current user: public

If you have questions about the server, please let us know.

Query: PB007011 gi|160888195|ref|ZP_02069198.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]gi|156862330|gb|EDO55761.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492], from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# E-value Template Links and tools%idFirst RQSEDSRHSKYVIRIICEGEKTEPLFFTSLCDKLLDENGGEEEWDVKTIPQPDIPEEKPSMADRGLYKNKKKRVKGKKDKLQPEVQGQPPLSWIRLSRKKLNEGVDEAWAVFDKDEHPARKDAFEEAEKLIDDKKVNIAFSSRSFEYYLLLHFEYLYHPFHATECGERIDGKKVNYNCMTEKSKENACHGEKCINGYARLKKYWNETKTSQSTFPLIEKRLKAGIINAKRLRIESNSKENCPIYDRNPYTNVDKLVCRLLast
1 4.000e-37UniRef50_B3PE73 CRISPR-associated protein, Csm2 family n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=B3PE73_CELJU  ali  23  19QRRKATRAPYAKVLIVCEGSKTEPHYFEGLKNHYQLSSTNIEITGESGSSPISV---------------------------------FEYAQQRYDQEKLAGDPFDRVYCVFDKDTHSSYQDACDRIEKATPKNTYFSITSVPCFEYWLLLHYRYTTAPY-----------------------QPLPGNSAANQVLSQLKNYFPGYQKGSKNIFAELSGQLEFAKNNAQRALAAAIQQHT-----DNPSTKIHELVEFL 216
2 1.000e-36UniRef50_A0A1V2DRE5 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1V2DRE5_9ALTE  ali  26  13KRKAPKREPYDRVLIVCEGEKTEPAYFEDLRNHYGLSTANIAVTPATGSDPVSVVRYAKRLQNE---------------------------------EKKQGEKFDRIYCVFDRDEHTNFNAAC----HQVQVNRFESARSWPCFEYWLLLHFGYQRNPFMPTQ-----------------------GRTAAQNCGSALRQNFPDYTKGMRGAFQELLPRIEEAKQHAERALRDAEATG-----EPNPSTEVHLLVDYL 206
3 1.000e-35UniRef50_A0A1T2D8M0 Uncharacterized protein n=2 Tax=Solemya velum gill symbiont TaxID=2340 RepID=A0A1T2D8M0_SOVGS  ali  26  12KRKAPKREPYDRVLIVCEGERTEPVYFEDLRNHYGLSTANIAVTPANGSDPVSVVRHAKKLQ---------------------------------KDESKQGEKFDKVYCVFDRDEHTNFDAA----SSQLNVSNILAARSWPCFEFWLLLHFGYQRQPFH-----------------------PSRGKTAAQLCQYSLKANLPAYTKGMQGIFDELLPDLDTGIQNATRAQRDAQATG-----EQNPSTEVHELVEYL 205
4 9.000e-35UniRef50_I8ZU35 Uncharacterized protein n=12 Tax=Bacteroides TaxID=816 RepID=I8ZU35_BACUN  ali  57  3RTSENKRHSKYVIRIVCEGDKTEPLFFTDLCDQFYGDSKDFDVRTIPQPNIPVEDAEADSSRGSYKGKKRKVKSGGQKDVAEDEVIGVPPLKWVLYARKIMSEGVDESWAVYDKDEHPKHEEGMAEANKIIDGKKVNIAFSSRSFEYYLLLHFEYLYYGFEATECGERIKGKKQIYECGTGKNPDKDCDGKKCINGYARKHGYWMESKSSVSTFPLVKDKLLKGMINACRLRTESDSKTDEPIYKRNPYTNVDILVGRL 262
5 2.000e-34UniRef50_UPI0007BF0DDD RloB domain-containing protein n=1 Tax=Luteibacter rhizovicinus TaxID=242606 RepID=UPI0007BF0DDD  ali  24  14.RKGVSREPYKKVLIVCEGEKTEPSYFKELINHFSLSTANVVISGDCGSAPINVVRHGKVLYDASA-----------------------------------KDKYDFVYFVFDRDTHPTYGEAVARVSSLKPAGCFVVADSNPSFEYWFRLHFGFSRKPYMAS-----------------------GKNSSGDLVVRDLVSVWPEYCKNMVGTFRHLLPNLSGALKNAEAASKDADNTG-----QPNPSTKVHQLVRLL 208
6 5.000e-34UniRef50_E8MYB1 Uncharacterized protein n=1 Tax=Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1) TaxID=926569 RepID=E8MYB  ali  27  21KRSTKQRELRQRILIVCEGKQTEPNYFKRFR------------------VNAVVEAFGLGRSPLDLVKYAQDYRKK--------------------------EGFDQAWVVFDRDNVQASQ--FNQAISEAQKSGIKVAYSNPFFEVWFLLHYGYHNTPMNREKYIEKLSQNLKR-----------------------------PYQKNDSSLYDDLLSRQSTAISNAQRLLASYT---PHDPAQDDPCTTVHLLVEEL 201
7 1.000e-33UniRef50_UPI0008A98911 RloB domain-containing protein n=1 Tax=Haemophilus sp. HMSC71H05 TaxID=1608898 RepID=UPI0008A98911  ali  24  19QRKVAMRKPYDRVLIVCEGEKTEPSYFMELREYYGLHTANIEITGECGSSPTTILAKAKELFNK---------------------------------AKQDGNPFDRVYCIFDKDEHTTYEQTILEIENITPKGVFFSITSVPCFEYWILLHFTYSCKPFTSS-----------------------GNKSAAEYVISELKNFYPDYEKNKEGIFIDLIDKLDTAIAYAKQISKS-----NQKTVTDNPSTSIGELVEYL 216
8 1.000e-33UniRef50_K9SI79 Abortive phage resistance protein n=16 Tax=Cyanobacteria TaxID=1117 RepID=K9SI79_9CYAN  ali  27  14.RTYDTKETRKSFLIVCEGTKTEKNYFESFKLKIKAENFNLNVKGLGKDPQTLVREA----------------------------------LNIKQAEEKKGEEYDQVWCVFDRDSWTS--ENFNNALQNASIHDIQVAYSNEAFELWYILHFEFLNTGIPRSDYKNKLKNHLE-----------------------------YSYKKNSDSMYEELLNKQEVAIANAKRLLRQYN---PTDPEKDNPSTTVHLLVEEL 203
9 9.000e-33UniRef50_UPI000784E55C RloB domain-containing protein n=1 Tax=Anaerolinea thermolimosa TaxID=229919 RepID=UPI000784E55C  ali  26  22.RSIKQRELRQRFLIICEGKQTEPNYFKRF-----RVNAVVEAFGIGRSPLNIVKYA---------------------------------------QNYWQKGDFDQAWVVFDFDNVG--APQFNQAIQQAKQAGLKVAYSNPCFEVWFLLHFGYYNTPMNRQQYINKLSQNLGR-----------------------------TYQKNDPSLYDELLTHQRIAISNAQRLLGSYN---PHDPAKDDPSTTVHLLVKEL 201
10 1.000e-32UniRef50_A0A1H9TBE9 RloB-like protein n=4 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A1H9TBE9_9GAMM  ali  25  19QRRPPVRLGCDKILIVCEGSKTEPFYFEELKDFYEIESAKVRVSGECGSDPMSVVRHGERLYRESL--------------------------------HDCEGAFDKVYCVFDRDQHPNYQEALFYLSKLRPLNVFEAITSVPCFEVWLLLHFNYSSAPF-----------------------VGAGGKSAGDQVVSVLKDYWPDYEKGSRGSFVHVFGQVGQAKRFAERLIGDAERNG-----SDNPTTKVHKLVSTL 217
11 2.000e-32UniRef50_A0A2A2TIE5 Abortive phage infection protein n=1 Tax=Calothrix elsteri CCALA 953 TaxID=987040 RepID=A0A2A2TIE5_9CYAN  ali  27  14.RKVNTREIRQRFLIICEGGKTEPNYFRSF----RVPKVVIEVQGLGMNPSKLVDKAIEQKNP---------------------------------------EEYDQIWCVFDRDSWM--ETDFHNAIKNAKDAGIEIAYSNESFELWYVLHFEFLNTGIPRSDYLKKLERHLG-----------------------------HKYAKNSDDIYDELLNRQPNAIKNAENLLKKYE---PSNPANDNPSTTVHRLVQQL 194
12 2.000e-32UniRef50_UPI000735DD8F RloB domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI000735DD8F  ali  23  19KRKGVTREPYLKVLIVCEGSKTEPNYFEEIREYYELNTANVEITGECGSNPMSVVSCARELYKKH---------------------------------RDMQVPFDRVYCVIDRDAHTDYRSAKETVRQLTPHNVYKVIDSVPSFEFWLLLHHEYTTQAF-----------------------EPLKGNSAGNQVLERLKVHMPNYGKGSKGVFAELIGLLPKAITHAERLENAAEASG-----SDNPLTLVHHLVVAL 216
13 4.000e-32UniRef50_A0A1Z4NGU3 Abortive phage resistance protein n=1 Tax=Calothrix sp. NIES-3974 TaxID=2005462 RepID=A0A1Z4NGU3_9CYAN  ali  23  14.RKVDTKEVRQRFLIVCEGEKTEPNYFRSF--RVPKNVAEIDVKGLGKNPSKLVNFA---------------------------------------KELNQQEEYDQVWCVFDRDSWT--PEDFNNAINNAENQGFQVAYSNEAFELWYVLHFEFINTGIPRSDYLKKLGLLL-----------------------------NRGYKKNSETIYDELLDQQSTAIRNATNLLNQY---DPHIPAQDNPCTTVHLLVQEL 196
14 4.000e-32UniRef50_A0A2A4PZB9 CRISPR-associated protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4PZB9_9GAMM  ali  25  20.RKKASRAPYAKVLIVCEGKKTEPNYFNELKDYLALNSANVKVTGDCDSSPISVVEYAIQRYSK---------------------------------ESILGDPFEKIFCVFDKDTHSTYPQALEKLQNANPKNTFCAITSVPCFEYWLLLHFGHTTAPFQSSDQKSAADRVIDELRK-----------------------HIPNYRKGDNSIFCTLIERLSQAKTYAEKALKDAQTNRT-----DNPSTHVHELVTYL 216
15 5.000e-32UniRef50_E0U6K5 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=E0U6K5_CYAP2  ali  30  21.RREKTKEIRQRFLIVCEGEKTEPNYFKSF-----------------RVPKEVMDIRGVAHNTVSLVKKTIKIQKEEN-------------------------DYDQVWCVFDKDDFP--AENFEQAIELAKQHNIKVAYSNEAFEIWYILHFCYRDTPMSRQEYQNALTKQLKNAGLMNNK---------------------EKYQKNSVDMYEKLENLQATAIRNAKKLLEEYS---YPNPAYDNPSTTIHLLVEEL 210
16 6.000e-32UniRef50_A0A2H6F6C1 Uncharacterized protein n=1 Tax=bacterium BMS3Abin06 TaxID=2005714 RepID=A0A2H6F6C1_9BACT  ali  25  20.RKRARRASYDRVLIVCEGAKTEPNYLRNLIDFLELNTANVEVDGDSGSSPISVVEHSKKRYNK---------------------------------EKRTGEAFDRVFCVFDKDSHASYTRALDEVEKAKPKNIFKAIISVPCFEYWLLLHYEFTTKPFVVTGAKSACANLIDYLKK-----------------------YFPAYSKGNTNTYNEIKSQTTQAIDRSKQALKQAQENG-----RDDPSTLMHELVEYL 216
17 9.000e-32UniRef50_A0A2W4XYR2 Abortive phage infection protein n=1 Tax=Pseudanabaena frigida TaxID=945775 RepID=A0A2W4XYR2_9CYAN  ali  27  14.RKIDTRELRQNFLIVCEGEKTEPKYFEAFP-----------------VPKDVVDIRGLGQNPSKLVNSTKKIIEQKEEGY-----------------------YDQVWCVFDRDDWT--AEDFNNAIANSKIQEIKVAYSNEAFELWYVLHFEFLNSGIPRSDYIKKLDGLLG-----------------------------HKYKKNSEDIYDELIDKQSIAIKNAKNLLKQY---DSQTPVKNNPSTTVHLLVQEL 197
18 1.000e-31UniRef50_A0A2U2S5G4 Abortive phage infection protein n=1 Tax=Anaerolineae bacterium TaxID=2052143 RepID=A0A2U2S5G4_9CHLR  ali  25  18RRSLNVRELSPRFLIVCEGEKTEPNYFRCF-----RVNADIEVVGTGCNTLGILE----------------------------------CARERRREAQRRGLNYDQVWLVFDRNGFP--EQDYLDTIRLAQQEKIRVAYSNEAFEIWFILHFSYLDSALPRSQYFNLLTKYLGS------------------------------YQKNQSDLYEKLLPYQAQAIRNAERLLSSYLPEHN--PARDNPCTTVHLLVQEL 203
19 3.000e-31UniRef50_A0A2N2H033 Abortive phage infection protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H033_9DELT  ali  27  6RRPTDARPACRRYLIVCEGEKTEPNYFKSLAETLDWDQVQVEVDPTGMNTQSLVERARKRKSEKNQLGVAS---------------------------------FDEIWVVFDRDSF--KSDQFDNAIKSADAAGMKAAWSNEAFELWYVLHFEFRNSGMSRRDYRRVLTRHLK-----------------------------QRYKKNDPEMYDKLEENQSLAIRYAKSLDKARIADKQ-PPSAANPCTLVYKLVERL 201
