNIRYKKNVWATHQQLIEIDIPNIASFSTAFEEHRTRIFNFLYEGDIKTMQLANQKGADQKLSHYIHKKYGINMALPKGFKLMK----DTADFCWFTFDRLATSTHIVIQSFNIKNLSSINNEY--------LVYLRDSIGKAFIPGPSELSY-MQTEKRLPVMAKNKQINNMNITEIRGLWKVEGFFMGGPFVNYFIRDKAHDRLLMIDGFIYAPQKNKAHYVRQMESILRSVK 273
278 2.000e-63UniRef50_A0A1G0AZB7 Uncharacterized protein n=1 Tax=Flavobacteria bacterium RIFCSPLOWO2_12_FULL_31_7 TaxID=1798015 RepID=A0A1G0AZB7_9BACT  ali  23  8...............................NQNSVTVLISQSLWNGKVGAKIREKFAAPIVGLHDCESVFTLLPIHANYFPSAAKVSRNILIVSSSFKTQTT-------------------------LVKNKYTENQNIYTIQGKNQELLLNQLQNSSKEIMNTFYNSEINLILT--KNKINTKLQKQIKKQFSIDIQVPTDYQKA----LQGENFLWLRKEIGSGYNNLLIYT------ASFSALYNKNALVTNSLFIRNQVSKKYVLGKTDGSY-MITEQAYYPSFHTTEIQNNLAYEMRGNWEFHKDFMNGPYLNFAIRDNKLKRFIIIDGFAFNPIHSKKDLLFEMEAVIKSTK 297
279 2.000e-63UniRef50_H1ZCW8 Uncharacterized protein n=3 Tax=Myroides odoratus TaxID=256 RepID=H1ZCW8_MYROD  ali  22  6FYISCFVFCMGCKNPMQK----EDMRTPSQGQINQVLLVMDDDLWLSDVGDTIRNYLAAGIDGIIPAEPRFDLDQQSPGIFGNTAKNRKNIVYVSM------------------------REKKTNFELIVDQYAQPQSYFLIEGTDNKSIIATFLKYKDSIIDRFHQQEIVDIQQRIKEGPLYETV-LLHDRYHIDIDLPASYKRVLV----DDNFVWYKKEIASGNSNILVYSLPF---EVVKPYTTQREFVLDMDYLRDSIVGKYIHSSEPETF-MNMSVDFEPFHKIIQPKGLEVTEIKGTWDMENSFMSGPYLTYIV--KKEGYYLVIEGFTYNPSMSKRNVMLELEAIMETLK 325
280 3.000e-63UniRef50_A0A1F4R283 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium RBG_16_48_16 TaxID=1798559 RepID=A0A1F4R283_9BACT  ali  19  6FFYALSILFLA----SALFDSSCTQKPRSIGSNDKIVVLADSALWR-EVEVDVRHAVEREM-YTPQPERIFSIILKDPQDISDVGRFPH-LLLLGTLDSEGSTRTLLDGMLDETLVEKIEKDS-LFVFRKTDIWAKDQLLVVMVCRDVPTLLSHLQGDKDLLFRLFDDHAQMVVQTAMYKAEQKDAEQRLMQKHGWSVRVIHDYFAAIDSTQAR--FVWLRRMGPQRE--FFVYWQPVADPSVLS--------KQWIIQKRDSLTKIYYQGDYIDTVKV------NVVETEVDFQGRYAIRLDGVWQNEINISGGPFRSYAFYNEDDGRMYLIDCSVVAPGQRKWAYMRQLDVMAQTF. 338
281 6.000e-63UniRef50_A0A1J5LBT7 Uncharacterized protein n=1 Tax=Crocinitomix sp. MedPE-SWsnd TaxID=1860084 RepID=A0A1J5LBT7_9FLAO  ali  21  6.IALTSLFFISCDEE----VSREDLLPDASGEHGKILLVIEEGLWETSLQQNLHDQLDQNCKGYLRPEPLFDYYRTGSTEMSHIDKLARLILKIKIDHDSTY--------------------QETAVTVKENYFARGQLFVVIKDSDLNRLNDYIKNDFDFVLDAYNAFEAEQLTKEFKGDPHKAIDEISQDNFGISISLPRTYERSQKQQYQTSGTSGYTYETFWIQEGILFWKEPLDSASYFEPYH--------IMARRDSVLKQNVPGDMDGSYMATEYDYYKPEADKIVVDGQETIVVRGLWKNPGAFAGGPFVQYSMINEKTNEIITVCGYVYAPKFSKREYIRQVEAMLSTIE 350
282 8.000e-63UniRef50_A0A132HW64 Uncharacterized protein n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132HW64_9BACT  ali  18  12..VCMALMLAACNGSASDKSSKKGSSGK----TLELMVAIDRNVYEGATRDLLDSIFRQPQPGLTQPEPIFDVVQIPLTSFTEMFQAHRNIIICDIRP-----------------------DNPDKVYRYVDQWASPQIVYEFAVKDRATLCALLRKYADVIIENLYRTEHRRMYKVFKGIEGVEVREAIRRQIGLTLTFSNEFEVARPM-NPTSDFMWIRKETKDFGLGVFIRVLPYTSRDIFNEAVLLDTLAAQ--------MHRHVPGSADSSY-MNIERAMPFYSRTVVFEGPYCVETRGCWRTEGDFMGGPFVNYVVLSPDNRQVVFLTGYIYYPSGSKRDLLMQAEGICHSL. 338
283 1.000e-62UniRef50_W7YA35 Uncharacterized protein n=4 Tax=Marinilabiliaceae TaxID=558415 RepID=W7YA35_9BACT  ali  24  8.LLIVSIITTSCKTQPN------SHKPNPSGNAGVMIIVMNDAVKKTEAGKKLWDIMVQPMIGLPQEEPMFDVSVIPHRSLSDFMKTYRNI----------------------VVVEVGQEVQKEGIFFHKGTWAKQQALVRIYAKDAASMKQLVDDNELKLVGFFTKAERERLSHYFKTTFNKDLKDKVANTFGVSMNIPRDFSLRK----EEADFIWMSQETNSSSLGLMIYEIDYVGEGSFSKEY--------LLNQRDKTMMKKVPGPSEGSY-MTTEHQFPINYQVIKTTDTNTVMLRGLWKVQGDMMGGPFIAWHII.................................... 289
284 2.000e-62UniRef50_A0A2D6LY01 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D6LY01_9BACT  ali  21  10FVLTAIVFAVSCS-----------YKPRSSGADNEIVVVI-SFEDRRFVEPLIDSIFGR-VIYTPEAERFFDIVYVTPEQFEE-YKVRTNIVIAALFSVVDTTADVLVRNILPENQVEMIRRGEQNIFAKRDFLARNQVFAVLAANSDKELAKAVQIKGRWLFDQFDSGFLERQAKHMYKREQKELADELWQKYKWKMRIQHDYVMIKEQPQR--NFIWFGRSFPYRWLSVQWVDHPVT------------------KAVDSQIAADMIHDYPSVYYKTVNFTHYYEKIEETTFKGRKAWRAEGLWEHKKDIKGGPYVSYIFYDERTDRIYHINYLIHHPSGKKMLSLRQMDIMIRTF. 334
285 3.000e-62UniRef50_A0A085L4B8 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A085L4B8_9FLAO  ali  23  6FLLVFSFLYFSCESTSDQSKKQQTALPPSTGSRCEILVVCTEHLWNSRALIPLKNELLRPQPGLPQPEPYFSILRVDPVNFKNVIQRNKAVIIIEESDTTT-------------------------FQWKSNAFSKPQQLALFTYSDLRQLYVLTARHRSEIFSRFREQDLNFTRRTLLTSGAKW--KKATEEESIRLLMPQGYTEV----VKKNNLSIFFAQSSKTHHVIMVYTRPWDPEGHLLNE-------WEIIAIRDSLTRIHTQSSRPGSYTM-VDTSITPLSQTINFNGSLAIEMRGLYKSVNDFLGGPFYSITIFDEKYRRIILLDAFLQAVGLNKRNMLFEMESVLKSAE 334
286 4.000e-62UniRef50_UPI00082A4746 DUF4837 family protein n=2 Tax=Crocinitomix TaxID=246873 RepID=UPI00082A4746  ali  20  6FIIVSLFALIACDDSN---TPKDQYLPEANGKHGEILILMEDHLWEGQIGEKVIEELSVRAPGYLRPEPSFSYFRKRPEDLNHLNQLNRNILKFMIDTDS--------------------IYSETAVIEKRNYFAKNQLFIIIKDSDINRLYEYATNHMYEIRDKFNAFEVAQLKRMYKAEPHKLANEIAEEKFGLSIAIPKKCKLKK----EQSNFVFFKRDRSKNQQGFLIWKTPIIPDS-------NQMTTQAMLMHRDTVLKYNLPGERKDTYMGTEYQYYEPVGREFTYDGHPAVEIRGLWIYEGKVGGGPFVQYSILNEKRGEIVTICGYVYGPKFEKREYIREIDAVLNTVK 351
287 4.000e-62UniRef50_A0A2T4XJM1 DUF4837 domain-containing protein n=2 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4XJM1_9BACT  ali  19  5.....................DGDYRQLSTGAIDEVFVVMDSTAWNSETAEAIREVFGGGITTLPAPEPRYRVTFREFRTNKQLVKQLRNVIFAAPLDQDGNTANFIRSITSDDVENRILNN-ESFAFPLRNQWYRDQWTLILSSSGDEQLADMIRRSEQALLEGLQELELQRWQEVFRRAEQTEISDALWSDYGWSVRMQHDY----VQTVDTTDVVVFRRYLPKNNRWIWAWWDDGFQTP-------EEITPEWIHAKRDSVMQIYIRGDREGSYVTTEYRRDLVTTQLEWNDDWSGFETLGTWRMTQDFMGGAFVNFTYFDPQSERLFMIEYSQFAPGISKRRFIRQFQAMGRTF. 375
288 6.000e-62UniRef50_A0A1F1DWP6 Uncharacterized protein n=2 Tax=Porphyromonas TaxID=836 RepID=A0A1F1DWP6_9PORP  ali  19  22...........CNGKKRRSTT------SATGNALSLIVVPDGNIDNQALRDSITFYFGQPVTILPQPEPMTDISFVEASNFVSFVRRVRNILYVSIDPETYSG---------------------PSVGLSRNDYASGQLIIHAKGRNLEDIYTLLQSRGDQLVQLIYTEELKRRQDYLEQTFSNPIRQLIEDSVGVTMNPPTGLDFTRAQR----GLVWASNMDQSKRIDLVVYSIPYRNPNTFTEEY--------FTELRDSILGSIITGKYPGSQMTTTKRDAPPYYHGMTYLGDYRGELRGLWEMTNDMMGGSFVMQGMLDKSGRNLVIGEVFIYAPGEKQRNMLLNAEASLYTI. 332
289 7.000e-62UniRef50_UPI00056F5834 DUF4837 family protein n=1 Tax=Thermonema rossianum TaxID=55505 RepID=UPI00056F5834  ali  23  29.............KQQSSQGRAQTYQPAASGTVGKILVSMDPTAWKAGIGEQVRECLQSPVPGLPQPEPFFTYMFIAPPDFSD-FKIFRQVLFVANLSDSTYANRRILQLLAPEELQQFKNGTQQSLFLQHDRYARGQILVFLVGKNTEALQHYLQDEAEQLLFVFEDHLATYMAQSIQKVHAVSLMNTLKNKFGLTFALPPNYKEV----VRDKDFIWIGTVSDNAYQNIWISRLPYQGKEMYDTTF--------IIKHRDRMGERFLRNPKREGSFVQTETRVPLHVRDTHLNGTPVREYAGLWVLESRRRGGGFVGYAF--EHKGYFYYIEAYIYAPGREKLPVLRRLKGILNTME 365
290 1.000e-61UniRef50_L1N8C7 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=L1N8C7_9BACT  ali  20  23...LLLIICQGCSDNK-------PLKPQSGGKPYEVLLVGD-------VDSMVWHTLNRHLSTLPQTEKQFDLSAVNYKQFNGTARLTRNIVLIEVNK---------------------KKFSSPQISYAYRVYAQPQVIITISVANKTMLKNSSSAIGKQVSEILNTAERNREIARLEKRHQVDAARSIKQMFGHTLYIPQEMTFCK----QGVNFLWFSDNGTEVSRNICIYCLSNGD-----------------VSKRDSVLRQNIKGETDSMYLRLLSSSLDVQ----ELKDPNETLTKGLWEMKGDGMGGAFIER--RQAEGKSILVVMAFVYAPSKKKRNYIKQLEAALYTLK 316