20 3.000e-31UniRef50_A0A1W2H7E1 RloB-like protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1W2H7E1_9BACT  ali  25  21KRKRDFRTKRQFYLIVCEGEKTEPNYFKGLKEDLPKGVLTFYQIDIEGTGRNT------------------------------QSLVDEALRLKLSYEKENSRPIDRLWVVFDKDSFSAQDFNSAIQRCSNSSPEIGCAWSNEAFELWYLLHFHFYNNGINRTDYQQLIEGNL-----------------------RPHIGEHYRYQKNSEEMYDLLKGNQDNAIRNAKNLTENLI--GQQDYANHNPCTMVWKLVEEL 226
21 4.000e-31UniRef50_I2GU21 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=I2GU21_9BACT  ali  26  12RRRSAFRSLRESFLILCEGENTEPTYFNAF----RLSTAHVRALPVTSGDAMAVVKAAIK---------------------------------RRQAELDKGNEYDHCWVVFDKD--ATPGDQFNAAIALAESKGFQVAYSNQAFEVWFLLHFDYVSGPMHRNQYSDRLKVLLGSYTKHMDTA---------------------------RLMFRVLLDRQSLAIENAKRLYNQYDNSGYRNPAEEESSTTVYQLVEKL 206
22 5.000e-31UniRef50_A0A1Z4BTT5 Uncharacterized protein n=2 Tax=Methylovulum psychrotolerans TaxID=1704499 RepID=A0A1Z4BTT5_9GAMM  ali  23  13.RKPANKSPKFLIIAVCEGKNTEPAYLKSFARHYGNGLVEVETVAPAGAPLTIVQTAVARKKARD-----------------------------GRKKTDSFDKLFEVWAVFDRDEHPNIPQALD----MAKANNVQIAISNPCIEIWPLLHFADHQAPIHRHKLQRELAEHMPSYQSDGSKIID----------------------------FEAIKDRFTVARTRAERQLAGHEATGD---PYGNPSTTLYRLLDKI 206
23 7.000e-31UniRef50_A0A0N8GT19 Uncharacterized protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0N8GT19_9CHLR  ali  25  17QRRLDQFDVRQRFLIVCEGTRTEPQYFERF----RVPGLVVRVEGVGMNTLRLVDEAINCCDE---------------------------------------GDYDQVWCVFDKDDFP--IENFENAIQRARERNMHVAYSNQAFELWYVLHFEYLNSAIDRKAYMEKLTQYLG-----------------------------FKYKKNDPDIYQVLQCKMDTAIRNAERLMQEYR---PSRPGRDDPSTTVYQLVIAL 198
24 8.000e-31UniRef50_UPI00036EE307 RloB domain-containing protein n=1 Tax=Erwinia toletana TaxID=92490 RepID=UPI00036EE307  ali  25  19KRKNASRKAMEKILIVCEGEKTEPEYFDEIIAHYKLTSTDVFITGDCGSSPKSVVEHA---------------------------------REVDRKESKKSSPYDLVYCVFDKDSHADYNTAIEQVRQLKPAGKFHVINSVPCFEYWFFLHFTNSRKSF-----------------------VGDKKNSAGMQMQKELKSHIHDYQKNKKGMFALLHDKLQDAINNSIKVRKLAEQDGNE-----NPSTKVDILVEKL 217
25 1.000e-30UniRef50_UPI000B356287 RloB domain-containing protein n=1 Tax=Halomonas sp. JB380 TaxID=1434831 RepID=UPI000B356287  ali  25  20.RKKAKRDPYSKILIVCEGKKTEPNYFEEIQKCYELNTANVELIGTGSSPRNILEYA----------------------------------RQRYREEKDSGDGFDKVFCVFDRDSHTTYDETVGNINQAVPKSTFVAITSVPSFEYWLLMHFIYSTKPYEN-----------------------LSGNTAANQVLDEVKAYYSEYTKGGKDVFAHLFEALPSAKANAKRSLEEAIRNDN-----FNPSTKVHELVDFL 215
26 2.000e-30UniRef50_Q1IPY6 Uncharacterized protein n=1 Tax=Koribacter versatilis (strain Ellin345) TaxID=204669 RepID=Q1IPY6_KORVE  ali  25  8RRGGPRLDPRRRVLIVCEGKLTEPSYFKDYLRENRNQLVMVEIVPDRGVPKSVVDYAADRK---------------------------KQAEKHSRRRADPYLKFDEVWCVFDVDEHPHLPEAL----QQAKDNKIRVALSNPNFELWILLHFQDLFRHEHRDVIGRLCREHMPEYQKLVN--------------------------------FELLRAGYEDAVRRAGTLEKLQIQKGA---PDGNPSTGVYKLTERI 200
27 2.000e-30UniRef50_A0A1Q6DNV8 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1Q6DNV8_9DELT  ali  24  20RREAQKREAYDLVLIVCEGGKTEPKYLQELCDAFKLSTANIRIAGECGSSPRSVVDYALKEYRK-------------------------------------ERKYNRVFCVFDKDRHPTYNEALERIRKMGKGDSIQAITSVPCFEVWILLHFCYTTKAFGST----------------------GPSGSICASVIKTLKKHISGYDKGTGGLFSSLKERLPDAMIHAGRLEKHADESG-----SDNPSTKMHQLVEYL 217
28 4.000e-30UniRef50_B0JVB5 Uncharacterized protein n=22 Tax=Microcystis TaxID=1125 RepID=B0JVB5_MICAN  ali  22  12RRQTKTRETRKRFLIVCEGEKTEVNYFKAFTV---PKKIAVTVKGEGKNSLSLVNKAIQIIDNLK-----------------------------------QDDSFDQIWCVFDKDNCSKEQFNQAEGLA--KEQNIKIAYSNEAFEIWFILHFQYLDIATSRSEYPKILNTQMKKCKLLNEK---------------------EQYAKNREDMYEKLKPYQTTAITNAAKLIQDRDEAKKH-PFDANPSTTVQELVQEL 208
29 4.000e-30UniRef50_A0A2N6DCS9 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2N6DCS9_9BACT  ali  26  18KRKSKALDTRPRILIVCEGEKTEPNYFREFP---------------VKGNLVNVEIHGEGKNTRSLVEEAKRLARIANNNKEP---------------------YYQIWCVFDKDSFPQFNDAVKI---CESTKNFFAAYSNEAFEIWYLLHYNYHDAATSRTEYERMLSKNLKT-----------------------------KYEKNSKNMYAILLDKQPCAIRNAKKLRATY---DSISPHSNNPCTTVYELVEEL 205
30 5.000e-30UniRef50_I0KEG3 Uncharacterized protein n=1 Tax=Fibrella aestuarina BUZ 2 TaxID=1166018 RepID=I0KEG3_9BACT  ali  21  18RRVEATKSLRKFFLIVCEGTKTEPNYFEGIKKDLPPNIVRVADFKAAGTGKNTLSVIDEAER-----------------------------LLEQHKKSGSTQPIDEVWVVFDRDSFPKQH--INAAITQALQIGMHCAWTNEAFELWYILHFQLIEHAMSRSQYQKVIERELTRCLGKPYK-----------------------YQKNSEAMFALLMQHIEQAIKRAERLAEPFGDR--TDYADHNPRTEVHRLIKKL 222
31 5.000e-30UniRef50_A0A2C6V0E0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2C6V0E0_NOSLI  ali  24  21KRLQNARPKRRFYLIVCEGTKTEPLYFEGLKKNLPPHVLELIDLSIEGTGRNTLGVINEALKAKARIESQPGRV------------------------------IDETWTVFDRDSFPN--QNFDNAIAKAQELGVYCAWSNEAFELWYLLHFQHFQQAIRREHYQKLLEKELSRCMGKSY-----------------------QYDKNSQDVYNLLKGNEEQAIKRARQLEQQF--AGRTDYANHNPCTRVYALVERL 224
32 5.000e-30UniRef50_A0A1W9VB26 Abortive phage infection protein n=1 Tax=Anaerolineaceae bacterium 4572_5.2 TaxID=1971725 RepID=A0A1W9VB26_9CHLR  ali  27  16.RKVGVRSLRDKFLIVCEGVQTEPKYFSSF-----RVSKEVKVVGVGGNTDYVVREAI---------------------------------------RLMDQDDFDQVWCVFDRDTFP--VQNFNNALSLAKSHKIRVAYSNEAFEIWYLLHFHYHDTALSRSQYAKKLKT-----------------------------RSGFKYQKNADNMYELLENRQPDAIRNAERLLRSYI---PHNPVKDNPCTTVHHLVQEL 195
33 6.000e-30UniRef50_A0A257UA49 Uncharacterized protein n=1 Tax=Ferrovum sp. 37-45-19 TaxID=1970377 RepID=A0A257UA49_9PROT  ali  21  17RRKAASRKSADRILIVCEGSKTVPQYFDEIRQELRLPTAHIYVMG-----------ASDGNDPLSVVQYAKKIFLNGDPHRSISPRV-----------------FDQVWVVFDRDEHHSYHDNLSMENDIKSKVPFEVVASVPCFEIWLLLHYEDVLAPLSRSDVYQRLRRHIPQ------------------------------YEKGGCGLWKRTNSQVLTAKDRAIKIALQKNRNDD-----DGPYTDLHLFVDRL 220
34 6.000e-30UniRef50_U2FST3 RloB-like protein n=1 Tax=Salinisphaera shabanensis E1L3A TaxID=1033802 RepID=U2FST3_9GAMM  ali  23  13RRKRESKEPKQKIIIVCEGKTTEPDYFDQLYRYVRNPLVKVEVCEAAGEPATIVAKAKSLKAE---------------------------QLRKAKRSGNSFEGFFSVWAVFDRDEHPKYHEALDL----ARASDIELAISNPCFEIWLLFHICDYQAPIHRHDLQKKLEEACPGYS-----------------------------AKKKRIQYCAISDAYESAEKRATSSIVNRELEGDPL---GNPSTTVHHLTNAI 208
35 9.000e-30UniRef50_K9UI64 Uncharacterized protein n=2 Tax=Chamaesiphon TaxID=217161 RepID=K9UI64_CHAP6  ali  25  20.RILGTRDTIPTFLIVCEGEKTEPNYFKSFPVSTRP---EVTIIGASCETVAVVNKAIELMTAKK---------------------------------------FDRVWCVFDRDKVNNTAHRFREALKIAAKENINVAYSNECFEIWYLLHFHYFNTGVPRSDYKKKLTKLLG-----------------------------CDYEKNSDDMYVKLEDKQTQAIKHAKNLLASY---DPHEPENDNPATTVHLLVEEL 205
36 1.000e-29UniRef50_A0A285L6C2 RloB-like protein n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A285L6C2_9NOCA  ali  27  14....PFRDPVTLILIVCGGEVTEPTYFHGLRRHLRNPATKSAVTVRPEDPKRVVAFAA-----------------------------------------RQRADYDQIWCVLDVDEF-----DYSEAIRMARTSKIGLAVSNPCFEYWLLLHFENCDAALTGRDVEKRLKKHLPAYDKTAL-------------------------------RFADYIEGVEEAVRRAK-----SRSVGGGDDHRANPSTGVWKLVE.. 185
37 1.000e-29UniRef50_A0A1G3UM94 Uncharacterized protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1G3UM94_9DELT  ali  25  13.RRVGIRYLRDRILILCEGKKTEPNYFRKFP--LNVELVEIDVRGTGANTLNLVEAAI-----------------------------------RRGQAASEGRPYNQIWCVFDRDSFP--PGNFNRAFKVAEANRIHIAYSNQCFELWYILHYHFNDAAIDRNEYARRLTKFIGR-----------------------------KYYKNDENMYDLLKERQDNAIQNAKKLLSRYVS---CNPEKDDPSTTIHKLVETL 199
38 1.000e-29UniRef50_UPI000378C292 RloB domain-containing protein n=1 Tax=Lamprocystis purpurea TaxID=61598 RepID=UPI000378C292  ali  23  20.RQQQQRQEGKRFLIVCEGMKTEPYYFTELCNAYKLHTLRVKIAPGAEGS-------------------------------SPNRVLDYAKKLYEEDAQLGSDRFDQVFCVIDRDQHEHYKATIQRIETLGK--PFRAIPSIPCFEYWLLLHFTYSRQHFQAAD---------------------KQSLCDAVIRDLRRQPGFFEYAKAQRNTYHLLKDGIETAIKHAQWAETDAEKTG-----EDNPTTSVHHLVLEI 218
39 1.000e-29UniRef50_A0A139CSD5 Uncharacterized protein n=2 Tax=Methanolobus TaxID=2220 RepID=A0A139CSD5_9EURY  ali  23  6RRKRGQRPTRNKMLIICEGEKTEPIYFE----NYRTPQNNVDVIPIPSS---------------------------------RKDVGSIVKFAKKKMQDLDINGGDSIWCVFDCDENTDDSISTAYRDA---GRSIKMCFSNPSFELWFLLHFSYTDASLQNEGLIELLKRQIADYSK-------------------------------SRNYFQTLKPLTDTAIKNAKKLEKLHLDNGDINSTQSNPSTQVYRIIEVI 194