291 3.000e-61UniRef50_A0A1W9PQA6 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4484_219 TaxID=1968530 RepID=A0A1W9PQA6_9BACT  ali  22  10.ILFLFLVLVGC-----------YHQPTVREPEYDIFVFAETDDWQ-HIERPLCQIFEKEIR-TPQLEKLFTIHYADFSKLEK-LSVRKNLLFVSTLESQGEIATIVKNMVRSPEMVRKIQQGKYFIFKKENQWVENQLLIALIAANRDSLVAKLHRNAQKLYNLFDKHNRKILLRTMYAQENKKLEKQLLDKYGWSLRVQHDYFLVKETSTNG-GFVFLRRSFPERWLFVHW---------VQTDDATKLMTPEWCLNRRDWIGKKFYENDRVNRKFTTV--------KLSEFNGRLAYEVTGLWENEEKIAGGPYKAYIFYDEPTHRVYMIDIAVFAPNKRKLPYLAQLDVMAHTF. 335
292 5.000e-61UniRef50_A0A255T3Q2 Uncharacterized protein n=1 Tax=Prevotella sp. P5-92 TaxID=2024222 RepID=A0A255T3Q2_9BACT  ali  16  11YVCITALTLTACNGDNS------VMMPDSIGNAYDVTLVTKDKRLCNVALDILDTVM----PAMTQHERLFTI--LTFNSISGATRYRRTLVMVRL------------------------TGDKTHIRYEHNAYASPQLLVFIESPSAEQLKTDCHKAKAAITKLIDGFETATAVQRARKSPNRMAQQEIRRLFNARIDVPNEMASAKR----GKDFLWFSDNGTKTMRNICVYATPGTDCS-----------ANRLVDLRDSVMARNIPGERQGMF-MTTEHRAGLRHQR----RGPFTVIHGLWAMKDDAMGGPFVSLSLPDTTRRRTITAEAFLYAPSVDKAQTMRQLEALLYTL. 312
293 7.000e-61UniRef50_A0A2E4YSW2 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E4YSW2_9FLAO  ali  19  9.ITSFTLLVLGCGS---ADYNQEILKPNSRNNFGDLLVVLDKKFWNSTISHTVKKNFGQLITTTPLPEPEINVEFVDQAGVNTMIKRHKTILIVNIDPA-------------------AKKNSELSPSPIFDLWAKNQIVYKINATSEKNAVTLINHHADSLKLGINQFYHRSFLA--KSSFNNSANKLLEKNHSITLSLPSNMKVKKSNKE----FTWLNRGDHEIQQGLFIYTYPYVDENAFSNQVQ--------VNLRDSLLKKHVHGTTPKSYMTTRDQLAKLNSTAKLINNKYIYNIKGLWRVENDKMGGPFSSISAVSEDGKNVVTIEGYVYAPNFGKRELIRELEAYMFSYK 341
294 7.000e-61UniRef50_U2JMN0 Uncharacterized protein n=38 Tax=Prevotella TaxID=838 RepID=U2JMN0_9BACT  ali  24  10..LVLFLTLMACNENS--------LKPTSYGKPFEVLIVGDR-------KNSISNVLSSPMNGLPQAEPTFDVIKSAADTLNGDEKLLSNIVIIKIDKQYKTTE----------------------LSSQQDIYARQQVVVTITSPTEKAYMGFVKQQGEKLRNYFIKAEXXXXXXXXXXXXXXXXXXXXXQMFGIKVKIPPDMTASKV----GKDFLWLSNNSPSSMQNMCFYTIHAT----------------NFRQQCDSVMRKNIQGERKGMYMRTAA------ITETTQNKGKSVTIRGLWEMKDDAMGGPFIAY--WKENGGKIIVSEAFIYAPGAKKRNALRRLEAVLYT.. 299
295 1.000e-60UniRef50_A0A255TQ12 Uncharacterized protein n=1 Tax=Prevotella sp. P2-180 TaxID=2024224 RepID=A0A255TQ12_9BACT  ali  20  7.FLIAATIMTACGNTKAG-------KPMSVGEPYEVTVIAEDN----NLAALTKRMLTDTREPMPQPECLYNVR--TMKSINDVTKFMRILVVVR------------------------KNITETRVRYEYDPYSRQQLMILIDVESSKRLKEDSLNVAHTLQNTIELFEMKNAARQAHNNSNLALAKEIEKTTGCHIDIPNDFKASKT----GKKFVWVSDNGTKTMCNICVYTVDGIYNST-----------ENIIRIRDSVMAENIKGEKDGM-VMTTERKADISTN----NNGHATTIRGLWQMTGDAMGGPFISVTKTDSIRQRTITAEAFIYAPSEPKAKAMKRLEAILNTL. 306
296 2.000e-60UniRef50_A0A2A5CX16 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5CX16_9BACT  ali  21  7.ILTILSLWVGCDS----------VKPRAMGADNELXVVA-AFEDRDKIQQVLTTIFNDTL-YTPQPEPYYRTVWVDPENFNDVNNHVNVIVAAMGDHPRNLGAKLVKQILSPSQYASSMKGDNQLIFAQ-DIYARNQNYLIINGPTLDKIIERAEDQGPWLKKQYDDLFFKRQSKHLFSTLQKDLSKELADKYGWTMKIPWGYTVIADSAEQK--FFWMGRDMPYRW---------------LAVKWADGLVFQDSVSVHD-----YVKEIPLDNFDHIQYSDYQFKIEPSEFNDRGAWKITGLWESIEEAQGGPFILYLFYDEPSNRTYFIHLMIFHPGKDKYMLLRQVDIVAHSF. 330
297 2.000e-60UniRef50_A0A1H6L989 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1H6L989_9FLAO  ali  21  38WYLFLLFVVLSCKKNEVSVVR----LHPSFGDRNEVVLVLDDSLWIGSFGDSIRSHLARTTTISGNTEPIFTLLQLDPKIFTSKAKLARNIVLFSTNNQYE-------------------------FLLQKSVYATPQNFFFLRAENTEDLLKMFKKNADSIASVFKASELNEEMHQVVRASTHNLNE-LKDFFGCTLKIPDNYHL---QVQDEFPFLWYQRDLPSGNINLVLYEFPITEI-----ENDKGSVENHLLQARNFIGEEFMKTAKDQAY-ITTSTEIKYTITKETLQNLPAYRITGNWETVNDYLKGPFICYAIRDDYYKRYLFIEGYINNPFKQKGEQILEAEAIIKSI. 356
298 3.000e-60UniRef50_A0A2D8WFL2 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D8WFL2_9FLAO  ali  22  5FVFLXLISLFSCQNEKNN------LLPRSTGAINEIIFVVNNDLWSTNVKDTIYNIFAKQVEGLSWXEPSFDIVQIPXSSYTKIFQTHRNIIFLEKSDTN-------------------------KLYFLKNKNSKDQLIAIFLFKNPKDLXXNLIINGPKVFNAFKKIELNRLLSKSIKSSN---LDRIFSKHKXLFSIIEPFTXV----LDTTNFSWLEFXPKNKELIKGXFIFXXPSTKLF--------DDLSFVKKSDSIFKNYVLGEHKNTY-MEIEKNYPLHVSPLQRKHLYGHSIKGLWKIKNGFMGGPFVSNVIVDSLNNRTIFLYGFIFNPGKAKRNDIQEFEATFKSLK 316
299 8.000e-60UniRef50_A0A2N1VSV5 DUF4837 domain-containing protein n=10 Tax=Bacteria TaxID=2 RepID=A0A2N1VSV5_9BACT  ali  27  27...........................NSIGKEDEIIVIADS-VDYLKLEPALYETFSK-VIYTPQPENLFEIIRRPFESLKN-LKNRKNIIIIAPMDGKGFTADYVRSMLDSTVFSMVKS-GKEFVFNKYDLWAKDQLVMVLTAPNLSDLEKNILTQKEKLLYHFKKISDKRLSRSLYNSERKDVEAQFLRDYDWIIYVQSDYIVSKESPEDK--FVWLRRMNTDMERWFFIHWIDNATPEWLNKD--------SINAIRDRLTQKYYR-TTDNSFVSIAQDQLT-TVREVNFQGNYALMAHGFWRFSDKSGGGPFISYTFYDEQTRRIYMLDGSVYAPKYYKKQLLQQVDVTLQSF. 344
300 8.000e-60UniRef50_A0A2E0ULE2 DUF4837 domain-containing protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E0ULE2_9GAMM  ali  27  28...........................QAMGPDDLIIVVADSTEYAG-LEPLLRNTFAPPFH-TPQPENWFNLKRIDITELPN-YKRNKNIVFIAPLEGGSTVGEFLNSALDSTVKTLVR-NREEYVFAKKNQWFEDQTVLYLTGNSMEEIETKLVTEQQDLFYFFKNAWDQREKMRMMRPREDDLEEYLAENHGFSFSIIKSWFLAKDS-VEISSVLLRRQAPEETERWLLIHWIDSKNTDLLTPDF--------LLDRRNKLTNILYRTVDDKAY-VRVDTAHYLQWDEVNFNGRFAWRMQGLWQMSDYSMGGPFVSYLFYDEDHERIYLLDGSVFAPKYKKKKLIQDIDIMMHTF. 345
301 1.000e-59UniRef50_U7UQ79 Putative lipoprotein n=4 Tax=Prevotella TaxID=838 RepID=U7UQ79_9BACT  ali  20  21....................RQQRPLPAALANPYEVLVVGD-------ADSLVSHMLSVPMASLPQREPMFDVRQVEPARFKRKLLLTRNVVVV----------RWNRKWL-----------GKPSLHIERDRHAHPQLMVYVDVGSANELKRFIATNQHRVRQLLVTNEYLSAILQLQRKHSVGSGRLIDSMFHYTVLLPADMTYHKV----GKDFLWVSNNAAQSMQNLCVYTLSGMDDQSAERM--------------DSVLRANMKGETDRMYLRTVARSM--TQENVRFGGQSCRLQRGLWEMVGDAMGGPLVRRVVKDSVAGKSLVLDAFVYAPEMGKRNKMREMEAVLLTVK 311
302 2.000e-59UniRef50_A0A2H0FR24 DUF4837 domain-containing protein n=1 Tax=Ignavibacteriales bacterium CG18_big_fil_WC_8_21_14_2_50_31_20 TaxID=1974047 RepID=A0A2  ali  25  12.FFLAIFLFSACTNS----------KKPAIGNDDDIIVIADSLHF-LELEAEMLHVFEK-VIYTPQPENLFNLKRENIENLNQ-LKSRKNIIFLGSLNAKDQVSEYIKQAL-DSSVTKLVKNREEFFFNKNNLWAKDQLVMFIVANSAEELKKDILNGNEELLYSFRKISNDRLFSKLYKYENQKIEAELLNKYGWTIYVQPAVELAKS--DSTNNFVWLRSGRNTPERWIFVHWIENANASFLNSD--------SLINIRNRITQKHFLVSDDSVCVDISFGMSKPMVSQANFNEHYALMSQGFWKFSDKSGGGPFVSYSYLDENTGRFYMLDASIYAPKYYKKKLIQQGDVILTSF. 347
303 3.000e-59UniRef50_A0A0F9GS23 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9GS23_9ZZZZ  ali  20  1...................................MVVVIDNELWNGQVGDSIRRHFAAPVLGMPMDEPLFNIDQIAPKFFTGSIRNTRSVLYVMLDSVN-------------------------VAHVKTDMYAAPQNVGVIKGTTEAEIMENLASESNQIITAFKDMEITEAQKRFNRSLNRE--DVLQEKFGISLKVPSIYKVGK----QEDSFVWIDREIQKGTANIIVYQLPANSFT------NDSTLVRDIIAMRDSIGEKYIPGPDVKKTHMRTEPAYAPAVFPVEIAGVKGVEVRGIWDMKNYPMAGPFLTYILND................................... 254
304 3.000e-59UniRef50_I5C9J5 Uncharacterized protein n=6 Tax=Cyclobacteriaceae TaxID=563798 RepID=I5C9J5_9BACT  ali  25  1....................................................MKKIFQEEVPGLIRPEPMFSVKRVEPKAMTRILRMATNLVFVTTFDDKKPGSQSINAQFAQNLKDKAAEDRNFHMYRANDEFAKGQEVIYFFGNNEEELVANLENNRARIQNIFRVREKERLEKLILNRKSGDARAG-GEPLGLNLNLPASYQIAKA----ESDFLWLRQPTPNTNRSLFYHVQNYVSEEQLKPE--------NIMRMRNNITRQHIFGDPSNSFLTLEYEYPEPTFFYTQVAGNYAIEMRGGWKTNTNSMGGSMLGIAFVDQENNKLYYMEGFVYYPNEKHREAIREIE....... 292
305 4.000e-59UniRef50_A0A1F3C7L7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWA2_31_9b TaxID=1797315 RepID=A0A1F3C7L7_9BACT  ali  22  1..............................................................................................................................MVIQNDLYAKPQIVINIIAPSDSIMEELIRDKGDLIVDRLLKKEMSRYASNYTKYEEKKVGAQIKKKFGIDITIPRGFKI----EMDTTEFVWIANDSPSMAQGILIFSYDKPDFELTTPY---------IIAKRNQYTKQFVKGGNINSY-MAVEEEIKPFRREFNIDGLKVVELRGLWRVEGDFMGGPFVSFTLLNEKTNKIIQVDGFVYAPQYDKRNYVRQLESILNSIK 219
306 9.000e-59UniRef50_A0A2D4QYD7 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2D4QYD7_9FLAO  ali  21  9.CLLILAGLSSCDEKNLAGL-------NVTGKVGEILVVCDDAIWQAPLTNELDTALTQFIMPYWPDVPTFELVHRNSKTFEGAIKRHRNILFLTIDKGYTA--------------------SEPSIVSRKDVWANRQLVIEITAKNIEXLYATCRDGLQEVHDSFDTAEWNRIRKYFREKQSPYVNDKIADGFGIHIELPDGYRIQLPNASRPIEFIGTGQDVGAIYSGVMVYQYPFNDSSQLSHK--------NLLQARDTMLKYNVPHETSRLYMGTTDLVYPESSKSSNYNGISGIEMRGMFVFKGHTTGGAFWSFHFVHPKTNKLICISGXVDAPSTTSWTHLREIEAIWKSV. 348
307 1.000e-58UniRef50_A0A2E8SGQ5 DUF4837 domain-containing protein (Fragment) n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E8SGQ5_9FLAO  ali  20  1.......................................................................DLKQIPPEVFTGFAQSSRSVLWVGIRDQTN-------------------------IRIDKNTYAQPQTVAVFTAPTPTELTEIIISQSDEVIKTLRTQERAERLRRIRKS--TYANHGLDKKFGFTLTMPSAYKTLK----ENETTSWFQREIQKGHINLLVTTTPYDED------IVVDQNLEKIIAQHDSIGKAFIPGRLPNS-HLITEKAYEPYIYSTTFGKKPALEIRGTWEVQGDFMAGPFLQYIINDKPNNRNILLEGFVFAPSIAKRDYVFEIETVLRSLQ 250
308 1.000e-58UniRef50_A0A1W9SHV3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4572_128 TaxID=1971633 RepID=A0A1W9SHV3_9BACT  ali  28  11FFLIISLFFFSCDSDTK----NKILLPGITGKIGELVIVIKKDNWKSKAGNKIRDIFAKKYEYLAQNEPLFDLINIPHNAFSRIFKTHRNIII----------------------TQXXXXXXXXXXXXXXDVFATPQVFISVTAKDEKDFLDILEKSKTKIVNYLLQEENNRISKTYKKLENKNINSFLEKKHNISMVIPKSYTL----DMDSSGFSWTALN----------------------------------------------------SYMTIEKKFFPIFFQKFRKKERFFTRIRGLWKTNGDKMGGPFVSLTTLDKKRNKIITIEAYVYKPNKSKRDLLRQLEAILGTCK 291
309 2.000e-58UniRef50_I4Z714 Uncharacterized protein n=8 Tax=Prevotella TaxID=838 RepID=I4Z714_9BACT  ali  20  12.LVTAILILASCKQ--------VNTRPKSVGKPYEVLVVGD-------VDNIVDSVLSTPTPGLPQAEPLMDVIH--AKQLTSDNNNFRTIIVVNMDNVPKKVA-------------------EAHSVEKANEFVDNQQTLYIFASDKKALKEI----TQKLRRTILTTEIAREQRNLAQKPNIKAAALVKKMFGKTMLIPQELTASKA----GKDFLWLSNNTAEGMLNICFYYVD----------------AKRFETQHDSIMQRNIQGTQKGDYLSIATLATRIVNKDTKNTT-----IRGIWRMRQEAMGGPFVTYILHNKKQGKCLAVEAFLFAPEKEKRNRMRRLEAALYTL. 304
310 3.000e-58UniRef50_D1VW50 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=D1VW50_9BACT  ali  20  9FSLLCLVMVTACRQ-------QKTVLPASTQQPYEILVVGD-------IDSLLYHCLSVPTVGLPQVEPTFDVTCVKTGDFDAQQRLMRQIIVV---------------------RQHQEERNKPAISHERNRYAQPQLVMYIDVNSKKELQRICENMGKEIRQVFIAQEYEQNILHLRQNHEVKTAQKVQRMFGYRLMLPADMQSYKV----GKNFLWLSNNAVQGLQNICVYAI--------------QGLKQPTLQQTDSVLQANIKGETDENFMQTVRASMQEETFFFHQKRQNWQ--RGQWEMCGDMMGGPLVRKVVIDSTERQAVVFDAFVYAPEGKKRNRMRALEASLLTIQ 314
311 4.000e-58UniRef50_A0A1H9BTT5 Uncharacterized protein n=3 Tax=Flavobacterium TaxID=237 RepID=A0A1H9BTT5_9FLAO  ali  22  37...............................NQNSVTVLISNSLWEGKVGEKIREKFAAPIVGLHECESLFVLMPV-HGALTTEAKASRNILVLSKKEQSET-------------------------KFEKDKYIKNQKIYTIEGENEEMILKQLQLSYKEIMKTFYESEIQLLLQ--KSTTNKKLQQQVKKQFLVDIQIPKEY----SKGLQGDNFLWLRKEIGSGYNNLLIYT------ASFSAIYNKNAVVTNSLFIRNQVSKKYVLGKTKGSY-MVAEPAYYPNFETTKIHNNLAYEMRGSWEFHNDFMTGPYINFAIKDNKRKRFIIIDGFAFNPVHSKKELLFEMEAIIKSTK 325
312 7.000e-58UniRef50_A0A1Z8LD42 Uncharacterized protein n=2 Tax=Cryomorphaceae TaxID=246874 RepID=A0A1Z8LD42_9FLAO  ali  22  10.ISVFIIMSSGCSLEQATDKKETSFMPSSNGTHNELTLFCDNDLWNN-CGIKIITSLAEPVKGLPQNEPRFNLSRLPHNSISNITKRSKSILSLQIVPDSSS------------------------INFKYNVWAYPQLVIHIVAPSANLLTKLFDSHSKEIIKKYELHDQEILKNRISSSSKTLLPKSLKE-LGIKMLIPRAY----NTTISKSDFKILRADTKKSIQYLMAWSRPYIESN--------YNIESKIISEQNELMENNFEGFQEKSYL-SLESKIPIDINYSNKNGIYVIEHRGLFRTELGFGGGPFVTFTYIDEKNKRRLSISSIVYAPSTKKRKMMLELEASLRSVE 333
313 1.000e-57UniRef50_A0A0R2RDV8 Uncharacterized protein n=2 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2RDV8_9FLAO  ali  18  1......MVLVGCQSESQSPEERKSNLPSSNGTHNELTLFCDRSLWEDGLGISLLESLAKPMEGLPMAEPHFDLSRVDQKAVSSLTKRSKSILSLAVIPDSSAT------------------------LVIRDLWAEPQLVILIIAPSAEQLKVNLQQVLPGVIEKFDDHDARVLIQRIKGSQKHVVPASLRD-FGVSMSMAKGFK----TTFSEAHCAILREDTRNSIQYLLGWDQPWDGESD---------PSQAILDVQNTYLNSHFEGVQEGSYLAI-EPRIPVVQAYREINKRFTYISRGQFRTEGGFGGGPFVTYSYIDETQERIVSLCYLLYGPSMKKRKVMMEFESSLQSVK 319
314 1.000e-57UniRef50_A0A0B5RSH3 Uncharacterized protein n=9 Tax=Myroides TaxID=76831 RepID=A0A0B5RSH3_9FLAO  ali  21  3...............................EPHQILIVINDRLWYGSVGDSIREHLAIPIEGITPPESTFSLEQISPNLFSSRTRNRRNIIVFSDN------------------------YNSNSFLFEKDKYTAGQMYFTVSGDSRKGLIKEFKNNADSIVNSILRSEFDVVARRILEGKIVDT-DYFQDKFQVSLNLPTTYKLVGSNY----HFVWFKKNIASGNSNILIYDVPIDRI-----ENTEGTILNNLLAVKDSVNGKYIHSIEDNSYLRLNEGFI-PNNKEFVRQGRKVYEFTGEWDMNNSFMSGPYMSYVFRDVSANRYLFIEGLVYNPAMGKRGILMEVESIVNSLK 295
315 3.000e-57UniRef50_A0A2E8KXS3 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E8KXS3_9BACT  ali  21  11..LLLAFVLAGCD-----------YKPRAGGIENQLHVVV-SFEDQSHVKAVIDSVLGRAI-YTPAPETYFDITYIDPFEFSSV-KRSHNLLVISVLGIPDTTVDRIARSMLPPAQLDLATDGNTQIFSTRDFFARDQVFSLVVGNDPADLIRGLRNRGTWLFQQYDKAFLERQKEHVFKRREKQLSAELWEKYHWRLRIQHDYVMIREEPER--NFVWIGRAFPFRWFSVNWIDEPRT----------KDLDQLMVTELVNDFPMAY--------YNKIRFSDVYQRAESVDFISQKAWRVEGLWEHNKEVKGGPFISYVFYDEKSDRLFHLNFLVHSPGQNKIISLRQMEIMAHTF. 333
316 5.000e-57UniRef50_A0A1Z9H4I6 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1Z9H4I6_9BACT  ali  20  9FILFALAFFYSCSFD----------KPRAQGADNEIIIVCSNEN-KDEAMYILSNIFNDTL-YTPQPELSFNQVWVTPNKFNEIKKNVNVVIISIGNDIDNPGTGLVKKLLSEDQFSSGIFGNNNLIFT-RDVFARDQNMLIINGLNNDVINKTVIEKGPWVEKQFEALFVHRQSQYMSSSRQIELENNIKKNFNWSMKIPYGFTIISDSLS--KDFFWIGREMPYRWLAVQWSEGLLFSDS--------------------STASQYVKSLPLKYFRTIRYADYYFKIEPDLFNERGSWKVSGLWESIEEAQGGPFLSYLFYDENHDRTYFVHTMIFYPGKNKYLLLKQLDIIAKTFE 335
317 7.000e-57UniRef50_A0A0S7WMD5 Uncharacterized protein n=1 Tax=candidate division TA06 bacterium DG_26 TaxID=1703771 RepID=A0A0S7WMD5_9BACT  ali  20  20..........................PYATGREDEVFVIIDRGTWDG-LQELLKATFEKERR-IVQWERIFSLQRVDPDEFPR-YRARKNLLIVGRV-AGQRTSELIQELLPAASMEKVVEKGG-GVFAIENPYREGQIAFVIAGMDTDAIRETIEKSSDSLFEILWARVKERIKERALHRLNRRLIEMIEEKYGWSLKLPQQYRLSK----EEENVVRFTRHYPD--RLVSVYW-----------EEGGELTQSSCLEKRAWLGKAFFDGDTLLPEMT--------SVRDAELDGARAVRIDGVWQNEGQVMGGPFISFCIRAPVLNRNYLIDGLLFAPGKKKWIYLAELEAIVESFQ 322
318 9.000e-57UniRef50_A0A2E7CUS8 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E7CUS8_9FLAO  ali  19  8..LSILLFTLGCSEEDSNDYNQKLYKPNSTEDLGEILVVTEKINWENEIGQSLKTNFENLVSTTPLPEKEFKLDFIDPKGLIKNIKKHNCILELKIDKRIQNTTSLPEPIL--------------------DQWANGQIIIKIKFNNQKSAVNFIESNAIQLKQVINDFYYSKIIKNY--SFNGPINEMLKKKYAFQLALPDSMKINRSI----SNLTWLSQLTTEKDQGLIIYEYDYKDTSQFGLNKQ--------IFLRDSLFKKHIVNKSKGTFMTTRKEENSGNFSHINLNGEYTVEWAGLWRVDNDKMGGPFVSVSRLNPSKTKIITIEGYVYAPNFNKSDLIRELKAVIYSLK 348