40 1.000e-29UniRef50_A0A2S7HZ68 RloB domain-containing protein n=10 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2S7HZ68_ECOLX  ali  26  24KRVSKARAQMKKILIVCEGEKTEPAYFTDFIKHCRISTAIVEISGECGSSPMNVVS---------------------------------WAKEKYNTEKKRSDPYDKVYCVFDRDAHPNYDEALSRINSLNPKGIFVAITSIPCFEYWLILHFGYTRKSFS-----------------------PQKGKSEGAQMLAELKKYMPDYEKKASGVFNKLQDRLDTALINAKRVEDAAKKDGSI-----NPSTKVGALITDL 222
41 2.000e-29UniRef50_UPI0004109D39 RloB domain-containing protein n=2 Tax=Vibrionaceae TaxID=641 RepID=UPI0004109D39  ali  23  9KRTSNKKDPYDKILIVSEGSKTEPNYFNEIKNLYEISSLNIIIDGDCGSSPICVVNHAKALA---------------------------------KKEEKLGSPFDKVFCVIDKDNHTCYFEALDK-IKAQKGDVFKSVQSIPCFEYWLLLHFEYTTRAYVSQ---------------------TGNSVGTQVIRDLKNKPGMGSYEKGEKGIFIKLLDKLETAKINATNAQNSAEKNEC-----DNPSTQIHTLVEYL 207
42 2.000e-29UniRef50_A0A2T4VQK1 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A2T4VQK1_9DELT  ali  29  17....PSLNPKLRLLVFCEGENTEPQYIDAFRKWCRNSRVDVEIAKERGVPLTLXXXXXXXXXXXXXXXXXXXXXNIA---------------------------YDEVWCVFDVDEHPNLSDA----QQMASANGIKLAISNPCFELWLLLHFRENPGMQHRHDVQKMVVGFVSDYDKHVD--------------------------------FELFKVGYPAAVMRAKRLDEHASADGE---SGRNPTTNVYQLTESI 205
43 2.000e-29UniRef50_G4CND9 Csm2 family CRISPR-associated protein n=15 Tax=root TaxID=1 RepID=G4CND9_9NEIS  ali  26  19QRKVACRQPYERILIVCEGEKTEPYYFQGLCDSLSLHTANVEITGNCGSSPKSVFERALEIFKES---------------------------------EKQRNPFDKVYCVFDKDNHSCYDETIRKITSQQPKNTFFAITSIPCFEYWLLLHFQYTTQPFNNASVMSKLKEFI------------------------------LDYEKGNSKIFQVVKDSVKFAIENARRANTEAEQNHT-----DNPTTLMPEIIEKL 210
44 2.000e-29UniRef50_A0A1H7WTL0 RloB-like protein n=1 Tax=Pasteurella skyensis TaxID=97481 RepID=A0A1H7WTL0_9PAST  ali  22  14.RKQPSRKPYDRVLIVTEGEKTDPNYFNDLIKDEGLSSANVVVTGDCGCDPTSVVNQAIKLFKES-------------------------------KKGGSSTIYNRVFCVFDRDGHANFDNAINK----ASSNNIEIICSYPCFEYWYLCHFEYTRKGFQKTGNQSSAENCIKELNIHWNNNFKK------------------KYGKSDTQPYVKLKPKLNNAINNAKK-----AQNDADSTGEMNPSTRVYKLVDYL 213
45 3.000e-29UniRef50_A0A2N5XZZ9 Uncharacterized protein n=1 Tax=Chromatocurvus sp. F02 TaxID=1905677 RepID=A0A2N5XZZ9_9GAMM  ali  22  14RRRPPERTPKYEIYIFSEGSKTEVDYFEKFQKEVEASLVTLIIRGGQGDPQHLVKNAIEKKAELDTLSKRNRDSFSKRF---------------------------QVWAVFDKDEHMHYDAA----IMSAEGAGIHVARSNPCFELWGLLLLRAHAAPTTRFELQRILKTEMVGYDHDLNPHFVEGR----------------------------TKDNYREAIDRADELLSMHVNAG---SPYGNPCTTVHTLVHKI 210
46 3.000e-29UniRef50_A0A2K8Q141 Uncharacterized protein n=2 Tax=Acinetobacter haemolyticus TaxID=29430 RepID=A0A2K8Q141_ACIHA  ali  23  11.RRTAQRESYDLVLIVCEGQETEPNYLESLREHEDLSSVNVVITGESHSDPMSVVNHAIKIYEE------------------------------RANEKNPSTLFDKVYCLIDRDEHAKFDAAVHKANTYTKRNILTIVRSYPCFEYWYLCHFKYSRAGIHK------------------IGSKTAGDACTSLLNPLWQTIFGTKYTKNQSNVYPKLAHLIQIAITNSKRALQ-----DTESSSDMNPSTEVHLLVEYL 218
47 4.000e-29UniRef50_A0A1T1BDR8 Uncharacterized protein n=2 Tax=Deinococcus TaxID=1298 RepID=A0A1T1BDR8_9DEIO  ali  24  15...RKQRSERRTYLIVCEGEKTEPNYFKEMRQHHRLS-IAIEPVGTGYNTISLIDEA-------------------------------------ERLHTANNRIYEQVWCVFDKDDFPD--QNFTNAIQKALSKGFRVAWSNESFELWYLLHYRFTTAHLPRSVVYTELSTHFGK-----------------------------KYDKNIVGLYKILLQNQKTAIQNADNLESTQTRDGKT-PAQGNPWTLVHHLVKEL 200
48 5.000e-29UniRef50_A0A1I7JMU0 RloB-like protein n=1 Tax=Acidovorax caeni TaxID=343013 RepID=A0A1I7JMU0_9BURK  ali  25  19RAARPLRQPAPRILLVCEGEKTEPIYFSDLVVAWGLSNQVKIGKNDGSSPDRIVARAEELFA----------------------------------LAQREGDAFDEVFCVFDRDAHERFGDAVARLKAKASGQPLSGVVSVPCFEFWLLLHFGYTDKPYACK---------------------GKKSVGTVVVSDLKKKPGFEKYDKGMAGVFNVLGPKLEPALKHAKQLAANPAEHAEHP----NPSTQVHLLVNR. 218
49 5.000e-29UniRef50_A0A1C0V444 Uncharacterized protein n=1 Tax=Limnothrix sp. P13C2 TaxID=1880902 RepID=A0A1C0V444_9CYAN  ali  22  16.RKENTMKPKQRFLIVCEGTKTEKNYFEAF----PVVSKQVVVIGLGQDPLSIVDKAIE--------------------------------------EKNKDDDIDQVWCVFDRDSVPS--NKFMGAIQRAKSCGIRVAYSNEAFELWYLLHYNYYDCAISRQEYKKMLESLMRR-----------------------------KYKKCDPFLYEELLEKQEQAIAHASRLLKSYGKRH--SPDKDNPSTTVYQLVQEL 198
50 9.000e-29UniRef50_A0A2H0XT22 Abortive phage infection protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A  ali  28  19QRKTDLRAGYENILIVCEGEKTEPKYFRAF-----------------SVNKANLEVYGEGLNTKSLIRFADKKVKEAERKSEY---------------------YDQVWCVFDKDSF--SDEKFNTAIQMAEAKGYKVAYSNEAFEFWYVLHFEYLNADLPRERYYSILDEKLG-----------------------------FKYEKNNPDMYSILLSRQKTAIRNAETLLKQY--NPDTTPSDKKPSTTVHMLVLEL 206
51 1.000e-28UniRef50_A0A075V618 Uncharacterized protein n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A075V618_9PSEU  ali  25  9RRRSAFREERTSVLVVCGAEATEPAYFEGLKRARRNPAVTIKIKAKRGDPDTVVKYAAG-------------------------------------MRDRAEGTHDEVWCVVDVDEF-----DLDKAAATAGRLRINLAISNPCFEFWLLLHFEACSAPLTCYDVAKRLVKHVPGFSK-------------------------------SALRFADYESGIEAAVQRAKKHNVELGFEHG-----RNPSTGVWALVEKI 190
52 1.000e-28UniRef50_A0A0A2F3X8 Uncharacterized protein n=2 Tax=Porphyromonas TaxID=836 RepID=A0A0A2F3X8_9PORP  ali  24  16.RREGTRSQAVYFLIVSEGEKTEPNYFASFAMNRRPEEIHIEIEGAGRNTCSLVRYALAKRAELEWLLHRQ---------------------------------FDRVWVVFDKDDFP--DRDFNEAIRMAEQEDIRLAWSNQAFELWFLLHFELPRGPVDRREFRPRLEYLIQQGHPRYNRKRRYRYKKNATNMRRLLVDAG---------------GFVDRAKRNARTLRGLFS---DTNYAQHNPCTTVDLLVEEL 220
53 1.000e-28UniRef50_A0A0D8HDK4 Uncharacterized protein n=1 Tax=Acidithrix ferrooxidans TaxID=1280514 RepID=A0A0D8HDK4_9ACTN  ali  21  18.RKVGDLKPKRTFVVFCEGARTEPIYLNALRRLGSKTSVVDLKVISGTGDSAPLNLVSKAV----------------------------------KLAERNDCEIDEIWCVFDVDDHKTINQA----IKLAKENNIELAISNPCFELWLILHFCDHRSTLNCSKA--------------------------------SNIRMVFDNSKGKEVNPNLYLPRLATAIKHSERLDQMYDQNGSELP-NNNPSSGMYRLVSRL 204
54 1.000e-28UniRef50_E6W457 CRISPR-associated protein, Csm2 family n=3 Tax=Bacteria TaxID=2 RepID=E6W457_DESIS  ali  23  19QRRAAKRAPYTKILIVCEGEKTEPGYFREICDYYKLNTANVEVYGCGYDPVGVVEFA----------------------------------RQRYRQEKDAGDPFDRVYCVFDRDDHARYGEALDILTSATPKETYHAIPSVPCFEYWLLLHYVYTTRPYECAQLLKELRTHMKRYRKGKQPLFASHXXXXXXXXXXXXXXXXXXXXXGT-----------------------------------DNPSTHVHELVEF. 214
55 2.000e-28UniRef50_A0A1S2QV85 Uncharacterized protein n=1 Tax=Bacillus sp. MUM 13 TaxID=1678001 RepID=A0A1S2QV85_9BACI  ali  23  11RRTVSRKEQRDTFLIVCEGERTEPNYFKKFP--LKKDVIEVDVVGEGKNTHTLVQEAIRLQ----------------------------------REAEKEGTPYNQVWVVFDRDSFPVV--NFQKAIELCDSNGIKFAVTNEAFELWYLLHYNYYDAAMSRTQYIDKLTELMQR-----------------------------KYEKKQQDIYELLKDKQERAIKFAKKLQKHHYDKGYHDFCNSNPITTVYELVEEL 203
56 2.000e-28UniRef50_A0A147KIF2 Uncharacterized protein n=3 Tax=Nocardiopsaceae TaxID=83676 RepID=A0A147KIF2_9ACTN  ali  20  13.RRTNTREAKPRVLVVCEGERTEVEYLKGVIAFFGALPVEVETVGLGRDPLQVVQEAVDRRRE---------------------------ARIDARRAKDANLAFDEVWCLVDVDEHTRLDQALTL----GRQEEIKVAVSNPCFELWLLYHFQDLASAIDRTVLREKLSKYLPGYDKHLPPGFPYSDHSKARARALRAAPEHRETCRKGP-----------------------------------NPSTTVWLLIEAI 205
57 3.000e-28UniRef50_A0A2N2PMC7 Abortive phage infection protein n=1 Tax=candidate division BRC1 bacterium HGW-BRC1-1 TaxID=2013722 RepID=A0A2N2PMC7_9BACT  ali  26  45.RRVDTRSPRTRILIVTEGERTEPNYFNAISERLPRGTVEIAIEGCGFNTIGLVKEAARL-----------------------------------RDLREPLRQFDEVWVVYDKDDFP--PEHFNDASQLSDRLGLKAAWSNEAFELWYVLHFQDLKSGLPRDDYSKMLKKHLGE-----------------------------PYVKNAVDMFLKLEGLLEDACRRGKHLAELSK---NETPAHSNPCTMVFKLVERL 235
58 4.000e-28UniRef50_A0A1H7A955 RloB-like protein n=1 Tax=Arthrobacter sp. yr096 TaxID=1761750 RepID=A0A1H7A955_9MICC  ali  23  15.RRKPTRASKKRFLIYCEGEATESDYFNDIRDEIRGALVELKVDSPSSDPLKLVRGATQRKLE---------------------------AQRDAKRFKDEFLRFDEVWCVFDVDDHKTLEAARVE----AQKADVAIAVSNPCFELWILLHFSDHSAYIETRDLPAKVRTHLPRYDKNLPD-------------------------------CSAIRSGRGDARSRAMRLAVMHDRNG---SPGGNPSSDVWKLVDQI 207
59 4.000e-28UniRef50_L0KWT6 Uncharacterized protein n=2 Tax=Methanosarcinaceae TaxID=2206 RepID=L0KWT6_METHD  ali  23  6RRKRGQRPTRNKMLIICEGEKTEPMYFE----NYRTPHNNLDVIPIPSS---------------------------------RKDIGSIVGFARKKMQDLDIKGGDSIWCVFDCDENTDDRISTAYRNA---GKSINMCLSNPSFELWFLLHFSYIDTSLQNDGLLGLLKRHIPAYSK-------------------------------NNDCYQILCPLTDTAIRNSKKLEQIHLDSGTELNSTRNPSTQVYKII... 191
60 4.000e-28UniRef50_A0A1F4CUP4 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1F4CUP4_9PROT  ali  23  15..QAPARAQYDVALIVCEGEKTEPEYLRGLRKACDLNPANIKIVSADGNDPVSIVREAIQTYRSN------------------------------------PGEFDRVFCVFDRDGHANYQQALDLVANSPRGGILTAIVSVPCFEIWILLHYAYSSAPV-----------------------AASGGRSACDNVVAAIRRHLPEYEKAFDGVFEKIAPMLDTAITHAHRLA-----LHNHGTESDNPATKVHELVKYL 209