319 1.000e-56UniRef50_G6AF52 Uncharacterized protein n=3 Tax=Prevotella histicola TaxID=470565 RepID=G6AF52_9BACT  ali  20  20........VSSCNINKGQ--------PVSGGKPYEVVVVGDQD-------SIVTKTLSAPIPDLVRKEASFDVIQVRKLRPNDLNRLSHAIVTVTIDP---------------------QKGKNIQLTTERDVDVQKQVIVHITVPNTTVLRLFMERNGSRLRNYLNKFEIERAQEALASHHNKTAEEAIQKMFGVQMLIPAEMKASK----KGKNFLWFSQEDGANSVNICLYR----------------ATDIDFKRQRDSVMRINIPGEHDGMY-MQTASLTTVHINPGKSVTNW-----GTWEMKNDEMGGPFVAY----HPIGTDITAEAFVFAPNKSKRNLLLKAEAALYTLK 304
320 2.000e-56UniRef50_A0A2D8KFE4 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D8KFE4_9BACT  ali  21  17...................SACQDTKPRAQGGDNEIILVCSKQ-DKIELESILTTIFNDTLF-TPQSEPHFKVIWVEPERFNEIKDYVNVIIGAIGEFSTNNGSKLIKNILTDEQYNSTISGDNHLIF-SKDIYARDQSFLVINGPSFEKIHSLAQDQGPWIKKQVDDLFVKRQSMHLFSTLQKELQNKLIDKYGWNIKIPWGYTVIRDSSDQQ--FFWIGRDMPFRWLAVQWKQGLLFSDSLSVVSYAKIFP--------------------EKYFEHIQYSDYKFKVEPSIFSDFGSWKITGLWESIEDAQGGPFISHLFYDPSKDRTYFIHSMIFHPGKDKYLLLRQVDIIANTFQ 333
321 2.000e-56UniRef50_D1P8V8 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=D1P8V8_9BACT  ali  20  14...LLFLFLASCSPGGGRNRK----LPKSTGQPYEVVL-------EGDTDSIVTKILTEEVPALPQPEPLCRLIQVKKGKIHGSYLLVRTRIVVNIP------------------------AAEFSVRLSRNENASPQTVIRISARSLQQLREKL--NPEKLRQFVDETELEHLASIISSKQNREMQQLVKKNFGISMIIPAEMQASK----KAGNFIWISNNASSGMKNLILMKVKREERR---GKANSDAFPAQEKQQIDSMLRTNMPGETDSMYMII-----------------PVLSEKGLWEMKGDAMGGPYVMRRIRLRKTGDEIIIIGFVYAPEMKKKILIKQLEAAISTIK 311
322 6.000e-56UniRef50_A0A2E6HW21 Uncharacterized protein n=4 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E6HW21_9BACT  ali  20  17....................SCGDTKPDSVGPTQEILVLADPADW-AVLEQPIRDTFEK-VLLTPQAEKIFSVQHGLMADLESHKHLRRNLLVVSPIDATHDVGEFLRSLLSDAVTARID-EGQARVTWKRDVWAKDQLLMIASGTNLDDIXXXXXXXXXXXXXXXXXXXXXRVTKLIYKYERKDVTDQLLREFGWQIRVPFGYRILESKPD--SGFVALVKEEPN--RWFFVYWEDGIAPDTLT--------EDWVVDKRDQITRRFFDNDRIAPG--------EVDVFHDEFQGKLAVVLQGLWENQKQWTGGPFKSYAFVDTELERFWFVDVGVFSPNKRKETYLRQLDLIAQTF. 333
323 8.000e-56UniRef50_A0A1W9RYD3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium 4484_93 TaxID=1970780 RepID=A0A1W9RYD3_9BACT  ali  21  23..LFFALLVIGCS----------RYKPDAMGSYNELITFGNKAIVDS-VKPALMDVWSKTIR-TPQEEKLYRILYRRPEEFK-HYRKYRNLLLIGRIGAYDPISKMVTEALDSAALEEARL-GISYIFTKQDIWARNQLVIFLVSPDANLLSANLINDRRELFKYLDQSVNERLSEWLYDGEQFEIEDSLRNLFGYSIRIPRNFDIETLS----NNFVWLRALAPDRWVFIW-----------FTNEPPESLSIKWWRETRDSLCSLYYEGDIVVAGTEQLE-------QTEGLGDNPVYRIRSLWKNPHSLLGGPILSYILYDERTGRLYIIDCALFAAGTRKEPYLRHLQIIAESF. 347
324 9.000e-56UniRef50_A0A2D9VQF3 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D9VQF3_9FLAO  ali  21  17YIIISIIVFFG-VFFWLSKLQLQSELPNAIGDPLELVVVRDSDAHTNRFYQTIKNLLNTDLGPSPQPESILSIIEIENNKFTGILQRHHNILIITKSDNFN-------------------------IKFENDVFAKNQTVIIISCNSEHELISN-EEKIRQLHEEIKTVEINRLITSIEKKNNNNLKNKILENHNVSMLVPNGFFLA----HLEKGLTWIRRETNKLSQGVFLANIPPEMEQLFFTQTSIAI---------DSMIRPHILGPISGSY-MITDKNAPVKKDTISINGIEMIKQQSLWRMKNDFMGGIYVSYIFHGSSQVEPFIIYTYLYSPGEPKKTPLIQLDAIVRTL. 333
325 4.000e-55UniRef50_A0A101GB42 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A101GB42_9BACT  ali  20  7.LSLILFTLFSC----------EPYKKLAVGNDGPVYTFVDDSLW-AIIEEEIRKPVEKEIR-TPQIERIFHFETVPLSDFKD-YRASKNLMFITTLDRKDRTSLYVQRMLPDTALRMIEK-GERYLFPIKEKLAKRQIFIILAAPDDEALLTFIRNEGNSIYDALNKAFIERQFEQYYKAEEKEITKKLFEKYNFSFRVPHSYQILEENPNER----IIQLGRTNPYRWVTIYWQKGGLTSVL--------DERWAVTMRHWLSLNYLDGTYVEKRFLT--------HRLVHWGNRPVFNIRGLWGHPEKTMGGPFSSFYFYDGVTDRTYFIDVCVWAPGQIKNVYLRQMELMVSTF. 330
326 5.000e-55UniRef50_A0A2E6QLS6 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E6QLS6_9PROT  ali  22  7.FISLVSLIFSCDSETSKRK----VLSESTGKQNEIILVIEDSDWNGVAGDILRKTFEFEIDGLPQSEKLFNLVKINPSQFSRFFRTHMNIMFVGRDYKDS---------------------------YTKNKWAKPQIVMYINSNSNES---EFETSCVRSFNFLNRKEIENIKYSYKRAHNTEARKYIQESFGIDLFLPTEYSVSKSENLFISDFHSF-NEKQDLLKYILVYEL---------FPNNEVDIQNQLINFTDSILKENIKGAVDGSYVQI-DRRMPLS----EIDGTY----RGIWTLKNGFMAGPFILKSRYIE--DKIIVSLGLVFYPNEDKRDYVRTFEAIL.... 306
327 6.000e-55UniRef50_A0A2E5XCQ3 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E5XCQ3_9FLAO  ali  24  17.IIVIILLFNNCESNTN--------LPQAIGDPLELIVVKDQNLYEESFYDNLKFILKRDIGPSPQPENTLSIIEVNADKFSGILKRHQNILLISKADSFS-------------------------IGYKTNMFANNQLVLFLNCSSSQDLNAN-TQKLKSLIDKIKLTEIERMILAHQKNPSSNLNKQISTKHNLDFIFPSGFFYAY----EDSNTTWIRRETPSISQGI------------FFTNFSKDINLDNINELRNKINSKHILGPIEGSF-MSVDKSAPITIDTFLFDKSEAIKIQSLWRMENDFMGGVFVAYFLADHSPPTLIY--SYLYAPGEPKKIPLLQLEALMASL. 323
328 6.000e-55UniRef50_A0A2E8GUQ4 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E8GUQ4_9BACT  ali  18  8FLFSVLLILIS----------GCSTKRESLGSDNEIIVIA-SIEDQEDIRNVLEKIFSDTL-YTPEPEPFYKMKFVSPKGFNNLKRQTNLAVASIGDNLLNPGTNLVKNLLGKDNYERTIDGGDHFIFT-EDQFAKGQLFMILSGQSKDDIIQDIRGKEEWVRSRFNENFNRKQKKYLFQMRRKDVEEDFMKKYQWSLNIPWGWEIIQEKPD--SNWVWLGREMPYQWVSVHWEEGLTASDSLSAAEVGWNFPQKF--------------------YGHIRYHPYKFNIQQTRFLHWTGWKVTGIWESEQEAQGGPFISYIIFDGVTDRTYHINILIFYPGNDKSIYLRQMDLIAHSF. 331
329 2.000e-54UniRef50_A0A1Z8QU55 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TMED39 TaxID=1986664 RepID=A0A1Z8QU55_9BACT  ali  20  6FVIFCSLFAF-CDKGNNKQ-----IKLESYAKYGDFFILADDRLIQHQMKETFLNVFSAEEENLLPPKPRFLPRFLPLDQMGNFTRRYFNSIILLDNKSKDYFLSLFDRQTGQNLLQKI-NEKNAFGFVINNLWAKPQKTLIIYAENQNSLLEKIVKNQEKLIQYVEQAELSVGENKMFGKARNSSFIKMKKSRKFALPLHPYYRLALN----KKEMLWYRRNSKKMDYAICIYEEPFASESQFELNY--------IKKMRNQKTKKFLKGQLDNTYVEI-DPEIDCSFTKENFSGMPCYTLKGWWSMNNDFMAGPFVTRTIFDQKNKRVITIDGHLYGPEVNKINHLRELEVYIHTFE 348
330 2.000e-54UniRef50_A0A2E5W1J5 Uncharacterized protein n=9 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E5W1J5_9BACT  ali  24  24..IICLVFFNSCEN-----------KRDALGADNEIRVIC-SEIDKAHIQQYLKEIFIDTL-YTPEPEPFYHLKFSAPETFSELKSQSQVVVATIDEETNSSGYRLIRKLLPEKDFNSMRVSN--PVLISQNIYAKKQLFMIINANSIEQLIPTIDEKRNGIRKLFREHFIKRQHPFLFNDHNESIQDSLIEKFGWDIRVPWGWEIIKIK--QDSNFVWLGKEMPFQWIGIGWESGNLVNDELSAGNHIWNWMQVN--------------------YGTVRINNYKFKLDKTELKSGLAWRAQGIWETIDDSKGGPFKSYMFYDDKNDKTYHLNYLIHHPGKDKSIFMRQMDMIIKTFK 346
331 2.000e-54UniRef50_A0A2E7MWI5 Uncharacterized protein n=10 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E7MWI5_9BACT  ali  21  15.LTFGLFLFFGCQDT----------KPSAQGGDNEVVLIA-SKYDQVFLMKAVSMMINDTLF-TPQPEEHFKIIPIEPDRFNDVSDYVNVVVGAIGDYPSNKGTSLIKSILTNEQYLSSMNGNNHLIX-SKDVFARDQNFLVINGPSSDKVYQASYEQGPWLKKQFDDLFIKRQSLHLFSTLQAELQTSLLSKYNWSIKIPWGYSVIRDSSDQK--FFWIGRELPFRWLAIKWEDGLVFSDSASARKFSK------------SIPLKHFRN--------IQYIDYKFKIXPSTFNSYGSWKITGLWESLNDAQGGPFISHLFYDADQDRSYFIHSMIFHPGKDKYLLLRQVDMIARTFK 339