61 6.000e-28UniRef50_UPI0009E679F2 RloB domain-containing protein n=2 Tax=Burkholderiales TaxID=80840 RepID=UPI0009E679F2  ali  22  3KRQPPKRESHPEIVIVCEGKVTEPRYFLDLKKSFKNTLVTITPIGGCGVPISVVERAIDERQQRVANAKRSKNSFAKRFF---------------------------VWAVFDRDAHP--VGQVPAAMALAEANGIKVAFSNPCFEVWGLMHYSAYAKPGHHHQTQSELKNKLKSY----------------------------CHEHNPIIDLGEIQHLYNDAVKNSKKAMESRAEEGT---PKGDPSTNVYELTELI 201
62 6.000e-28UniRef50_A0A1Z4L1I5 Uncharacterized protein n=1 Tax=Nostoc linckia NIES-25 TaxID=1091006 RepID=A0A1Z4L1I5_NOSLI  ali  22  11RRRSGNRKSRDNFLIVVEGQETEYNYFYAFKQDLKLSTTDIRIVSASGGDPLKIIDKTCSLVQENKLET----------------------------EKGNQLEFDRVFCVFDND---NKIEKFKQALLKAQENNFACITSIPCFEFWFLLHYLYTTSPFTNKELCPRLETEM---------------------RRAGVLKTKENYDKSDVKLYHKLKPNLENALKNSAELQKNHPNEDGCT----NPSTKVHILIQEL 214
63 6.000e-28UniRef50_UPI00094E9CE0 RloB domain-containing protein n=1 Tax=Parabacteroides timonensis TaxID=1871013 RepID=UPI00094E9CE0  ali  25  22KRAVGTRNQRVYFLIVCEGQKTEPHYFSSFNNSLPPYTLDIETQGEGCDPLGVVNAAIEL-------------------------------------KKSSPKPLNSVWAVFDKDDFPAS--RFHQAIEKAERNGIKCAWSNEAFELWYVLHFLYRNTPMSRTEYQKCIEKEMNQKILEQDGKKGK-----------------FIYRKNAKDMHDLLLGNEAQAIKWAEKL---AGTFDTTEYVKHNPCTMVFRLVDEL 223
64 6.000e-28UniRef50_UPI000A1FAEAC RloB domain-containing protein n=1 Tax=Thalassospira sp. MCCC 1A03138 TaxID=1470576 RepID=UPI000A1FAEAC  ali  26  15.RRGPRLEPKKTFYLFCEGKNTEPDYFRALKRKIRDPLIKIVDKPAAGVPMT-------------------------IANLSVEQANAIGKGAKRKRVKQSYQEADEVWAVFDRDEHPHIQEAMQLC----DSNNVGIAFSDPCFELWLILHIHDFNRACNRHDIQRALSDVLEGYERGRGKTAD----------------------------FSVLLEDIENAENRAEVLLDRRHEEGG----DTNPSTTVFKLTRRI 211
65 7.000e-28UniRef50_A0A0D0ZAL7 Contig000089, whole genome shotgun sequence n=9 Tax=Lactobacillales TaxID=186826 RepID=A0A0D0ZAL7_STRSZ  ali  23  10.KKTGKKEQLPIILIVCEGEKTEPNYFKQF----EVASVKIEARGIGDNTRRLVKYAIEESKKGS---------------------------------------YDQVWCVFDKDSFPDNDFNTAVDLARNKNCGI--AYSNESFELWYILHFEYLNSQIGRDSYIDKLNKIFKSKQSEGFPD---------------------SYKKNDSNIYRMLKPYQNTALKNAKRLSQDYQSEATPSAAQQFPVTYVYKLVEEL 201
66 7.000e-28UniRef50_A0A1R4ITB3 Uncharacterized protein n=2 Tax=Marinilactibacillus psychrotolerans TaxID=191770 RepID=A0A1R4ITB3_9LACT  ali  23  11KRRQKRTPSAEYFLIASEGKETEKNYFTHLKNKI--------------------------VEEKTLSNNKIDLPIFQIEG--IGMVGETLINEAEKYFRRTPRQYKYKWLVFDKDDL--SPNDFNRLIEMAESRGFRVAWSNECFELWLVLHFEFLNTGVTRDQYFTKLDKHLQDRGSATG------------------------YAKNSYEIFDITFELTEVAIKNAENLNKQQGTEGNYTPSSQNPCTRVNLLVKEL 215
67 7.000e-28UniRef50_A0A1G5SAZ5 CRISPR-associated protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1G5SAZ5_9PROT  ali  24  19QRRIARRDPYAKVLIVCEGEKTEPRYFQDLRNHYGLNTANIEVCGECGSDPNSVLQFATQRY---------------------------------REEKDAGDAFDQVFCVFDKDIHANYDEALNAIAKAQPRNTFVVMNSVPCFEYWLLLHFIYSTRPYLANQVLSELRGYLPDYEKGANNIFAMLXXXXXXXXXXXXXXXXXX-----------------------------------XXXVTDNPTTRIHELVNFL 216
68 1.000e-27UniRef50_A0A2N3FI73 Uncharacterized protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-6 TaxID=2013651 RepID=A0A2N3FI73_9ACTN  ali  24  37....GTKDPKRRVVVVAEGAKTEPHYIALLRPRCLAALVEVEVVDEPATD------------PRSLVRRAVEIKAEAKRSY--------------RRSKDPNDLVDDVWCVFDVDEHLFLREACEK----ARDNGVQLAVSNPSFELWLLLHFQPQTAYLSRDDARRSLQRHIVGYDKTIASLSPFEGA-------------------------------FDDARQRAMLLERKHEGDGTVFPHN-NPSSGVWRLVDAI 229
69 1.000e-27UniRef50_UPI000D3896C7 RloB domain-containing protein n=3 Tax=Limnohabitans TaxID=665874 RepID=UPI000D3896C7  ali  23  29..........PRCLIVCEGSKTEPHYLAELREVRGIPHSWVNIKPSEGSSPDRVVQTAEKLYAEDA---------------------------------QMGDSFDQVFCVFDRDAHPTFSAALQRAREAAGGKPFNAITSTPCFEFWFLLHFGYSDAPF---------------------AKAGNKSVGDVVVSQFKTKAGLAQYGKAQRGLAALLQGKLATAAKHANKLRQSAAKTLKQDPIHANPWTNVDELVQYI 225
70 1.000e-27UniRef50_UPI0009B35327 RloB domain-containing protein n=2 Tax=Proteobacteria TaxID=1224 RepID=UPI0009B35327  ali  28  8.RNEGRRSTRQKILIVCEGEKTEPGYFNSF-------RVDKEVCDIRGIGANTLSLVNEAKKIKG------------------------------------NGNYGEVWCVFDHDSFPKK--NIVAALKRAKTLGFKCAFSNESFELWFVLHFCYLDTQITRKDYCKRLSGFLNK-----------------------------EYKKNDPGIYEALLPFQGDAIKNSEKLYKNLTGDGTH-PADARPSTSVHLLVKRL 190
71 2.000e-27UniRef50_UPI00017EF7B3 RloB domain-containing protein n=1 Tax=Cyanothece sp. (strain PCC 8802) TaxID=395962 RepID=UPI00017EF7B3  ali  23  14RNNSISRQPRESILIVVEGKETEYNYFEELRNQLRLPTVDVKVKSSKKSDPLGVVEYANSLEKQRLDESKKSLK----------------------------SPYNKIYCVIDGDHPNR--DNYRSATQNANQYKYQLIVSIPCFELWFFLHFEYSTAYQNCDQLCKHLKKYVPNYDKAM-------------------------------TSFKEFFDRIEVAIKNSQLLDNFHKENDSTEIILQNPSSQVYSLVELL 212
72 2.000e-27UniRef50_UPI000DC42A18 RloB domain-containing protein n=1 Tax=Nitrosospira multiformis TaxID=1231 RepID=UPI000DC42A18  ali  23  35.RLQRSRTKGPRFLIVCEGQKTEPHYFSEFCEHHWLRTPRVRISPGEYGS-------------------------------SPGGVVSYAIDLYDEDAKLGPDRYDIVFCVIDRDTHSTYHAALHRIEENAEGKPFVAIPSVPCFEYWLLLHFTYTRQPFHAAGKKSICEAVIRELRKQSG---------------------FHGYGKGQKGIYIHLREQTTTAIKHAQRAEEDAREIGD-----DNPTTCIHKLVIAL 236
73 2.000e-27UniRef50_A0A2H0KAH3 Abortive phage infection protein n=1 Tax=Candidatus Taylorbacteria bacterium CG11_big_fil_rev_8_21_14_0_20_46_11 TaxID=1975025 Re  ali  26  6.RKAEIRRPRKVIRIYTEGVKTEPNYFNSIKNELRLSEIDIKVNGRGDHTLPLVQWVIERKNEERISDNFET----------------------------------EWWVVFDRDDHS----DFNHCIELAEANGINAAYSNECFELWFILHFEFLQTSLGREKFESKLTKLLGK-----------------------------KYGKNDSDIYDLIKHGEVNAIHNAKNLKKIHDGAGVQSPIKRDPSTLVYKLVENL 196
74 2.000e-27UniRef50_A0A1C4LFW8 RloB-like protein n=29 Tax=Actinobacteria TaxID=201174 RepID=A0A1C4LFW8_9ACTN  ali  22  8KRTKGVRPEQRRFLFYCEGACTEDQYFKGLRTELRSLPVAICLGGEHGEP-------------KSLVRAAIDHQERAPRSASDRW-----------------TEYDEVWCVTDVEAPV-PHDGLAAALKPARRYGVQVALTNPCFELWLLLHFKDVSGYCTSAEAQRALERLDACGYSVDRKHLE----------------------------YESLRAGHGQAEQRAQALRERA-----TKGHADNPWTDVDRLVGRL 202
75 2.000e-27UniRef50_UPI00037483E1 RloB domain-containing protein n=1 Tax=Oligella ureolytica TaxID=90244 RepID=UPI00037483E1  ali  21  20.RERSKREPYEKILIVCEGSKSEPYYFEDAKRFHKINTLNIKVEGTGLDPNKLVERTEELV----------------------------------RQEARRGDPFDAVYCVFDKDQHTSYQQAINRIHNTTHNGEWFAITSVPCFEYWLILHFAYTDKPF-----------------------YDRDGLSAAEAVTRELKQYFSSYSKEKKSIYTELYEQVPTAIGYAKRILKSHQNLNT-----DNPSTHIHILVERI 215
76 2.000e-27UniRef50_H7EI42 Abortive phage resistance protein n=2 Tax=Treponema TaxID=157 RepID=H7EI42_9SPIO  ali  30  11KRSSKRKRQLRKILIVCEGEKTEPAYFKSFPEK-PDVFDSLDVQGIGNNTVFVVKKAIE----------------------------------LRDKAVKTGTPYIEAWAVFDKDDF--SQKDFEEAIKIAVENKIHVAYSIECFELWYLLHFNYYNTAMHRNDYFDKLSALLK-----------------------------QKYEKNNENMYSLLKTRIDTAIKNASKL---HVRQMSLPLSEQNPVTLVYELVQKL 200
77 3.000e-27UniRef50_B4V8U4 RloB n=10 Tax=Actinobacteria TaxID=201174 RepID=B4V8U4_9ACTN  ali  24  13RRRGPVRRSARTLLIVCGSKETERQYLQGLRDHLRNPAVAVKVLGKACSPTQLVAYTAGQ--------------------------------------RDLADGYDEVWCVFDVDQFPDVDEAV----TQARRAGIKVAVSNPCFEVWLLLHFADHRVHVTYKKLLPLLRKHVPAYDKTRVG-------------------------------FAAYRQGLKAAAERAERL------DPTGEDHARNPSSDVWRL.... 189
78 3.000e-27UniRef50_A0A1G1Y1E3 Uncharacterized protein n=1 Tax=Candidatus Buchananbacteria bacterium RIFCSPHIGHO2_01_FULL_44_11 TaxID=1797535 RepID=A0A1G1Y1E3_9  ali  26  12.RKYNTRPEKKIIYIFTEGEKTEVNYFKAKKNEIRRTNIQIKIKGTANNTLSLVEYAMAVIANEGIV-------------------------------INGSEDGDECWVVFDKDNF----DNFDEAIIKASQNGLRVAYSNECFELWFFLHFCLITAGIGRQDYM-------------------------KKLDNKLKKLGSDGYKKNSLTMYSLIKNLEVDAINNARYLLDSYP--LKISYSKKNPSTTVHLLVERL 207
79 3.000e-27UniRef50_A0A0Q4B723 Uncharacterized protein n=1 Tax=Candidatus Bacteroides periocalifornicus TaxID=1702214 RepID=A0A0Q4B723_9BACE  ali  21  11.RAKGQREKRLRYLIVCEGRRSEPNYFRTLSSEIKSDIVAVELEGDAGCTLRVVERA---------------------------------ESLVRKRKQEGQAPYNRVWVVFDYDGREDFKKAIE--RARSRSNGFGCAWSNESFELWYLLHFQDLESAITRQQYCDKLETWVRKKRGNPD----------------------FKYQKEDESIYQILKEHEADAIRRAEKLRKLHP-AKEGNYNEWNPCTCVDLLVQEL 212
80 3.000e-27UniRef50_A0A1F3K3X3 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3K3X3_9BACT  ali  25  21KRKVEFKSKRKFYLIACEGEKTEPNYFDSLKTSLPKGVLELTNIDIDGTGKNTL------------------------------SIIEEAKKLRNKYEEKYLRKIDKVWAVFDKDSFPPINFNNAINKGENSRPKVNCAWTNEAFELWYLLHFNYYNTGITRQQYQKLIEKEINRASNSTG----------------------FKYKKNSKEMFSILNGSQENAIKNAERLENLY---FDRSFSNHNPCTKVHKLINEL 226