332 4.000e-54UniRef50_A0A2D9XJ39 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D9XJ39_9FLAO  ali  19  28....................SDSSNLPQSIGDPLELVVVKNTNDFDAEIYSTLKTLIGVDIGPSPQPEKLLSIMQVDLEKFKGVLQRHQNLLFVEKSDTFS-------------------------IQFKYDVFAENQLIILLQVSSGEDLIAR-DKELLGVVKKIKETEMARLSQKFKKHESQVLSNQIDVRHGLLINVPKDFFIAY----KDSNITWLRRETSKISQGLLINSHSLHHSDFLKLKYSDTMAVDVAFDAVDSIITEHILGPLPNSYMM-LERSLPTHINAPESGSH--IKIQSLWRMENDFMGGVFQAYFF-----ERGPLVYTYLYAPGEKKAIPLLQLESLLNSFK 330
333 5.000e-54UniRef50_R6E8D6 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1320 TaxID=1262922 RepID=R6E8D6_9BACT  ali  23  16.........TACANGPGA-------LPDSGGKPFEVLVVDDSD-------NLLTRLLQVDAEGLPQREPSFDVSRVASPQWKGSLRLARAIVV---------------------------RDTSRTMRREVDRYARPQLIVYTDGRDGKRLLALLQE-----------FELRVATEWLRQRHNAKMEETIRQMFGVSVLIPSDM----NSARRGKDFLWLSDNKASPMRNVCIYKG----------------------VNRDSVMRQNVKGETDSMYVQTVKG--TLKERPLPGGGVYRY---GLWEMKGDAMGGPFAS------VTRQGVTIEAFVYAPGGKKRNLMRQLDAVLYSL. 275
334 7.000e-54UniRef50_UPI0009DF99DC DUF4837 family protein n=1 Tax=Saccharicrinis fermentans TaxID=982 RepID=UPI0009DF99DC  ali  20  2..........................................................................................................................KNTNIRYKKNVWATHQQLIEIDIPNIASFSTAFEEHRTRIFNFLYEGDIKTMQLANQKGADQKLSHYIHKKYGINMALPKGFKLMK----DTADFCWFTFDRLATSTHIVIQSFNIKNLSSINNEY--------LVYLRDSIGKAFIPGPSELSY-MQTEKRLPVMAKNKQINNMNITEIRGLWKVEGFFMGGPFVNYFIRDKAHDRLLMIDGFIYAPQKNKAHYVRQMESILRSVK 226
335 2.000e-53UniRef50_A0A0R2SHW8 Uncharacterized protein n=2 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2SHW8_9FLAO  ali  17  6.VVILSLGVASCGPDGADPVKRERTLPPSNGSHNDLTVICPQNMWESFAGLAVATELGKPAPALPQSEPTFSIIHAVPEKVNGLLRRGKSLLNLAVIPDSTA------------------------MLVVHNVYARPQIAIQVIAPSAEALQAMLPQALAKASALYREHDATVLAARMRKNAQNPLPKEVKS-LGISMTLPEGFVVTLSNP----DLVVLRLETKKSTQYLMLTRTPDSDSPT---------PEADVITDRDALLRQYFEGPQDKS-HLTTEMLLPPVQAFDDAHGVRRLSTKGLFKTVGGYGGGPFVSRSFLN--NGSIGTADALLFAPGTSKNRLRMELDLITASV. 323
336 2.000e-53UniRef50_A0A2E9KT66 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E9KT66_9BACT  ali  21  11...ALLXLMIGCG------------KPLSKGADDELIVLAAKE-DKTAARTILTRIFSDTL-YTPAPEPYYKAKFVKPSDLENV-RHHPNLIAISINDDTNPGTRLVKSILPEESFTNSKNNN--PFILTNEPYAKLQTMLVINGNSPESIVSAAEIQGLKIYEKFDEQFIERQSRFLFKRARKELEQNLFNKHGFSLQIPWGYTVVQDSVE--TNIFWIGREEPF--RWLVFHWEDGMVIQNMNDAEQFSREIPQRI------------------FGHIQYTDYKFNIKPTMFNVWSGWRITGLWESLDESQGGPFIAYTFYDGITDRTYYIHALIFNPGEDKYLLLRQLDIIAHTF. 328
337 2.000e-53UniRef50_A0A235BYK9 Uncharacterized protein n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A235BYK9_9BACT  ali  19  7.CIVVATLFSGC----------RRHVVSAVGPIREVTVVSD---WWGWVEPKVXEILQQRIP-TPQPEPEFKLRIFTPDXF-RTYSLFRTVFLIGTVKDS-----IICQVLGPKLDSLPX--GDYGLFKVPNPWAANQELVIFVAQDENRFLPGLEIYSKRIRKTFYDIVLAHTARALYHYRRSQAADSLSKMYSFTLDIPKRWFLKQEHAD--SNFVYMF--GHYPDRGVFVHWENAE----------RPLIPGSLLTLRDSLTARYYDGDFVEDSLVTADT--------VEFLSGMALRFRGVWQNRTEVIGGPFVSYSFNHE--GRFFMVDGLVFNPGKRKLDQLFQVEAIIRTF. 318
338 3.000e-53UniRef50_A0A2E9QH83 Uncharacterized protein n=5 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E9QH83_9FLAO  ali  23  3FLFLCFLVFSSCTEERK-------ILPYSTGKNSEVIFVVDDLLWENTIDSLVKITFGTAIDGVNQVESLFKVIQINHSELKSILKTHTNIVIVLEGGVKSS---------------------------QKNKWAKDQFVAQLNGNNHQTLLKEL----AQLRDLFALKEVRSIKKDLKKSSQKNIEQTLFNSFGVECIVPKKYEIVNN----DSAFFWANYDPKKSDEIKNI--------LIFSFVPKTKNVQAEVLFKTDSVFAKHLIGLKENSFVRIEKEYPPFYFQNI---------YRGLWKLENGFMGGPFLIKTYF--IKNKIVVNIGLVFDPQGQKRKHIKEFEAIL.... 297
339 3.000e-52UniRef50_A0A2D5C4T5 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5C4T5_9FLAO  ali  24  4.FFISLLLFLSCSNATKT-------LPNSTGKISEVIFVSDDNLWQDILQKLVVKTFGRPINGTNYDESLFKIIQINFSEFKSILKTHKNIVIISDEAINSSEL---------------------------DKWAVGQYVTQLRWSNSPQ---NTIEDLEKLCLMYKNREIKYVREVLKKSSNEELERKFSINFNNSIVIPKEYKSVM----FTDSFFWASYDPNNSDVIKNI--------LSFSFKKNDTNFHSQVLSKTDSIFKHYLAGSNEGSYVRIE-----PLYKPIISKNIY----RGLWRLEGGFMGGAFLIKTYFEDKKDKIHVNVGVIFAPQSPKRKYIKEFEAIL.... 301
340 5.000e-52UniRef50_A0A1Z8T7U9 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1Z8T7U9_9BACT  ali  21  12.CIIILYFNISCDN-----------KREALGADNEIRVIC-SEVDREAIQKFLSAIFTDTL-YTPEPEPYYHLKFSDPSTYLDLRSQSQVVVAALTRDVGNPGYQLVKRILSPEQFSF--TENQDPIILGKDIYAKKQLFMIINANSADQLMSTVNEKQANVRKHFHEQFIERQGRYIFADRNKDLEDSLSMEFGWTLKIPWGWEMIKKRPD--SNFIWLGKEMPFQWIGIGWTKGDIVEDDLSVGEYIWNWPIKN--------------------YGNIQINDHKFKLDKSSHNNYPAWRAEGIWETVDEAKGGPFRSYLFYDPKENITYHLNYLIHHPGNDKSIFMRQLDMVVKSF. 334
341 2.000e-51UniRef50_A0A229I562 Uncharacterized protein n=1 Tax=Prevotella copri TaxID=165179 RepID=A0A229I562_9BACT  ali  20  27.FYLIFVLLTSCDITGKNRK-----KPASTGQPYEVVL-------EGDTDSIVTKMLTEDVTGLPQPEPLCRLIQVKKGKTQGSYLLVRTRIIVNIGER------------------------DFSVRLSHDENAAPQNIIRITARSTQQLQERL--NGERLRQIVNEVELKHLADIISSKQNKEMQDEIKKMFGIDMKIPVSMNASK----KAKDFIWISNNASTGMQNLLVFKVKSEERRMKNSNAFYVNDKTQI----DSILRTNMLGETDSMYMEI-----------------PVLSERGLWEMKGDAMGGPYVMHRIHKSQQGYDLYIIGFVYAPEMKKKILIKQLEAAISTIK 330
342 3.000e-51UniRef50_A0A1W9SDE0 Uncharacterized protein (Fragment) n=1 Tax=candidate division KSB1 bacterium 4572_119 TaxID=1971636 RepID=A0A1W9SDE0_9BACT  ali  17  1..........................................ELWN-QAEPLIREIFER-IERTPQEEKLFTIIPQEAKN----YQRYKNLLFLSTLDATDDLSKMINSNLSEAALSKV--NEGEFIFTKTEVWAQDQKVMFLVAPDIATLLELMQANKDNIFFQFENHWQEFHKNILYSTKDNYIEKHLLQNYGWMLEVPADYRLEIQSARDR--FVLFHRKVP--LRWIAVFWEEASDPNIISKDY--------CISKRNEFADSFYEGE------VVADKFEPVTTTEVNFQNRRALYLRGLWENNKKVGGGPFRMYCFFDEQTERIYFIDMHMFAPKKSKMHYLRQMDIIAQTFK 294
343 4.000e-51UniRef50_A0A2G2DDJ2 Uncharacterized protein n=3 Tax=Crocinitomicaceae TaxID=1853230 RepID=A0A2G2DDJ2_9FLAO  ali  16  12..ISTLFLFAQCDSMRPSSASTGLHV---TGNVGEIMVVCEIGIWDSEIKQHLDSGLTQFILPYMPDVATFELVHRKPHRFEGSFKRFRNTLFVTIDPKH--------------------KGDKGKIELRKSVWATGQTVIDIVAKDYAQLLETVKFGIGKVHDKFDKNEWYRIMERFQKRPDLVIGSRLEKNFGINMALPDGFRIEFPKIFRPLDFGTDGVDAGGMHSGLLVYQYDFIDSSQLSLD--------RLLTARDTMLKYNVPSEIEGMHMGTVDYVYPEGNDTATADGINGFEMRGLYVFTGNGTGGAFWAFHFVNPKTKKIVCVSGYLDAPPTTSWQPLREIQAVLRSIE 354
344 4.000e-51UniRef50_A0A2D9UE24 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D9UE24_9FLAO  ali  23  16.........................LPMAIGEPLEIIIIKNTDQHDDNFYQLLRNFLSVEIGPSPQPERVLNIIELDQTSFKGIFKRHQNLLFVTKSDTFS-------------------------IKHTDNIFAKNQNAVFLNSHSSKDLLSN-KQKIVDLVFQIKEMEIKRQILKYKNQNNIELQRIINNKHNLSILLPKKFFLALDSQKTT----WFRNETPKIGQGILLSNLDHKDTSLSPYK---------ICRVVDSIVKANILGPLENSY-MTFESRAQKSIDTIMLGGFSAIKIQSLWRMENDFMGGVYQLYYIPGNQSVRDRIIYTYVYAPGENKKIPLMHLESIVQT.. 307
345 5.000e-50UniRef50_A0A1H9EFK3 Uncharacterized protein n=6 Tax=Prevotella bryantii TaxID=77095 RepID=A0A1H9EFK3_PREBR  ali  26  10.IISLSFLLSSCTDDSRQV---------SGGKPYEVLVVNDS-------RDSLRHILSVDTPDLPQSEPQFDVSSLKQNRLQDGTKMAHSIVI---------------------------HQAKGTYRIQRNLYAQPQIVIHASAGDSLQLRKDL-----------KRFELYCEAKRLQTYHNPKMERLVKQTFGINILLPVDM----NSSMKKKDFLWLSNNSAAGMKNVVICRGNI-----------------------DKMLANYLKGETDDMYM----KRITPCKNS------------GLWEMKGDAMGGPYRMRQIKDGKQ-RDLTILTFVYAPSMKKRNLIQQLEAVLYTI. 268