81 3.000e-27UniRef50_A0A1U7CSU9 Uncharacterized protein n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CSU9_9BACT  ali  23  18......RDPMPVVLIVCEGEKTEPQYLEGYKRACRNPRVNIKTVSKTVSPEGLVQLAVELRDRAG------------------------------------HDAYDSVWCVFDVDDHPSLPRAKDQ----ARAGRIELAISNPCFELWLLLHFQEHPGMQDRRRVKAMLRKHVPHYDKAVD--------------------------------YASYATGHPHADKRAERLEQAAEKA---NEPGRNPSTGVYQLIRII 195
82 3.000e-27UniRef50_A0A257DHH1 Uncharacterized protein n=1 Tax=Sphingomonadaceae bacterium PASS1 TaxID=2015579 RepID=A0A257DHH1_9SPHN  ali  21  11KRRQSLRAPKRKFVIFCEGANTEPVYFRALQQYFIGAIIDIEILGAAGVPTTIARKAVAEAA---------------------------SIRRNNRKRNQSFGQLDEVWAVFDQDAHLH----VAQAIAQCRDAGVGVAYSNPCFELWLALHIQDFDQACDRHTIQKHLEGVCPEYDRNS----------------------------GKSPNCNKLVKSVSIAETRA---ISQFQRRIDEGSSMGPPSTTVHLLTIAL 207
83 4.000e-27UniRef50_A0A1E7XWY7 Uncharacterized protein n=3 Tax=Acidithiobacillus ferrivorans TaxID=160808 RepID=A0A1E7XWY7_9PROT  ali  22  31............VLIVCEGEKTEVFYLKDFCEDLRLRTLDVRVEPGNRGS-------------------------------SPDRVVAYALELYEEDARSGEDRYDHVYCVMDRDEHATFDHALMLQSRRGRGAHIQAITSFPCFEYWFLCHFEFTRRPFSRS---------------------GGKSSCDEVIAQLRGHPGFKDYEKGRRGVYALLKERMETAEANAGEACVQACSDG-----SANPSTAVHVLVAKL 221
84 4.000e-27UniRef50_UPI0003680A29 RloB domain-containing protein n=1 Tax=Methanomassiliicoccus luminyensis TaxID=1080712 RepID=UPI0003680A29  ali  22  6RRKQSGRERRKLLYLVCEGERTEPIYFNNFR--------------TPECDFRIIILSDHNNDPIGLVSRAIKVID---------------------DEVFDSEYGDQVWCVFDVDQ--NSDEKLQAALGMATDRGISIALSNPCFEIWYYIHFTFCSSKLSRQDLLVKLDNYIKDYNKTM-------------------------------NVFECTKDMLPMAIKNAKKLNKMHEGAAVALIGTSNPSSQVYRVIETI 197
85 4.000e-27UniRef50_A0A1L7FF68 RloB-like protein n=2 Tax=Actinoalloteichus TaxID=65496 RepID=A0A1L7FF68_9PSEU  ali  22  13RRRTGGRSERRRILVVTEGTKTEPSYLQGLCAYLRQTGVRVCVRGEGRDPERVVKKAALETGDGQLV--------------------------------GGRDGFESVWCVFDVDEHRT----LQTGIRAAARHGFHTVVSNPCFEIWLLWHYEDCRRSIDSTELRRRLRRY--GIDKAVPKDFLFAR....................................................................... 165
86 4.000e-27UniRef50_A0A1N7B2T0 RloB-like protein n=1 Tax=Pseudomonas sp. A214 TaxID=1855331 RepID=A0A1N7B2T0_9PSED  ali  23  20KRAKAVRAPYSKVLIVCEGKKTEKNYFEEIKNHYELSSTNIEINTECGSAPINVVRHAIELYKNEL--------------------------------RARKDAYDKVFCVFDRDTHSTFDQAVDLVNGQNPKGTFNAITSTPCFEYWFLLHFLYTQQPFRATQ----------------------KKSAAEQLEDHLRSNYWPEYKKNASNCFKTRINELSRAKIWAGQILSSSKTSGII-----DPLTNVHELVDYL 219
87 4.000e-27UniRef50_A0A2T0QA78 RloB-like protein n=2 Tax=Allonocardiopsis opalescens TaxID=1144618 RepID=A0A2T0QA78_9ACTN  ali  22  11RRKVGTREARPRLLIACEGTVTECQYIEGLKRYLQSQLVELRDCRTLGIGCDPLNVVKAAIDERN------------------------KEARKADARGDANLRFDEVWCLVDVDEHTTLLPALE----TAKRNGIKVVVSNPSFELWLLYHFQDYLSAVSRDHLAKKLPKRIPGYDKHLPDDFPFAAH--------------------------------EAARQRAQRACPEHTEANRNGP---NPSTNVWLVVDA. 206
88 4.000e-27UniRef50_A0A2S8STF8 RloB-like protein n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8STF8_9BACT  ali  24  19.......KERATFLIVCEGARTEPHYFEGF----RVRVEDADIFGKGYNTLSLVQETITI-------------------------------------RENSHKAYDQVWCVFDRDDFP--VENFNRALELAAQNDIRVAYSNQAFEIWYLLHFHFHNAAIHRDQYAEKLGKELKR-----------------------------PYKKNDREIFTILRGKRTDAIRNARQLYESYT---PHLPATDNPCTTVYLLVEEL 195
89 5.000e-27UniRef50_UPI0008374185 RloB domain-containing protein n=2 Tax=Psychrobacter TaxID=497 RepID=UPI0008374185  ali  25  12.RKSKLLRQYKNILIVCEGEVTEPNYFKSLIHKYKINAANVQIIGKCGSAPMSVYSTAVELYRVS--------------------------------KLKGEVEYDKVYCVFDKDQHPTYQAAVESIRQ---KKNFEAILSDPCFEVWYLLHFTQSSKPFHKK------------------------GSKTASQQVKSETTKLLKQYAKNENHLSILHQNLGTAISNAKQMESRGIK---------NPYTNVYKIVEEI 201
90 5.000e-27UniRef50_A0A1S6IMA7 Uncharacterized protein n=3 Tax=Jeotgalibaca dankookensis TaxID=708126 RepID=A0A1S6IMA7_9LACT  ali  25  14KREVATRQPEKTFLIVCEGTRTEPNYFRSF----PVLSARIEVRGAGRGTLSLVHYAENLLEDRQ-------------------------------------DEFDEIWIVFDKDSFSAVSFNNAAYLESRHDEGYRAAYSNEAFELWYLLHYELFTQPLSRYQFGPMLSK-----------------------------RMHKQYRKNMPNMYGILLNKQARAIENAKILYSRHSN----SPAKDNPSTTVFKLVEEL 199
91 5.000e-27UniRef50_UPI0005CA2EF1 RloB domain-containing protein n=2 Tax=Legionella pneumophila TaxID=446 RepID=UPI0005CA2EF1  ali  22  19KRKSNDRKPYDTVLIVCEGIKTEPNYLQAYCDEKKLSNANIKIAGRGENPSRVVD-------------------------------------FSLKEYNRGKSNYDRIYCVFDKDMHPCYQESINRINRRHNPIPIYAIASVPCFEYWLLLHFVESTRLYTST-----------------------GEKSASELVCDDVRYYIRDYQKNNVNIYHITKQHLTIAIDRAKRLRQNQSDIGT-----DNPSTNMYELIEYL 216
92 6.000e-27UniRef50_A0A2A4NU02 Uncharacterized protein n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2A4NU02_9RHOB  ali  16  15KRRGADRDVPDRVLIVTEGSKTEPDYFRKLIAELGLRTAQVRITGDGGSAPVSVVEDGL-------------------------------------RILQQDPDFEQVYFVFDRDRHDSYDGALDTKKRAYKGVTIVAVTSVPCFEIWFMMHVSQSRKPYESA--------------------KTGGSPGSAVLSDLKKTDLFACYEKGECAQFDEIAPFRDDAKSRAGLFLTQAQEEGTTEFHE-NPSTRVHLVVGAL 220
93 6.000e-27UniRef50_UPI0009DEE327 RloB domain-containing protein n=1 Tax=Belnapia sp. F-4-1 TaxID=1545443 RepID=UPI0009DEE327  ali  22  13KRPRPVEEPRLRVTIFCEGKNTEPDYFKKFADEHGNKLVVVKTIGPAGAPPVIVAKALI------------------------------AKRDASRQRQASYEKRDQVWAAFDYDDRPN----IQACIKAAKDGGVRVAFSNPCFEFWALLHFVGYGAALNSAEAQHLLRKHMPKYDPSGTKLLD----------------------------YHALKDRYEDACRRAETLRRQREVEG---VHYGCPYTDVHVLTDLI 207
94 7.000e-27UniRef50_UPI00055A5EE2 RloB domain-containing protein n=1 Tax=Ruegeria halocynthiae TaxID=985054 RepID=UPI00055A5EE2  ali  20  17.RGRAKRQERDKVLIVTEGEKTEPDYFRRLISELGLTTAKVRITGEGGSAPISVVEMAEGILE-------------------------------------HDDDYEQIYMVFDRDRHASYDDAIAKTRSGFDDKTVVAVTSVPCFEIWYSLHVSESCKPYCST---------------STGGSPAKSLISDLKRAKLNGVALFSEYEKGCKKQFFEIAPQREVAKQRAERILQRARQAGDKEHHE-NPSTRVHFIVGAL 227
95 7.000e-27UniRef50_G1VHY9 Uncharacterized protein n=5 Tax=Prevotella TaxID=838 RepID=G1VHY9_9BACT  ali  24  15RRRQGTRNEYVRFLIVCEGTETEPNYFKAFVKDRWSEVRTVGPVIKGCAKGTCQLVAEAGKIRVDLEKSRQV-------------------------------PFDRVWLVFDKDEF----NDFNQAISKAKKKGMMCAWSNESFELWYCLHFQDIKAALRRNQYIDMIEKCVRKLSKNKD----------------------FVYDKASKDFYTLICEHGDKAGKRAKLLRQSYGSR--TDYDKHNPRTEVDLLVDEL 216
96 7.000e-27UniRef50_A0A1F9ZK36 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon RBG_13_61_15 TaxID=1797978 RepID=A0A1F9ZK36_9EURY  ali  25  6RRRVGGRRPYRILVIVCEGAKTEQTYFKHYRDRGKNLKIE--------------TPNTNKTDPIGLVKFARRQIDR---------------------YDLSIGSGDQIWCVFDADHNSDQQISTACRMA---SPDIRIALSNPSFELWYLLHFAYDESPISNTDLAMRLKRHLPGFTKT-------------------------------QDVFSDLEPRRITAIRNAKKLNEYHKRRLVILRSSSNPSTQVYRIVETI 196
97 7.000e-27UniRef50_A0A218Q749 Abortive phage resistance protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A218Q749_9CYAN  ali  25  16.RKVETRELRPKFLIICEGEKTEPNYFKCF--RVRKDVIDVDVRGFGYNPSKLVEKA---------------------------------------KELNTQDEYNQVWCVFDRDDCPK--EDFNNAIANANQAGFKVAYSNEAFELWYVLHFEFLNTGIPRKDYITKLNNFLKK-----------------------------KYKKNSDSIYEDLVDKQATAIKNAKNLLKIYN---PHKPESDNPCTTVHKLVEEL 198
98 8.000e-27UniRef50_UPI000831689C RloB domain-containing protein n=1 Tax=Microtetraspora niveoalba TaxID=46175 RepID=UPI000831689C  ali  20  9KRKQGNLPERKRFLIYCEGEVTERIYFGELKRRFRIPGVQFG---------------GAHGEPLGLVKAAIDHQRRAPTSGSDQCMK-----------------YDEVWCVVDVEAPI-PHAALDRALALADRNGIKCAVSNPCFELWLVLHIKDQRGYITTNKACELLEAHGGCDYRRD----------------------------GKSLSAHALMNGYEVARKRARLLEDIHGPE--TRLTDRNPYASVWQLVDGL 204
99 9.000e-27UniRef50_A0A0B7IEE2 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0B7IEE2_9FLAO  ali  26  12KRTRATKGVGKTFLIVCEGKNTEPNYFNHFRK-------------------PTIKAKGTGCNTISLVGEAEKYSKQ--------------------------EDYDEVWCVFDKDDF--SHKDFNQAITIAKTKSFKVAYSNESFEYWFVLHFEDHQGAMSRRHYNAKINGYINPLGVFYDGNGDK---------------------KVSKEFFNLLKDRVQDAIGRAKRNYQIHEDNGTT-PANSNSSTTVYQLVEEI 202
100 9.000e-27UniRef50_A0A250JFM4 Uncharacterized protein n=1 Tax=Cystobacter fuscus TaxID=43 RepID=A0A250JFM4_9DELT  ali  20  13RRRGPTREPKRRILIVCEGEKTERGYFKDFQREVRNPGVHVEVASETGEPLQVVEIAV------RLKKKAEGEARSQHDDNLRWDDVWGVVDVDEHAK-------------------------LDEAQQLALKNDIDLAISNPCFELWALLHFQKQRAHVERGKAQAVLRRHLPGYDKGLDLPK--------------------------------LHPGYGNAVRRAQALDAEAQRQAA---PGRNPTTGVYRLTESI 205
101 1.000e-26UniRef50_UPI000CD8F73D RloB domain-containing protein n=1 Tax=Actinomadura sp. 5-2 TaxID=1926885 RepID=UPI000CD8F73D  ali  24  10.RSSQKKPPKRKIYIYHEGEQSEKGYFRGLCSSVRSPNIKILVSPARGNPLSMVEYAIDSTYRVS---------------------------------GGDIQEQDEIWCVFDIEAPI-PQPKIAEAVDLAMRKGVRLVISNPCFEIWLLLHFSEHNAYLTTNSAYRKLRLHLPNYDKHVD--------------------------------YVTFSSNYVIAKDRAKILDRRHQDTGD--IVKKNPWSNVWELVDHL 199
102 1.000e-26UniRef50_E1IFY2 Abortive phage resistance protein n=2 Tax=Chloroflexineae TaxID=1508594 RepID=E1IFY2_9CHLR  ali  27  21......REVRQRFLIVCEGEQTEPNYFRAFQ-----------------VPGLVITIKDTRERGKKLIQKAEHLRELA--------------------------DYDQVWCVFDRDDLT--PSQIAEAYQYAQQTSIRIAFSNQAFEIWYLLHFDYHNTAITRSDYCERLGKKIG-----------------------------QEYTKNSHGMYNLLFRRQALAMVHAARLIAQYT---PRRPAEDDPATTVYELVDEL 196
103 1.000e-26UniRef50_M2QJN2 Uncharacterized protein n=2 Tax=Amycolatopsis azurea TaxID=36819 RepID=M2QJN2_9PSEU  ali  24  20..RPAFREQRTSVLVVCGAEATEPSYFEGLKRARRNPAITIKIKAKRGDPEAVVKYAAG-------------------------------------MRDRAEGTHDEVWCVVDVDEF-----DLDKAAATARRLGIDLAISNPCFEFWLLLHFEACSAPLTCYDVAKRLVKHVPGFSK-------------------------------SALRFADYESGIGSAVERAKKHGVELGSEHG-----RNPSTGVWALVEKI 199
104 1.000e-26UniRef50_A0A1D3DH64 Uncharacterized protein n=1 Tax=Shigella sp. FC1655 TaxID=1898038 RepID=A0A1D3DH64_9ENTR  ali  23  20.RKSAKKESYDRILIVTEGEKTEPNYFNEIIRLYKLSSANVKVDGSCGPSPKTVV--------------------------------QYAIELAKEEERSKRIPFDKIYCVIDKDAHPCYKEAHEIARDTKLKGELIIISSVPSFEFWLLLHFIFTTKSY-----------------------QQQKKNSTGKQVLSDLKKYIPDYNKGMIDIFSQLEDKLPTAIKNAIAVNKKAAEYQT-----DMPTTKVYELVQKL 217
105 2.000e-26UniRef50_K0X6T1 Uncharacterized protein n=19 Tax=root TaxID=1 RepID=K0X6T1_9BACT  ali  24  17RRISFVREVKQSFLIICEGVNTEPDYFNAF----RLTSANIKAVGQGLNTVGLVQKA----------------------------------LRMKEEERKKGREYDQCWVVFDKDDFPD--RDFNRAIGMAEAGGMRVAYSNQAFEYWFLLHYNLVQGPMHRNQYETKLSGLLGSYNKEAGT---------------------------GGRVFRELGGKQAQAITNAKAVLRRME---GIPPAQAESSTMVHLLVEEL 206
106 2.000e-26UniRef50_A0A0P6WWB7 Uncharacterized protein n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=A0A0P6WWB7_9CHLR  ali  25  24QRRQNLLTPRKTILIVCEGRQTEPNYFNALRDELRNKNIRVRIIPGGESRVTPLYLVQSLATEI--------------------------------QRLDWDSTHDEAWCVFDIEQSGTHT-TLQRALASAKKQNYHLAVSNPSFEYWIMLHYERSNREFNAADVVSALTRYIPNYSK-------------------------------SMSVYSLVRRLTNQAIENAETLRLLCDRHWEDFP---NPSTGIDILVKKL 216
107 2.000e-26UniRef50_UPI0005FCCBB2 RloB domain-containing protein n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI0005FCCBB2  ali  30  17............ILIVCEGARTEPSYFKSFRVH------QDCEIVGAGSNTVSVVTHAMKMMKK--------------------------------------ESYREVWCVFDRDSFPKT--RVKTALQLAAQNNIKIAFSNESFELWYVLHFQYLDTQITRADYCQKLNNLLG-----------------------------QKYEKNDVSMYKKLLENQRIAIANAKKLEGKVVPVGACN-VDSYPYTTVYKLVERL 187
108 2.000e-26UniRef50_UPI000BA32BD0 RloB domain-containing protein n=3 Tax=Pseudonocardiaceae TaxID=2070 RepID=UPI000BA32BD0  ali  24  12RRKRQTRRENKRILIVAEGERTEVQYFKGLADYLRASAVNVIDVKIKG---------AGGGNPLSIVNRAIEELKGGPSIGD-------------------RDGYDAVWCVFDVDQHAK----MREAIVAAKREKFKLAISNPCFEIWLLWHFCSCEKHVDSTYLRRELRKHGIRSKK................................................................................. 157
109 2.000e-26UniRef50_A0A2G9ZNR4 Abortive phage infection protein n=2 Tax=Candidatus Falkowbacteria TaxID=1752728 RepID=A0A2G9ZNR4_9BACT  ali  27  9RTSDKTRFYNKAILIVCEGTETEPNYFNSF----RVKSAKVIAKGVARNTIGLVEYAKE----------------------------------IYDEAKYQKEIFDEVWCVFDKDNFSIKDFN-DAIAKAKKYKNFKVAYSNESFELWFLLHFCYQNTAVPRSDYLSRLGDYLEKLYGGR-------------------------YDKNDRSIYEKLLPYQEVAIRNAKKLLDSYS---NTDPFNNSPSTTVHLLVEEL 200
110 2.000e-26UniRef50_A0A0R2LUF2 Uncharacterized protein n=1 Tax=Lactobacillus paucivorans TaxID=616990 RepID=A0A0R2LUF2_9LACO  ali  23  10.RQKKRILLPGSYLIVSEGTVTEVAYFNEWAKLINEAYQGI-------SASPVVRVIGCGESNQKLVDYVKQEQALDEKI------------------------YENVWLVFDKDDFPD--ADFNTAIRTAKKLKWHAAWSNNCFELWYVLHFDYLTTAVDRKTYYDKLSRELVRNGLATD------------------------YQKNDQSILELLTDRRQTAISRAKKLMASYAEYRATPNSQRDPATTVYVLVEEL 211
111 2.000e-26UniRef50_UPI00049A14B5 RloB domain-containing protein n=1 Tax=Pseudomonas sp. WCS374 TaxID=1495331 RepID=UPI00049A14B5  ali  25  18RRSKAVRASYAKVLIVCEGKKTEKNYFEEIKAYYELNSTNIEINTDCGSAPISVAEHAISLY--------------------------------KKEIQMQKDPFDKVYCVFDRDTHTTFHQALNLIGSQSPKSVFKAITSTPCFEYWFLLHFGYTQQPFARKSAAEQLEDHL-------------------------RRTYWPEYKKNLSNTFAERFLELPQAKIWAGQILNSSLSTGIV-----DPLTNVHELVDFL 217
112 2.000e-26UniRef50_A0A1F8KCQ6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium GWB2_49_20 TaxID=1797612 RepID=A0A1F8KCQ6_9CHLR  ali  25  23.RRPGSRPPGKCILIVCEGAETEPNYFESLRRYLKLSTVQIRIKDRAGAPISVVDEAQNQIKKR---------------------------EQDIRDGRTDILSFESVWCVFDV-ENPHHNQTFDRAVFLADQNNYQLAVSNPAFEFWYILHFERTTRPFNGDELKEHLRHHIPRYQPALP-------------------------------VFDSLVASTQTAVQHANSILEKHPEGELRFP---NPSTQVHLLVQE. 218
113 2.000e-26UniRef50_Q12D90 Uncharacterized protein n=14 Tax=Proteobacteria TaxID=1224 RepID=Q12D90_POLSJ  ali  23  17.RKQGRRASYDRILIVSEGSKTEPNYFREIRAAYRLHTANVE-----------VRSSELGTAPIQVVQYAQALFEDG-----------------DRHKNIQRRTFEKVYAVFDRDDHDSYHDALKLRNDAKQPVAFQAIASVPSFELWLLLHFEGIHAPLHRDEVMRRLKLHIPG------------------------------YDKGAGNTFEITGEHLSVATQRAERLAVRFTAHTDPE-----PFTAIVELVKLL 219
114 2.000e-26UniRef50_E3I764 Uncharacterized protein n=1 Tax=Rhodomicrobium vannielii (strain ATCC 17100 / ATH 3.1.1 / DSM 162 / LMG 4299) TaxID=648757 RepID=E3I7  ali  21  17.RKKGTRPPYDRILIVTEGSKTEPIYFEDIRQQNRVPSAHIRIVPGEGTAPIQIVDTAWDLFLK-------------------------------------EKAFEWVFAVFDRDEHRTYHEALRRKNDEGKSIRFIAIPSVPCFELWLLLHFRDVHDFWHRHALIRELRSDLPG------------------------------YEKGMEGVYERTEPSLAQAVARAQRLKARFSPENG-----RDPYTSVDEVVSLL 210
115 2.000e-26UniRef50_A0A1H1G4I2 RloB-like protein n=1 Tax=Paraburkholderia tuberum TaxID=157910 RepID=A0A1H1G4I2_9BURK  ali  22  16QRKKPQRPAYDRILIVTEGEKTEVNYFEEIRRFHRLSSAHIRVCNSPYGTTPLQVVEYARDRCRETLEW------------------------------------ERVFCVIDRDDHQRYVEALNSANDLGQPIVFSAIPSNPCFELWFLLHFQAHEAHIHRTDVFRLLRD-----------------------------RYLQGYEKGRHGIFEATMQHLDRAYANAERLRAHGQGRGLT-----NPSTCVDELVRIL 212
116 3.000e-26UniRef50_K1GDR0 Uncharacterized protein n=25 Tax=root TaxID=1 RepID=K1GDR0_BACFG  ali  22  19.RISGVREVKQTFLIICEGVNTEPDYFNAF----RLTSANVKAIGQGMGTLALVQKAI----------------------------------NIKEQERQKGRTYNQNWVVFDKDDFPES--DFNSAILLARQNGFEVAYSNQAFEFWFLLHFNLYQGALHRSRYEKMLSTLLG--------------------------FAYTKKSGVSSKMFNALFPKQEQAINHAKTIIKQF---DGNNPAQQESSTTVYLLVEEL 207
117 3.000e-26UniRef50_A6NYN5 Uncharacterized protein n=11 Tax=Clostridiales TaxID=186802 RepID=A6NYN5_9FIRM  ali  20  8KRGQRRRKIKPVILIVTEGSQTEPKYFEHYRSRQTNIDIRVIGSRTSGGETDYLGLIRKAVEYQS-------------------------------KNQISASNGDAVWVVADGDVNYNNPDPIAAKRKLADAKGIHIAISNPCFEFWYLLHFQYTTKFFDYPAVKTALTAYLPDYEKAG-------------------------------DVYAQLSGHTTDAIQNAQRIEQYHIQNGSNKPFGINPFTDIYQLVESL 214
118 3.000e-26UniRef50_A0A292YQ31 Abortive infection protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A292YQ31_9BACL  ali  25  17RRRVAQRNDRDLILIVCEGTQSEPLYFQGF------RLTNVDVVGIGGDPLTVVERAKVE----------------------------------RNKAKKEGKVYDQVWCVFDRDNFPK--QRFNAALQKADSYGFKVAYSNEAFELWYVLHFEFLNSGITREDYKDKLSARLG-----------------------------FKYQKNDPKIYEYLKGNQETAIRNADRLLGLYPSF---NPEANKPSTTVHHLVQVL 204
119 3.000e-26UniRef50_A0A1V5VE97 Uncharacterized protein n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VE97_9BACT  ali  27  16...PPFKELKPVLLIVCEGKKTEPYYFEDIKSKWKITSMQIEIKGSN----------VCGTAPKDIVDYAKKEWKKKTRDGMPIEKGD-------------------VWCVFDRDAH----ESFDAAIKMAKDNGFGIAVSNPCFELWYLLHFRNQTAHIERDDVKRSLREHIIG------------------------------YESNMKEVFSEINDKMEKAEKHAHGLRLKHE--GDGSPETQNPSTGVDALIKRL 206
120 3.000e-26UniRef50_A0A0H3IYU6 RloB-like protein n=14 Tax=Clostridiaceae TaxID=31979 RepID=A0A0H3IYU6_CLOPA  ali  22  25............YLIVTEGTETEVNYFKNIKQIIENLFRNKIIV-----DKISLNIEGTGRSTKVLVNEAI--------------------------KKRSLGSYSEVWVVFDKDDNSDFDEA----IEMAKKEGLNIAWSNECFELWLLLHFQYLESSISRADYYSKLTSHFKENNINRGI-----------------------YNKSINKIFDITYPFVETAIQRSESLLLHHKQNGVFCPSKMNPSTTVQDLVKDL 213