346 7.000e-50UniRef50_A0A2G6BRY5 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2G6BRY5_9BACT  ali  19  9FFLIAVFLILGCDSGKNSKNKIDPKKPLAWGSKQEIIVMSDEDEWK-ITEDILKRSLEKIVVTT-EEESVFQLRKVSFDGMEQFYK-HRNIIFLSILDSQSDISDFVRKHLAANSF-KSAQERKGGMFTAENVWANDQQVVFLIGSDLERLKQLADFYKDRLFKTFRKRWDERISANIYSRGIIPYS--AFSRYPWTVQIPKHYREFRRN--DENNFIYIARLKDNPDRIIGIYW---------EKAETKPDMIQWMLDTRDRIGYEFYEGD-------IYDRKKTEMTKIKLNDQINAIKMYGHWGNLELFVGGAFRGYGFWNEEQKICYFIDNYVYFPEGYKLAGLEELELIAKTFQ 349
347 9.000e-50UniRef50_A0A1J4XM20 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A1J4XM20_9BACT  ali  23  10.VCLFTVWLVGCASPQK----------PAAGEDDVIIVIAEENNWN-ITQNYLNETFGKPI-YTPQEEYLYTLKWVDPSQFE-TFRMYKNVILISQFEVSSSLTGLLKSMVSDSALTRIRNTPGAYYS-RRNAYADGQELMIVVGKSDGDVQSRIRLNETEMLAKMESQTAKRLTSFIYRGEQTKLAEGYFQQYGWYMRLMHDYLELKNDPSQQ--FVWLGRDYPY--RWIVINSIPAPDSFDLP-----------------SVGKQMLEDVYGKLIPEVALSMTYFTMQESWINNHAALEFRGLWEHKTEIQGGPFIAYSFYAPEQDKIFLLTGIVWAPDRQKLPYIRQIEMMLRTF. 332
348 1.000e-49UniRef50_A0A2E1NCW8 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1NCW8_9BACT  ali  21  14.CLKLVFIVISCNG-----------KREALGPDNEIRVIC-SISDEKILKELLKTIFNDTL-YTPEPEPYYFLKFSRPEKFSELKNQAYLIIAALNHNQENEGSELIKKLLPYDQY--LIKENQQPIYMTKDHYCRNQILMIINGLNIDHVRKSIIEKKEFIKNQFFDQYYQRQKKYVLADKDNKRKQKILEKNGWDFSIPWGWEMIINSPD--SGFVWIGKEMPFQWISVSWDSGSYTGDEL--------------------IAGQYIWNMPEKNYKNIRFNDYKLNLKRTEFLNYDAWLIEGLWETINESKGGPFRSYLFYDQIKNNTYHINMLIYHPGNNKSLYLRQMDIIARTF. 336
349 1.000e-49UniRef50_A0A2A5A1B1 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5A1B1_9BACT  ali  21  5HISSILIGLFS----MIFISNCGKYLPWSEGPENEIQIFVSQNDIQVAEELMEKSLFRQSVDV--NPESYFTLRYRDPSKFDELQNRHNIVVFAVTDSKNDNGDHLINQLIADGELGTYA--GEDPVWVEEDIFSLGQVITIIRG-NHDDISSSLKLKGDWLFDQFDKRYLKRISDHLYENEQTDISEEIFNRYGWTVRVPHDFMIVQ--EDRPANFVKLGRDYPR--RWFTVHWIDNQVGSELHRNSVKN-------SIRN-LAKRFF-----SDYQFIESGDRPWTINKISIDNREMWRVEGRWETKNASGGGPFISYIFYDESTKRLFHLNMLLFNPAGKKLFFLREMESMVRTF. 339
350 1.000e-49UniRef50_A0A2E4DIR4 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E4DIR4_9BACT  ali  20  25.........................KKDSIGMDDEIRVVC-SKIDEPIIKEYLATVFNDTL-YTPAPEPLFKLIFSRPEHYQDLKKYAQIIIASVDRNNSNPGYRLLHKLLPKNQLNNSQDDN--PVLLTRDLHANDQIYVVINASSEEHLFNYLDKNKKLLRSHYDEQFKLRGSRFLFDDNQTQVEEKISQDYGWYLNIPWGWEILRNDSQ--MNFFWMGSEYPYRWLSVKWNKGNSIDDQLSVGKQIWKFPINNYKSIR--------------------FNEHRLKLDRIYFNDYKGWQCSGIWESNDEAKGGPFYSYIFYDHHSDRTFHINTLVHNPGKPKALYIRQMRLIAKSF. 333
351 3.000e-49UniRef50_H1XP18 Uncharacterized protein n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XP18_9BACT  ali  20  11FILLVLAGVF--------IIKCGDYRPSSLGYPYRIFIVADSLLWED-IKQPVSDMFEGEVL-TPVSEKKFYFTWIPLRMLNEFKKRM-NIFFIGVLNENGEVNQYLKNVLPEEFKKGV-EEGRYFYLFQDDLFARDQIGLFMVARDRKAFLKYFDEMKKQIYNTFEQKYYARLKKMFEKGEQFKVEEYIENNFDFSIRVQHDYFVAIEEPQVP--YLWLRRFDPDRWVSIWKIKGD-----------SSMFTLDSIANVRDRFTRKYYEGD----YVIREDTKLI----QTDFKGQPTYKMVGLWRNDSILIGGPFRTYVIHYPQDSALYFVDIAVMAPGLLKKPYLDQLEVIARTFE 337
352 5.000e-49UniRef50_A0A2W1NLP9 Uncharacterized protein n=1 Tax=Crocinitomix sp. SM1701 TaxID=2219161 RepID=A0A2W1NLP9_9FLAO  ali  19  7.LSLVTFLWVGCEPAPSNTEVINSGLPKITGPAGRVLISVQDNLWEGTLDSIFYKAFSKPAPGFISAEPIFDYFQQDPSEINQLGKKNRNFLSIILEPT--------------------ANFEETEVVIKKNHLADGQIYMVVKDNDKDRLIQFFQEQLPTYIAVFNDQENERLIKKYTYTRHAAFDKIAREKFGIGIGVPSTYALDKNSKEFADNIYWAKK-------GILIWDSPYTDST--------DMLPQALLNNRDSTLKYAVKGTIPNSYMATEYKTHAPKFTAVKVGEANAVKIEGLWKHAGNSGGGPFVEVALYHSTRNRIIHVSTYIYALNFEKRELLREVNAILSTVE 357
353 8.000e-49UniRef50_A0A2E5U8N7 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A2E5U8N7_9BACT  ali  20  10FILLLIIFQFSC-----------AVKREALGSNDEIIVV-SAMEDEVHLQSILSTIFNDTLF-TPEPEPYYKLIFVLPQDYKRIKNSTQIVIGAIGKDPSNPAVVLIKNILSDKQYHNSISGNKP-IIISKDPFARNQLLMVINTPNLEKAKEFATKNNEKIKSQFFTLFKNRQEKYLFNNRQKELEKHLIKDYGWSIKIPWGYEVITDSSEQQ--LFWIGREMPFRWIAVHW-------------------RDGAIVENYDS-AKEFIMDFPREYFENIQYSENYFELNTTNFNQWLTWKVNGLWESIDDTQGGPFLAYLFYDGISDRTYYIHAMIFHPGNNKVIFLQQLDLIAKSF. 335
354 2.000e-48UniRef50_R6PTZ2 Putative lipoprotein n=1 Tax=Prevotella sp. CAG:386 TaxID=1262925 RepID=R6PTZ2_9BACT  ali  19  10.LCCLALTFVGCDGMGGR-------KPASTGLPYEVVL-------EGDSDSIVTRMMTADMPHLPQPEPMFSLIQVRKGKVRGSYQLVRNRIVVDIN----------------------AHNKGYAVKMRKDVSAVPQTVVYIQAQSVEQLRHRLD--GGKLRSLFDTSELRHLATAVPQNPDR--QKEMRQRFGISMRIPASMNAGK----QAKDFAWLTDNASTGMQSLI-----------FFKTKSHGRSRDDLKAQADSALKRNLPGETDGMYMQLAD------MSQADRQGMR----RGLWEMKGDAMGGPYVMRT-----RGSMAVI-GFVYAPEKKKKILIKQLEAALSTIK 296
355 2.000e-48UniRef50_A0A2E4SBS7 Uncharacterized protein n=5 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E4SBS7_9FLAO  ali  20  11.IXSXVXMLTXCNLN---XYDSSIYKPKAKKDFGSVLFSLPKKYWHTTLGXELKKQFEKVNKSTPLPEEQFNIDFIVPENLVNNLKNKSCIVVIKIDPN---------------------QPGXRNPIYINDLWANGQLVXELNFKSEKRAVSYFYNNCQXXMQRXNSFYFELIQMSYQK--NNIINSYXQEEXGFNIVAPKEMKLN----NEGNNFWWFSNGTHEIQKGIVVYTYPYYSESQFSINYHK--------EKRDSIGLXFLKGRESNSYMSTRNDXIPIESLAMXIXDKYVFKTTGAWRMVNDKMGGTYVNYAFLSHDRTEIINMEGYVYAPNFKKSKLIREVEAILYS.. 338
356 3.000e-48UniRef50_A0A2D8JKX6 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D8JKX6_9FLAO  ali  21  5..IIILILFLGCNDGQNQT------LPSSTGAHSEIVVVVDDSLWXXKLNKTXSQVFNGPIKGLGKIEKEFNXIXINNSEFSQVFRRHKNIIIFSDNE-----------------------------KTQNDKWAKDQLVIQLNINSNT---NSLLETFQKVKSIFXIDELNYLRKKTKKTSNKLIENQIKKRFNIEVLIPKKYTNIIMS----DEFCWMQYNPKEKDEISQI--------LVFTXNXAKKTIDNTILNAVDSVFFKYIKGXAEXXFVKIEKLYNPHIEQNI---------CRGLWRLENGFMGGPFIFKTFFDXKT---VISLAFTFSPNTQKRDIIKEFEAIL.... 296
357 5.000e-48UniRef50_A0A1F4N6M1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4N6M1_9BACT  ali  23  6.IILVILLSFS----LLFFQSNCSTKVRAQGEDNLVYIFCDSSGW-SYYQEPFEKIFGQFVR-TPIMESEYNLQWRSFDQWE-TYKNYKNIFLIGRLDAKDAVSLNIKNLLNPEIIEGVQS-GKYFYIPQKDVWARDQYVLFFVSTSVSDMVQKILDLGDLAYNDFRNYYFSRLKEQMFSREQKSLQRYVESHFPFTMRIQHDYFIA--NEDLDENFVWIRRINPDRS--ILVHWLPYDSSIILN--------SHWIIEERNRLAENTLSGDVVVEEETKAY--------ATRFKNWNAIKLEGTWRNDSLVVGGPFKNFTFIDSLTDRIYMIDYYVQAIGKRKVLFLDQLTVLVHTFD 336
358 5.000e-48UniRef50_A0A2E0BRS4 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E0BRS4_9FLAO  ali  26  6.FIFTVVMLFSC-------CKNSNVLPSSTGNKSDILVVATESYWSNN-KSKIKQIFEQPIYGVNTVEPIFKIIHINHFEFKNIFKRNKNILIFGENIKSS---------------------------IHKNKWAKNQLVVFL---NENKILSKVSLNKT--LKIFEANEIDLIKNEIRKKSNKQVEKDIYNNFSVKTFFPSIYTIVEN----KENFFWASYNPPNIEEIQHL---------MFFVIDSKSASDKKCLNYTDSVISNNIFGNKDNTYVKIEELYEPVCENNI---------CRGLWKLQNGFMGGPFLLKKYY--RGKKTIISVGLVFAPQKNKRNYMKNLEAIL.... 295
359 6.000e-48UniRef50_A0A1Z9UWW3 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1Z9UWW3_9RICK  ali  20  15.LLFSVIFILSCD-----------YKRDAIGGNDDIIVLAAKE-DREKIRGIMTTIFNETIL-TPSPETFYNIKFAEPESFPALKTQTNLVVASIGNYDLNPGTKLVRELLGQKAFNSTLSG--VPVILSRDQFAKNQLFMILSGSNTEQIKDYLDKNNDFIRSQFDENFFKKQAQYFLENERQELELDLQQKYDWSMKIPWGWELIKN--DKKESFFWIGHELPFRWIAVHWREGNFFSEED---------------------ALEYVKKFPQKHFESIRYNPEYIKIKFKDFKSESSYEISGLWESIEDAKGGPFKGHLFYDYKNDRTFYVCYIVFNPGGKKAFYLRQMEMIANTID 335