121 4.000e-26UniRef50_UPI000DBE8028 RloB domain-containing protein n=1 Tax=Bradymonadales bacterium B210 TaxID=2211119 RepID=UPI000DBE8028  ali  23  13RRRPARRQALERLLIVCEGEKTEPDYFTRLRQEYRLPSADIEIVPAAGGG-----------AAKSIVKEARYRQKENKKAHKRSG----------------EPLYDDIWCIFDAED-PHHNPGIYSAIKDANKHGFHIGLSVPCFEYWILLHYSDQRPYRNCTQVLTRLQDVVPGYSKADID-------------------------------FDALKPSLPDAIQRARAHLASLQIDETSPCCEANPSTRAHLLTEKL 217
122 4.000e-26UniRef50_UPI00099BD9F4 RloB domain-containing protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00099BD9F4  ali  22  9.RPGETRPEYRRFLIYCEGARTEEQYFVGLRRELSKLPVTVKVGSAHGEAIKLVREAVKH------------------------------KERAPTSRADRFTAYDEVWCVMDVEA-PAPQPGLTQALETARRNNIEVALTNPCFELWLLLHFQDVTGYRTSTAAQKLLERHTECGYTPERKHLE----------------------------YSSLKDRFAKAESRAQGLRGHHGS-----THRNNPWTDVDLLISKL 203
123 4.000e-26UniRef50_A0A178MGM3 Uncharacterized protein n=1 Tax=Magnetospirillum moscoviense TaxID=1437059 RepID=A0A178MGM3_9PROT  ali  24  9RRKPPSRDPKRVFILFCEGKNTEPAYFKALERHCDCVVLDIQVIRAAGTPLTIAERA-------------------------------SAEVRARHTDKGSFQPGDQIWAVFDRDDHPYFDQALKLC----EKAKVGIARSTPCFEVWLILHYQDFHRPDGRHAVQRHLAALSPEYDAKSGKLPD----------------------------CASLMKSLDVAERRAE---TQLQARETERTPFGPPSTTVHLLTRAI 201
124 4.000e-26UniRef50_A0A1N7NK27 RloB-like protein n=4 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1N7NK27_9RHOB  ali  20  21.RRAASRTPMRRVLIVTEGEVTEVEYFEALKSLLKLVSVDLNICGKECDS-------------------------------SPTAVVRYALQRADAEGAHDKGGYNDVYCVFDRDTHADFEKALSQILTANKPKTITAVPSYPCFEVWLLMHFVDSRAPFAAANVEAELKKHSPFENFAKSLTKE---------------------------MVEALQANTDNAIERAEKVMRDAEKTG-----ELNPSTEVHLLVKAL 228
125 5.000e-26UniRef50_A0A0F9ZR50 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWC2_33_13 TaxID=1619061 RepID=A0A0F9ZR50_9BACT  ali  26  9.........KPRIYILCNGELAEPQYFQDFKDHLKAHNILV----------------------------RYRNEFLKKAPWSFIEAAIKFKEEEQQKGKFSEEDNDQIWLVFDVDNWSDNENKFCDALKLAEVNGLKVAWSNECFEFWFLCHFGLYNSAIPRTDYHKKLAKHFKD-------------------------KGLGKYEKNMKSIFDPLFPYQEKAITNAKKLYKMGA-------VGNNPSTAVHLLVEEL 199
126 7.000e-26UniRef50_A0A1M6VFG3 RloB-like protein n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A1M6VFG3_9DELT  ali  23  22QRKAGKRAPYDRVLIVCEGAKTEPLYVKQMCSDLRLSSTNVVVDNTQGSAPTSVVECAM-------------------------------------KKYKSDPYFNRIYCIFDKDRHGSYKQACDQIRDAKLKGTIHAITSVPCFEFWLLLHFEYTTKDYTGKSVCDKL--------------------------ISDLKVHIPGYEKGEASNYETTKDLLKTAINNAQRLEAYCNDSG-----KDNPSTQMHHFVEYL 217
127 7.000e-26UniRef50_UPI0009AC86E0 RloB domain-containing protein n=1 Tax=Nonomuraea sp. ATCC 55076 TaxID=1909395 RepID=UPI0009AC86E0  ali  23  32RKSGKPKPPRKRLSIYCEGRVTEKIYFCGLRSTLRAANVDVRVVPTKGNSHSIVRYAIN-------------------------------DTGLARRSDIDFQRGDQVWCVFDVEAPQCHP-GIEEAEKLASKYGIKLAVSNPCFELWLLLHFQEQRAYLTTANACTKLAVHLPDYNKRI--------------------------------SFDAFAELYSGGRSRAVDLGAKFGEAAN--LVERNPWSSVWVLVDHI 224
128 8.000e-26UniRef50_UPI000479EEE1 RloB domain-containing protein n=1 Tax=Bacillus sp. UNC438CL73TsuS30 TaxID=1340434 RepID=UPI000479EEE1  ali  23  13.RKINSRKIAPRFLIVCEGEKTEPNYFRYFKNK----------INEIKKDTVNIQIEGTGKNTISLVDHTIRLMNRAIP------------------------DYTQVWCVFDRDSFPTGNFDIA--IEKATKAGIQVAYSNEAFELWYLLHFHYYDSAFNREQYIEILNSIFN-------------------------QKLDIPYEKNIEGIYEIIIGNEDFAIKNAKKVNAMNQHL---NPENANPSTKVYALVEEL 209
129 8.000e-26UniRef50_A0A1X7K3W6 RloB-like protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1X7K3W6_9BACT  ali  24  10.RPTGIRPQRKLFLIATEGEKIEPKYFYMFNTTLSTAKILCLKGGHASSPPKVLKRMANWLNENDLKI------------------------------------FDEAWIVVDKDQWTDSQIEELSSWAKSKEN-YGLALSNPKFEYWLLLHFEDGVAIRSSRDCSDRLKKHIPGYDKDINASKFTN-------------------------------ERIDQAILRAEK--------GDNPPSSGWPSTTVYRLVKRI 195
130 8.000e-26UniRef50_UPI0002AA9728 RloB domain-containing protein n=3 Tax=Pseudoalteromonas TaxID=53246 RepID=UPI0002AA9728  ali  22  20.RKAAKRAPYETVLVVTEGLKTEPNYLNELVSRYKLSVANIVIDGESDSSPSSILKYAKQQVKKS---------------------------------KAKGFNYDRIYCVFDKDSHTCYEKTV---IAIKNLPGYYCIKSVPCFEFWLLLHFTYTTASI-----------------------VKAGKKSPGDKTLQKLKQFLPDYSKGAKNTFSQLEDKLNVGIRNSKKSLEESLKTGC-----DNPSTNMHELVEFL 213
131 8.000e-26UniRef50_A0A259ELM2 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A259ELM2_9PROT  ali  21  17KRHAAQRAPYKRVLIVCEGEKTEPYYFEEIRREHRLTTANV-----------QVSPSALGTQPIQVVEYAEQLLREG-----------------DRCKSILPGAFDHVCAVFDRDDHATYHQALAKKNDSGERIPFEAIASVPCFELWLLLHFEDVLAPLHRNEVYDRLKLYLPGYDKGQ............................................................................... 176
132 1.000e-25UniRef50_UPI00074505EE RloB domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI00074505EE  ali  23  20.RKGKGKSVSEKILIVCEGGKTEPNYLKEMKKHYKLETASV----------IEVCGDECGSDPRSVFNYAKKKRDEEMAKCAP---------------------YDKIFCVIDKDTHENYVETMDSISRVRPSGLFVAINSVPCFEYWLLLHFEYTTKAY-----------------------GNLPKKSSGNLALKDLKKYIPDYDKGCHGIFLKLENRLNRAIENSKRALGAASENKT-----DNPSSRMHVLIEKL 218
133 1.000e-25UniRef50_A0A1C3EKG0 Uncharacterized protein n=1 Tax=Planctopirus hydrillae TaxID=1841610 RepID=A0A1C3EKG0_9PLAN  ali  22  13.RSKATRTPRQRILVVCEGGVTEPSYLKRFQAFVKNQLVEIIYEDGEGDPQFVVTTARDFKTKAA---------------------------RRAQSENDSNLDFDRVWCVIDVDDHSRLDQARIMAL----DHGIELAISNPSFELWLLLHLRESPGSRKQDAIRSLLKQHWPTYQKEVL-----------------------------SVHFKDCETGYHQAVIRAKKLDELAAS---IREPGKNPSTGVYRLTEEI 209
134 1.000e-25UniRef50_A0A238D9P5 Uncharacterized protein n=1 Tax=Thiomonas delicata TaxID=364030 RepID=A0A238D9P5_THIDL  ali  24  17RKKQGRCAGYARILIVSEGRKTEPLYFDEIRIDQRLPTANIAAIP-----------SALGTEPIQVVQYAKDLFERGDIHKGIEPRV-----------------FDQVYAVFDRDDHASYFNALELRNDNKRPVTFKAIASVPSFELWLLLHDEDIQAPIHRDEVMRRLKQHIPG------------------------------YEKGAGRAFATTRDRLDTATQRARALAARFNA-----YSDPEPYTAIVELVNLL 220
135 1.000e-25UniRef50_A0A2V2GE42 RloB domain-containing protein n=1 Tax=Ruminococcaceae bacterium TaxID=1898205 RepID=A0A2V2GE42_9FIRM  ali  23  29RAAAPSIKIRPRYLIVTEGTKTEPYYFESFRKRINAGYHGEYV---------TLRVCGMGDNTVSLFERARAIAIADP------------------------DGFTQVWVVYDKDSFPSRDFNAVEERCSDKGTVYRAAWTNEAFELWYILHFAYVDSALDRGSYEPILTRHLCAEGFGR-------------------------YEKNRTDMFDILEGRMRMAISNAERLEKLNR---GLAPADSNPGTAVHLLVKEL 230
136 1.000e-25UniRef50_A0A246HKE0 Uncharacterized protein n=1 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=A0A246HKE0_STEMA  ali  22  10RRRGPSKVVNRTVLIVCEGTKTEPGYLQDLVQDYGIHGDVEITGNCGSAPISVVDKAIELFKERG--------------------------------------SYDFVYCVFDRDRHVSFDQAVRERRRVVSVAKFLAITSAPCFEYWIMLHYSEAAPPMNTAELLPRLKKIDG----------------------------FAAYEKGAGRLYASLKDFTDTAIRNAKRVEAAAIRNGSV-----NPLTRMHTLVEDL 208
137 1.000e-25UniRef50_A0A1V6JL37 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin006 TaxID=1852924 RepID=A0A1V6JL37_9BACT  ali  25  12RRREDTRVIRNRILIVCEGEKTEPNYFRKFSVDIDLVEVDVQGIGANTLSLVGDAVA------------------------------------RRDDASREGTPYNQVWCVFDRDVFP--AGNFNEAFRLARTNRIRVAYSNQCFELWYFLHFNFSDAALHRQAYGDKLTGLLGR-----------------------------KYQKNDTKMYDLLKDRQATAMQNARKLLTRYV---PCNPEKHN............ 188
138 2.000e-25UniRef50_UPI0009E6991C RloB domain-containing protein n=1 Tax=Acidovorax sp. Root217 TaxID=1736492 RepID=UPI0009E6991C  ali  21  18....KGRKPKTQFIIVSEGEITEPYYFRKLKDLWHYPLLDIRIIEKAGVPTSVVERAIEEFKSKQ----------------------------RETKKNNNSFEIFEVWALFDRDNFTSAM--ISEAFQQAEANNIKVAHSNPCFELWGLMHFGCYAKPGHHHAVHKALTKKIPTY----------------------------HHDKNPIFCPSEIMDKYEAAVNNSEKAIINREGEGTPHP-KGDPSTNVHLLTEAI 213
139 2.000e-25UniRef50_UPI00099E9A29 RloB domain-containing protein n=2 Tax=Streptomycetaceae TaxID=2062 RepID=UPI00099E9A29  ali  24  24...RARRELRKRLLIVCGGVKTEKDYFHGMRDHFRSPNVTIKVDTDARSPLHVVRKAASSF-------------------------------------RNNSDDFDECWAVFDVDDF-----DVSTAVAEAKRGNVNLAISNPCFEYWLLLHFCEHPGSITTRNALINVRKHLPNYDKTRL-------------------------------RFSDYADGVEEAVVRAE-----IRDRGNSSEPGVNPSTRVWRIVEQ. 200
140 2.000e-25UniRef50_A0A2V4J6A9 Uncharacterized protein n=5 Tax=Pseudomonas TaxID=286 RepID=A0A2V4J6A9_9PSED  ali  22  17.RKPGNKPTRQRLLIVCEGSKTEPHYFKEMRHELRLKTADVTVCGEE-----------CGSDPVSVFNYAVQKFEEEDC------------------------KYDSVYCVIDTDEHKNLGKALKLVRD--KGEPFVSIVSSPCFEFWLILHHGPHVTSFRATSTKSI-----------------------GDVVESALRKLDKAYQKGKPGVWARYKSKLDAAIQNSKAIHKVAKSTGN-----QNPSTEVHLVVEAL 209
141 2.000e-25UniRef50_UPI000697F311 RloB domain-containing protein n=2 Tax=Vibrio TaxID=662 RepID=UPI000697F311  ali  24  14RRKGTRLKPKIKIYAFCEGKNTEPEFINKFSLIHGNGLVEVKCVGAVGTPVTIVDECTKEIKN---------------------------LRRQQRKSNDPLDKNFQIWAVFDRDEHPNVSSAIDK----ASANNIKVAFSNPCFELWPLLHFESQTANIHRKVLQKHLETKLDGYDSEVSKSVCPEQLGK--------------------------KGCYETAKKRAMSLHTTHTQVG-VKLVDMNPYTNVYELFDEI 214