360 6.000e-48UniRef50_A0A2E5JQH0 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E5JQH0_9BACT  ali  20  14.FIILFLLINSCG-----------VKRASIGADNELVVIASLKDRKST--EVILQYIFDDTVFTPQPEPVYKIKFIEPKNFEDLKQQTSLIVSSFGNDLKNSGTKLVRQLLGEKKFIDTISGNNQFI-ISKDQFAKNQLFMIVNSPNESSILESLNGKENWIKGLFEEKYNSRQKSFLFSARQTELEQRLLGTYFWSIKIPWGWNIIKEVPD--SNFIWLGKELPYQWISVQWEYLNNTLDSSTVNNMVYTFPKIN--------------------YKNIQFNSYKFSLVQGINDTWFDWEASGIWESIQEAKGGPFKLFIKIDNLNKRIFLINFLIHYPGKNKSNYIRQMELIASTI. 335
361 8.000e-48UniRef50_A0A2D5ZQ01 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D5ZQ01_9BACT  ali  16  1.....MSFLSACERPLDARTSMSPEK--------TVVVFADAVDW-SELEEPIRALFEEPIE-TPREESIYKVRRESPADFE-FFSQFAMILIAGTHDRWGEAFSLLRPHMTLATLADDSAENG-WLRTKRDLWAHPQLVGVLSGESGAEIRGRVLVQGTALRDVYDSFVRERVADKILRRTQSEAEERAARETGIKVPIPRRWLIRDFDRDHARVAIWKRR--KKEDWQLLVQAMPGASERGL---------RERCRIWRDAVIGEVYDGDLIRSEGLKTDER--------SFEGRPGVRLRGLWENRGYVMGGPFETWCIPDPAAHRTLLVDMSVYAPGESKMEGLRTLQTLASRVE 323
362 8.000e-48UniRef50_A0A2D5V4B4 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2D5V4B4_9FLAO  ali  20  11.LLIIMVLFNSCSDD---DYNPNLLKPKTKNNYGEILFGLEKKYWKSDLGKQIENSFERLVKTTPLPEKEYEIDFVVPNKILKNIKNNNCFVFIDIDKHHPNNMAPI---------------------IKQNLWSRNQIIIELKFKSSDIAQQYFQKNANELKSIIKDFNLKKIAERW--SFQNNISNELKGENSLKFKASKKITLNK----KNKNFWWWSNGSHEIQKGIIIYQSPYINKNQFQKN--------NILKCRDSIGEKFLLGKKNNSYMVTSKNGIEITDSSFYINNKYVKMVNGCWRMQNDKMGGPFVSYSWLNHNKTKIITAEGYVYAPNFEKLKYLRELESTIVS.. 338
363 2.000e-47UniRef50_A0A2N5YUS0 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YUS0_9BACT  ali  25  1..................................................................................................................................................................MKLFLEADRDRWIAQLSKNVNQTVADKLMDKYNISIKIPANYYL----DVYDDNFAWISHEARQYTMAIFVYTYPLTDSTEFTTSY--------LIKERNKVLKENVPGSREGSYMTTEVKYDYPYLETITHNGLETAVMRGLWRVQGDFMGGPFVSYTKIDKPRKRVVCVEAYVYYPNEETRDKIRQLEGIIYTYD 185
364 3.000e-47UniRef50_A0A2E7VQU2 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E7VQU2_9FLAO  ali  22  5.IIFWLVLLISCNSNKT--------LPSSTGSLFEVLFVVDDNIWEINLRERVYNIFAANLDGINKAEQQYDIIQVNYSEFNDFLKRHNNIVLITNEDNDRVGN--------------------------KNMWAKPQLCFQIQYDEKE------NRNLHKIKKILDFNVLTRLRTQESKSSNHEIEEYLLNTFQTQIVISKKYQILK----KDSSLFWATFNPQDKEQIEHV---------LIFKSNKILRDKQLLLEKTDSVFSKYLLGAKEGTYVKIEPLYTPFCSDDI---------CKGIWRLQNGFMGGPFLLKS-YHIKSNTIIAV-GLIFDPSSKKRDYVKKFEAIL.... 294
365 4.000e-47UniRef50_A0A2E6PPL7 Uncharacterized protein n=3 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E6PPL7_9FLAO  ali  20  22............NCDSSNDYNPNILKPKAKKDYGEILFAINKKYWKNELGKTIKSSFENLIKTTPLPEKEYNVDFIVPNKIIKNLKQKNCIVFIEIENYHSI---------------------KTVPEFKKDLWAKNQLVIELKFKTEKLAINYFKTNSNLIKQKINQFYYLTISKEYSK--INSINSSIEKDLSLKYSTTKEMKLNK----KGEDFWWFSNGSHEIQKGVLIYKYPYYDQKQFKKQFQ--------IKIRDSICEKYLRGKNDTSYMITVKNGLNETIEPYILNDKYFNKLSGCWKMENDKMGGAFVSISFLTKDKKNIITTEGYVYAPNFEKIKLLRELETILYS.. 341
366 5.000e-47UniRef50_A0A2E4J673 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E4J673_9FLAO  ali  20  17YIIIII-----CGLSXTLFLNKSNIKPNSIGDPLELVLVKXXEDFSPDFFKKFKELLTVSIGPAPQXESMLNIIEIEKNAFKGIFQRHQNILIISKAD-------------------------KFKIKLKHNLFATNQXVVFIECPSFXMLNAK-RKXIMKIVYKIKXVEMKRLSVKFQNYSNIDLQKKIEQQYGXLXXVPKXFFLAYNXX----DIXWARRETKKISQGIFISNAPNTIEXANQNXK--------ILEXXDSIIQLHISGPKENSY-MIIXKXAPIQIDSIIIXNXTCXKXQSLWXMENDFMGGVFNIYYFNSKELKAPLLIYTYLYGPGEEKKIPLIQLEAXINTFK 334
367 6.000e-47UniRef50_A0A2E4RE81 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E4RE81_9FLAO  ali  21  27...............SKFNYFNSKALPSSIGDPLELLIVKNSKNLDDNFFIKLNDLLTTDIGPAPQKENFLNLIEVYQEDFKGILQRHQNILIVS-------------------------HNSKFNIRFKMDLFALDQLVIFVECPSIFALQKN-KDQIIKLIQKIKSIEIKRLSRKFKQYTSKSINEQVENTHNILITPPKDFFLAYSDSTIT----WIRRETPKISQGIFL---------SNLASNKLIQSQNNIISIIDSIIKPHIFGPVDGSY-MKSENDAVIKLDSIKVNDFLGVRIQSLWRMENDFMGGIFTAYYLTLKSTSSPLLIYTYLYAPGERKNVSLLQLEAIISTL. 329
368 8.000e-47UniRef50_A0A2N2W101 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-9 TaxID=2013699 RepID=A0A2N2W101_9BACT  ali  24  14.FLAIVLIATSCNEDQKG------LKVPSTGKPSEILVVSEKALWKSSAGDSIRAFFKTPIIGLPQPEPLYKIAQVEEDEFNRVLQSHRNIFIINIDSSIS----------------------KPLVEIRRDIWAAPQRVVKITASTIEDIKSSFAEKQSEIVNFYDNAEIERIQTLYSKSINIKTSEAIRDRFNLSMKVPADYYLAVN----KENFIWLRREANRISQGLL............................................................................................................................... 212
369 9.000e-47UniRef50_A0A1Z9NEZ0 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1Z9NEZ0_9BACT  ali  20  21.....................DCTGKKDSLGMDDEIRVIC-SEADEPLIRDYLIKVFDDTI-YTPAPEPLYKLIFSRPLYYQDLKRYAQVIVAAVNRDNSNSGFRLIQKLLPDNQLN--IEENDNPLLLTRDLHAKDQVYVVINAIDKEHLFKDINKNKELLRGYYDEQFILRGSRFLFNDNQIEYEEKLKTDYGWNIKIPWGWEIIRN--DKKNSFFWMGSEYPYRWISVKWDDGNIIEDQLSIGSAIWNYPINNYKSIR--------------------FNDHMFKLEKIYFDNYKGWQCSGVWESSDDAKGGPFYSYLFYDNNSDRTFHINTLVHNPGKPKAVFIRQMRLIAKSL. 333
370 1.000e-46UniRef50_A0A0S7WTI8 Uncharacterized protein n=3 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S7WTI8_9BACT  ali  21  23.LMVMVALAPSCT---------KPLLP-AKGGNKEVVVLTPPDVW-SRIEASLKEELERTVVIL-EAEQVFVVEHVDTLVFSEEGANRRNVLLVAPADAGGSVRRALEDAVGRDGLGAV---SEPAIFVRRNVWARNQAVISLVAPNADRLVAAVDQLGDSLYAAMMEVEDRVRRTLYLRGYKKPLAERFASEYGWSIRVPSGFQI--RDENPAAGFVSFIQHYPE--RQLFIHWGRVGRDVEIAPSHS--------LELRARLAAEFYGDDIDGSRW-----------ERGRFVGREAMILKGRWMNSGQMVGGPFWTYCFRGRGGERLYLIDLVVVAPGEDKYPPLRQLSVIARTFE 345
371 1.000e-46UniRef50_A0A1F5NWE3 Uncharacterized protein n=1 Tax=Candidatus Delongbacteria bacterium GWF2_40_14 TaxID=1817817 RepID=A0A1F5NWE3_9BACT  ali  19  13.VIGLLLIVSSCS----------VYKKPALGSDNVINVLADQTIFDTHY-PQLERMFSHSI-YTPAEEKVFTLNRITMDEFHQGFSRHKNLILLANIDSDDPEAQYIKKMLTDGVLEGVR-NGDYYYAVKKDAWAKGQTVLFLLDSKSIYLGGYLEKFSDKIFGFFFDKMITDIKERLFRFNNKTAEEFLKKEYNIEMFIPHEFNIG-ERGEDKDKFIRFRRTNPDRWLTLL--RSDYNSEISF---------QENIIQTRDRIGRQFADSVRINPEI--------LSFTPDSTFTTDGLKAQGIWEYIDG--GGPFFTYAFI--KNGSFYLVDGAVFAPSKDKYPYIIQLDLMAKTTK 334
372 2.000e-46UniRef50_A0A0R2QUD9 Uncharacterized protein n=3 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2QUD9_9FLAO  ali  23  1...................................MIFVVDDALWENSVDSLAKNTFGATIEGISQAESLFRIVQISHSEFKSILKTHTNIVIVSEGVKKSS---------------------------QKDKWATGQFVAQLNWENNPQ---KLLKELIELRTIFVVKEVKSIKNSFEKLSQKNIEKTLLSNFGIELTVPKEYQIIKN----DSTLFWANYDPPKSDEIKNIFT--------FLFIPKTANLQAEVLYKTDSIFAKYLVGAKEGSYARI-EPAYPPYYFENTY--------RGLWKLEHGFMGGPLLIKTYF--VKNKIVVNVGIVFAPQSRKRKFIKEFEAIL.... 267
373 2.000e-46UniRef50_UPI00040D972A DUF4837 family protein n=1 Tax=Prevotella sp. AGR2160 TaxID=1280674 RepID=UPI00040D972A  ali  25  14.ISLCVIILTGCRRSSK--------LPDAIGRPSEI-VLIDGPHHE------LRRILQRRMEGLPQPEYLFDLTDIKPSDFRGDLREAKIIV---------------------------RYDRGRSLESINDKYAFPQTIITSNGRDPQRLVNAI-----------LQAVLRHQQIQLLRHRNIKMEKRVSQLTGEKMLIPQDMTSCKRAR----HFLWISNNDGRVMKNILIF---------------------PAGEKVDSILQRNMPGEEKGMY-MQLATGLPNDQRTTDLEKRKADMLRGLWEMRGDAMGGPYILY----HKKNSPWSLMAFVYAPGHPKREPMLELEASLLSF. 292
374 2.000e-46UniRef50_A0A1V4RDR8 Uncharacterized protein n=2 Tax=Candidatus Cloacimonas TaxID=456826 RepID=A0A1V4RDR8_9BACT  ali  19  8.IVLSFLVFAGCTTDPSKQKKVDIKKPMSWGHKQTIYVFADDNVWK-YAEQHLRDTLERYYFTT-ENEPYFEVKRAPLDKLEQFYK-FNNLIFLADLESSAPVSAYVKSIMGGAIEAEIA-ENKVGMYPKENIWARDQFVLFLIGNNERNLLSLNISMAEETFQQFKQKLYERISFLTYKS--KTYLKSTFNNYTWEMDIPKTYTVYKQ--DDKNNFIFLARLRNKPDRYISIYSEDMVEDKV---------NDDWLKEKRRELAWKYYDED--------EYFDKDVRTQPYEIGKKQGWKLSGRWQNKKYAVGGAFQSFAFYDEIGKKAYLIDNSIYFPEGFKLAGLIETEVISQTIK 348
375 2.000e-46UniRef50_A0A1V4R9B5 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. 4484_143 TaxID=1956164 RepID=A0A1V4R9B5_9BACT  ali  18  13...IILLTILGCSQKKTKSKGTDPHKPMSWGHKQTVYVFADDNVWKYAKSHLIKTL--ERVRFTTENEKVFVVKRAPIDNLDNFYK-FNNLIFFCDLESNDKVSTYIKEIMGSKVETEV-KENLIGMYTKDNVWANDQFVLFILGSNEENLLKFNILQSHNIFDLFKEKLFDRINSQLYKTPVYSNDRFTA--FPWTLKLPKKYILYKNDT--ANNFIFIARLRNKPDRYISVY---------FQKIPKKEFNRDWLRETRQNISWKYYDED--------EFLDSDVRMEKFKLAGHQGWRLTGRWQNKKHSVGGAFQSFAIYDEVNGLAYLVDNSVYHPNGEKLEALYELEIISNTLK 348
376 4.000e-46UniRef50_A0A1I7BGK1 Uncharacterized protein n=1 Tax=Lishizhenia tianjinensis TaxID=477690 RepID=A0A1I7BGK1_9FLAO  ali  15  8.LVTLSLLLFSCGENQESSSSIVVKSETSTGKVGLMAVVCPDELWTPRVEKALDSVFGEYFRPFYPPQKRFEAYHLTPEEFEKRNKRVRNLMVLSLDPKV--------------------EAGKPEIDLKESYYAATQMATYISANNVKDIEAACENQLWNIAHRYDKMAWRREVIRNQREPGKMVEQRVAEKFGIHLDLPKNMRIAFPDESRPMDLAGGSYQTTRTNFNIMVWQYSFTDSSLLEY--------QTMLNSRDTILKYNVPHEYEGVYMGTQYHAVIPIRKQLTLNTIEGYELTGLFKFTGAMSGGMFWSFTFRHPKTNKVVTVSGFVDIPTTSAVPYIRRVQAIIYSL. 374
377 7.000e-46UniRef50_A0A2G2FCK0 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2FCK0_9FLAO  ali  17  7.VTVLILLLFSCSQSENKKDGSKDGKSTATGKPGQLVIVSENTIYTDEVAVLFDSIFGQFIRPYYPPEPKFEIFPRTKSDFEKGSKSLRNLIFLELDPSIPA--------------------GEPMLIIKKNYYSRTQLIAEFKANNMNDLYALIEERIEKVYDMFDTQEWKREYLRHKKANNQVVKKKLRKQFGIEFEIQS-----KAHYESKDNMYYNSTKANFIQSGIMVWQYDFKDSSQLTPAY--------LMRARDSILKKYAKHEIDGIYMGTQDHAVVPVHEEFQIGDIIGYQFRGLFKFTGRMSGGKFWSFHFLHPKTNRIVAVSGYLDAPPTMSASLLRKIQAIIYSLK 372
378 7.000e-46UniRef50_A0A1Y1REX6 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 TaxID=1971726 RepID=A0A1Y1REX6_9BACT  ali  22  4FFIILILGIFGCRQEPRRQATQKEGLKSVVGGARDITLLMDPAS-ESLIGKEIIQTLRLSRFPS-RIENTFKVRKPALEKYH-ISKLWYNAVLVFQMDSPATVAIETEKYLTADEKATIDREGILSI-YRESVWSFGQHVYFLVARDSVALLKKGDSYARRIVADIEARLNKDMADEIYQYGLNDERVEQMEKFGWRFDLPSDYSLYKQSEGDRAMMYRRRNLDPLIDRIITVHWGPATEVEL---------TEDRMKQMRDKILAKYSSGDYVGESF--------LFFRKCRFSGRDALMMEGNWKNDKDMIGGPFRAYLFIDQETSRYYMVDYYVLAIGQKKDRLMRQLEIIISSF. 357
379 1.000e-45UniRef50_A0A2M7YUN6 Uncharacterized protein n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YUN6_9BACT  ali  19  6.LLTALLAVSGCGMDAEKGIL------MAAGAYGDLAVVADPGLD--PVARQFATEVNEDQVFVIASETRFKIDIFPPENW-DLAKGYKNAVFVTTAGDHGAVNKELRKLMSKEAWSQLQSGAGGLVQ-RKDPWATYQLLVVATGPDRNSLASLLHRNAARIRGMIESDSRTRILRHNYEGLATGLMNSCWSRHGFYLEIPETFQLNQQGHDKVPGLELMETNP---SRGITICWLDTEDPAGMLADRT------RLVALRADMGRLFHHEDLVPESFTWSDGGPP---------GHPGVTLKGAWTGKTFAGGGPFWSYFLADKGRGRVYCIDLLTYAPGMDKMGFFRQMEAIATTF. 336
380 2.000e-45UniRef50_A0A101HGY1 Uncharacterized protein (Fragment) n=1 Tax=Proteiniphilum acetatigenes TaxID=294710 RepID=A0A101HGY1_9BACT  ali  25  10.IIATIALFTACNGGGGFL--------SASGTNNEVFVIIDDTAWESAPGRALFDVLNSNVKALPQPEPNFTIQQITPENFTSTFKMARNIIIPDISSIYS----------------------EPKLSAEIDKYAVGQVIMNIHAPDSASFVKFVTENKESIVNYFVTKELERVSK-WLKNEIPTPVPRVQQKFGINIHFPKGMT----NVTEHPDFYWATNNAARGRKDIVIYQFPYTTETVFEKD--------SLIAIRNRTLGKYIKGS....................................................................................... 237
381 2.000e-45UniRef50_A0A2E3AIP1 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E3AIP1_9BACT  ali  25  13....................TSCDFKPRAEGVENQIHVVVSFEDF-SKVKTIIDSIFLPEIL-TPEPESFFELKYILAEDFDKI-KNYHNILVLSILDIPDSTGDKLIYSFLPK---NSSERNENKIFSKRDVFARDQVFSVVYGKDFEDFKNTLIINSKWIYNKYFNFYRDRQEKHLFKRRQHDLSNLIFEKFNWKIRIQHDFTLIK--EDSNNNFIWLGRAFPFRWLSFN--WNDYNNKLTFEN--------LNLDTLLNEYSKFYNNDILFLKKYR--------NISRDKIGNFDAIKLEGLWEHNSDVKGGPFISYFFYDTNLKKLFHINLLVHNPGRKKLPSLLQLEIMSKTY. 325
382 3.000e-45UniRef50_A0A1I2TKW4 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A1I2TKW4_9BACT  ali  23  17...........CGNRRPAEHAMSSMKP------YEVLVVGDSA-------NAIADYLSRPCRELPQEEPMYDVVSIKAEDFKGSYRLARSIVVYTRGTRHDWD-------------------------IKDNVYTRPQRVVYANKDNIWIAEPFI-----------DQFEHQQAVKELRRKHNPKAGALVQKMFGIKKFIPVDMRSSK----QGKDFLWLSDNGTLATKNLVFIRLPYYHLGDFIGPAVKAFPE--VLQRVDSCLKANIRGEEDNMRMHMN--RSTVMTRQDKMLDLY---FHGLWEMENDIMGGPFFAHLT-NRRDGTMLVELAFVYAPGQKKRNLIRQLEAVVY... 304
383 4.000e-45UniRef50_A0A1Q6L1W6 DUF4837 domain-containing protein (Fragment) n=1 Tax=Clostridiales bacterium 36_14 TaxID=1897042 RepID=A0A1Q6L1W6_9FIRM  ali  21  9FYLVGLLTLVSCNSS--------IVEKRATGLPYEILVVMTREVGDSEVGELVKNQLKSPIAGLPQPEPAMRVTFVPTETFNGLLRYVRNILVVDIDPTKYTMVSLNG---------------------FKDEWAKGQEVIKLCAPSTRELVTYLTLHDSDIVKHFCAIEKDRRIKILKEHYSQLAMDKVQEKFGMKLHAPDDMTYYK----DTTDFLWVSNNAKTGRVDLIVYSFPYTDANTFTQDY............................................................................................................... 223
384 5.000e-45UniRef50_A0A2H0XVI5 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A2H0XVI5_9  ali  17  16..................TMSMCGYRQKGIGASDTIYVFSDEET-RQIVGSAIDTTFS---FGYRSPEKFFKTVWKPLDSFPEVTR-FKNLIVIADLNKTGLGMKIAKGILPPEKYHLAEQDS-IFIYAIDDVWVDGQMVVVIAGKDLKRMNQNILEQKGWLYEKFNQFEQTEKADIYSKGEQKKMSRTLCEKYQWTLRIQHDYVIIRESNLRK--FVWIGRGYPY--RWLSVSWENGIKTEWLTANG--------LFEKRQQIGKYYQDTETDKRFLGT---------YFTQFGEWNALRMSGLWYRTKEAKGGPFVTYAFYDSKTDRTFVIDIVLFDPGANSSILLRQVEIIAETF. 331
385 1.000e-44UniRef50_UPI0009DB9FE4 DUF4837 family protein n=1 Tax=Prevotella albensis TaxID=77768 RepID=UPI0009DB9FE4  ali  20  26.........................LPNSTARPYEVILSGDSA-------DTIRKALTTDVEGLPQPEPNFDVRTIKPANLKGNMLYARAIVIYSHDHDT-------------------------ICHYKLNVHAEPQIIIEANAHNIKSVIRYLQ-----------AFEAEQQVVQLRRHRNREMERMIRKKFGIQMTIPVEMTSSKV----RKDFIWLSNNDALKMKNICIIRINEPTTEAI-----------------DSMLARNIKGETDAMHMQLTSATLHEEETANGEQHLY-----GLWDMKGDAMGGPFEARVV--PQGNHYIAMLTFAYAPQTKKRNIMRQLHAVIY... 285
386 2.000e-44UniRef50_A0A235BZC2 Uncharacterized protein n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A235BZC2_9BACT  ali  20  11..FCLLLFTLSCIPK----------LDVAGGDQTEIIVFADDETYE-MVGDELSSILEREIF-TPTREKIFTLIPKSPSKFT-MYNRRRNVLVVGVIDNP-----LIDSILAPSARRKAGA-GKNFVFGDEDIFAKGQSVCIVTARDMDELKKVLGEKSDAIFSYFYQSVKNRVKDVLYKGYQEEIADRLLLSYNFTFNIPPGWMV---EEHGGKRLIKILRHYPDRFITVCW---EYSPRVLLTYKEACD--------LRDSICSVLHDGDMVN--------RQRSRMFNVDFHNMNAQKLDGIWKNDELVMGGPFRTYIF--STESAFYFIDVYVFTPGEKKWLAIEQLETIIST.. 323
387 2.000e-44UniRef50_A0A1W9RMY3 Uncharacterized protein n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RMY3_9BACT