142 2.000e-25UniRef50_UPI0009DBB510 RloB domain-containing protein n=1 Tax=Rhodanobacter sp. OR92 TaxID=1076524 RepID=UPI0009DBB510  ali  20  11KRREPRREPYDRVLIVCEGSKTEPNYLRELIAHHQLSSANVQITGDGGSAPHSVVEYALELFKK-------------------------------------DPDYNRVFCVFDRDGHTTFDAAVQEGRRKLGAARFEAITSVPCFEYWILLHFQYSTADMPRFADVE---------------------------PRLRVVPALSNYNKGVQGLYAQTHAHLQDALERADRANRAAHDAATN-----NPTTKMPDLIRYL 210
143 3.000e-25UniRef50_K9ZHR7 CRISPR-associated protein, Csm2 family n=12 Tax=Nostocales TaxID=1161 RepID=K9ZHR7_ANACC  ali  22  11RRSSKNQESRSYFLIVVEGQETEYNYFKSLKEELKLPPTTTIKIAPASGGDPLVIVTEAYKL---------------------------YQENQEKSKTGNTIKFDQVFCVFDDD---NKPEKYKKALKAAKEYNFTSITSIPCFEFWFLLHYCYTTSPFSSKELSPKLETEM---------------------RKAAILKKGETYNKSDKFLYQKLKLNQEKAIDHAIQLEQKHPNEDGCT----NPSTKVHILVDKL 215
144 3.000e-25UniRef50_UPI000D3EB7CE RloB domain-containing protein n=1 Tax=Polynucleobacter rarus TaxID=556055 RepID=UPI000D3EB7CE  ali  20  19.RKPATINTIPYVLIVCEGKKTEPNYFKELVSHFKLPSVNVVIDGDCGSDPVSVVNHGIKLYN--------------------------------DQIKFNNRVFDKVYFVFDRDHYHLEEQGCKYQSKKQLKEILVPINSVPCFELWLLLHHIETTKPYHGDEVKNELKKYWPDYDKGALGIFGLALAIDG--------------------------DNMKTAINRADRVLRAAIECNDE-----NPSTYVHKLVEQL 228
145 3.000e-25UniRef50_A0A1B7UU33 Uncharacterized protein n=1 Tax=Anabaena sp. AL09 TaxID=1710891 RepID=A0A1B7UU33_9NOST  ali  23  14QRKVSGRSKGKTFLILCEGEKTEKNYFEGFQKIARANKTAYITIKGLGAVGITVVTIAKQLKEQGNY------------------------------------GDDEVWCVFDRDYENNNQQNFNAAIRLAIENQLNLAVSNDAFELWFLLHYEYYQSETHRSEYEKMLSIRLGE-----------------------------KYEKNSETMYEKLKDKESNAINFAKKLWLNHCNLHGIDIHNINPSTTVYQLVEKL 223
146 3.000e-25UniRef50_UPI000A02CD9C RloB domain-containing protein n=1 Tax=Actinoalloteichus spitiensis TaxID=252394 RepID=UPI000A02CD9C  ali  21  13.RSTGKRSERRRILVVTEGKVTEPTYLNELKRRLRATGVSVSVVPGKHSDPRTVV---------------------------------DTARTQRDSAERAGEAFDSVWCVVDVDDHRGLPAA----IRDASRSGLKVAVSNPCFEIWLLWHYEDQTGALSSEALRKRVERYLDGK................................................................................... 150
147 3.000e-25UniRef50_A0A1I5E1X5 RloB-like protein n=2 Tax=Sphingomonas sp. OK281 TaxID=1881067 RepID=A0A1I5E1X5_9SPHN  ali  23  11RRRPAKLTPRLRIMIVCEGEKTERIYFSLFATALRAANVQLEIPPRECGTDP------------------------------------KSFITFGMTKFDDDVGIDRCFCIIDRDSHANFDEAMDYASTFIGRVQIDVIVSYPSFEYWLLMHYVRTTKPFSKS-----------------------GKKSPGDMVVAELKKHLPNYAKNAIDPMKALFDKTTVAIENAESTYKAASSSGN-----MNPSTRVHLVVSLI 209
148 3.000e-25UniRef50_UPI0006D5F9EC RloB domain-containing protein n=4 Tax=Proteobacteria TaxID=1224 RepID=UPI0006D5F9EC  ali  25  12KRKTDVVDPKVEIYIVCEGKNTEPKYFEDCADYYGNGLVKVKPLRGAGVPMTIVQTAKELKEELIAARSGKKAKNSFDHCF-------------------------RVWAVFDKDEHPEIDRALAIALESK----IDVGFSNPCFELWPLLHLTAYGGQDGRHPLQKRLKKEMPNYDHDSEAIVD----------------------------FGQIKDSFPIALDRAKALLDARASEQCI---HGCPSTTVGSLVEKI 210
149 3.000e-25UniRef50_D7N3Z4 Uncharacterized protein n=20 Tax=Proteobacteria TaxID=1224 RepID=D7N3Z4_9NEIS  ali  23  11.REEPKKEAYDLVLIVCEGEKTEKFYFRSLIKFEKLSSVNIKIISGTGSDPVSVIKTALKEVE----------------------------------DQKEYLPFNKVYCVVDRDEHKNFSNAVN----MIKDKNLELIISYPSFEYWYLCHFKYSRAPITRS------------------GTRSSGDNCVATLNAEWKKVFGNEYEKNTENLYEILHDKLEIALSNAAKSLKAAESEE-----ESNPSTKVHILVDYL 207
150 4.000e-25UniRef50_A0A2X4BIX4 Uncharacterized protein n=1 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=A0A2X4BIX4_STEMA  ali  22  10RRRPPARNVNKTILIVCEGAKTEPYYLREMVRDYGIHGEVEVTGNCGSAPISVVDKAIELFGE--------------------------------------APRYDFVYCVFDRDTHSTFKDAVAKVRGHQHKADFIPITSTPCFEFWILLHYSASAAPMNFTALLPKLKKI----------------------------PGYQAYNKGMPRLYELLKPLTDVAIANAQTVRTAALANGSP-----NPLTDMDILVGDL 208
151 4.000e-25UniRef50_UPI0004B4EFB6 RloB domain-containing protein n=1 Tax=Saccharibacillus sacchari TaxID=456493 RepID=UPI0004B4EFB6  ali  26  12.RKENKRNAKPSHLIVSEGVKTEVNYFNGFKEEINRKF-------EGTVASYTIDIHGAGKETIRIVEEIEEIRRRSPNI------------------------YEHLWAVFDKDDFPADH--FDNAINMAAAKGIKVAWSNECIELWFLLHFSYLNTAISREAYYTKLSAELKKRGGPD------------------------NYEKSDPILYELLKPYQSKAIANAKKLRQNA--NPNLPPSKQNPCTTVDDLVCQL 211
152 4.000e-25UniRef50_A0A101G0C4 RloB n=1 Tax=Actinobacteria bacterium 66_15 TaxID=1635289 RepID=A0A101G0C4_9ACTN  ali  25  14....PSRDPARSLVIVTEGAETEVEYLKSLRRWFRFGP-NVKVIGAGGDPCSIVETAATLHCDV---------------------------TARRRHRIPDYVEFDEAWAVFDVESDPSRTSKVQKAIALARRCGVSVAASNPCFEFWLVLHLVDHIAPFGSKDVAKVLSNHFPSYSKSTPPPPTQ--------------------------------ENLTSATTRAALGRNHHRDGGG----DGNPSTNMDHLIASL 205
153 4.000e-25UniRef50_A0A1G1FCJ6 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1FCJ6_9BACT  ali  25  14RQRKNPREPYDVVLIVCEGSKTEPAYFTALKNELRLSSANISIYGKE-----------CGSAPLSVVDYAIAEFNK-------------------------SRDYNRVYCVFDKDRHETYEAALEKVSRTKLRGKFFAITSVPCFEYWLLLHFAETARPY------------------------GASASFSPCEELLRDLKVHIGDYEKGNDVFGITYPLIDQAIRRAELRERNCATDRN-----DNPSTKVHHLITYL 209
154 4.000e-25UniRef50_A0A126Y1Y0 Uncharacterized protein n=16 Tax=Streptomyces TaxID=1883 RepID=A0A126Y1Y0_9ACTN  ali  20  20RRPSPHRTPVERLLVVCGARVTEKQYFDGLRKAEENKAVSVKLVARPKSPSQVVKFAVDRLAT-------------------------------------ARDEYDQVWCVLDVDQFTDLPDALAEA---ERHEDLYIALSHPCFEVWLLLHLADHTAPAASKALLPALRRHVPAYDKTSLDFER------------------------------QYGPTWREAVRRAKKLC------PPGKEPEVNPSTGVWRLAEAI 203
155 5.000e-25UniRef50_A0A0A7PEC9 Uncharacterized protein n=1 Tax=Sphingopyxis fribergensis TaxID=1515612 RepID=A0A0A7PEC9_9SPHN  ali  22  11QRRKASREPRQFLLIVCEGESTEPAYFAHYRRKLRLANVGIDICG-----------AECGSDPKSVVKYAEARFKK-------------------------DPSIDKCFCVIDRDRHLTDNFQGAIINNLYKNRDFIVHVSDPCIEYWFILHFQYTRTPFT-----------------------ESGQKSRGGCAVDKLVSLWPEYRKNLPDIGLSLEPRSAQARTNAIKALRDAET-----TSEPNPSTSLHLLIQEL 210
156 5.000e-25UniRef50_A0A242CI03 Uncharacterized protein n=1 Tax=Enterococcus sp. 4G2_DIV0659 TaxID=1834181 RepID=A0A242CI03_9ENTE  ali  25  6.RKVETIESKPSIFIVCEGQQTEPNYF------LKFPITNKTVKGIGYNTVSLVEYAIE-----------------------------------------NGSEYDEIWCVFDEDG---KKDQFDQAIRLCEKKGCFAAYTNEAFELWYLLHFNDMQPDITRKQYCEKLTSFLPT----------------------KRAKDRPKYCKNDETIYEKLLASQHTAISRAKKLLGSYPSHLQ--PSEQKPSTTVHLLVENL 191
157 5.000e-25UniRef50_A0A0Q4S110 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A0Q4S110_9FLAO  ali  23  21KRKENTKEVRVYFLIVCEGEKTEPNYFKSFKSNVKSFVYTIDTLGEGSNTKDLVKRTI-------------------------------------KARDKSSQKYDRVWTVFDRDSF--SPDNFNGAVQLANSQDIKVGWSNEAFELWYLLHFQYRNTSMSRTEYKKAIEDEIN---------------AKIAKESKSKKPKKFEYKKNSTEMYNILEGNQNQAIKWAEQLIATHT---CENYAIHNPCTLIHLLVKEL 224
158 6.000e-25UniRef50_D1A9I0 Uncharacterized protein n=3 Tax=Streptosporangiales TaxID=85012 RepID=D1A9I0_THECD  ali  21  1............MLVVCEGTVTEKQYLDGLKDHLRAIPVEVVDYECVG----------KGRDPHSTVELAIRLRDKAHRRA--------------RAQRDAFLAYDAVWCVVDVDDHATLGSALSL----ARRKGVNLVVSHPCFEVWLLLHFQELSAGTTRPEVVRKLQDHIKGCNKNIPVNFPF--------------------------------ERHDLARQRALRADPEHCE---VNRIGGNPSTNVWLLVDA. 183
159 6.000e-25UniRef50_A0A2E3R1K2 CRISPR-associated protein n=1 Tax=Rhodothermaceae bacterium TaxID=2026787 RepID=A0A2E3R1K2_9BACT  ali  18  3KRKRPRREPYDRVLVVCEGTKTEPDYFREIVEAYRLSSANVVVASGRGSDPESVVATAVERYE-------------------------------------DDPDYEGVYVVVDRDTHAGYAAAEDRVRNAPGRDVARLVPSTPCFEYWLLLHFEETARPYPCANVIRDLEAHLPG------------------------------YSKGGGGTFAATREYVEEAKARAARRLVEARRAGTE-----NPTTHVHVLVERL 209
160 6.000e-25UniRef50_A0A1V4TCU6 Uncharacterized protein n=1 Tax=Methanomassiliicoccales archaeon PtaB.Bin134 TaxID=1811727 RepID=A0A1V4TCU6_9EURY  ali  23  3........PKPRSLIVCEGRCTEPNYFEGFRKENRNIIIKVCESP-GKTPSQIVRHAMSMADEMDIGKV----------------------------------PGDSAWCVFDVDECSDKDMRRAVQMAGERLN---LAISNPCFELWFILHYTYMDRRMTCREALAELRLFMPGYDK-------------------------------SAEHFHRLRPMTATAISNAQRLERGRAGRGYEVYDRDNPCTGVHRLVCAI 186
161 6.000e-25UniRef50_A0A143YPU3 Uncharacterized protein n=13 Tax=Firmicutes TaxID=1239 RepID=A0A143YPU3_9LACT  ali  24  14.RPVGTKRPEKTFLILCEGTKTEPNYFRSFHVI-----------------SAQVEIVGTAMNTMSLVNYARDVVRDRP------------------------DEYDEVWLVFDKDSFDREIFNEAVFFCETHYRQFRAAYSNEAFEIWYLLHFELIKKAISRFHYPDMLSKRLG-----------------------------FFYKKNHPHMYNVLLSRQPAAIQNAKKLYSQR----SPSPARDNPSTTVFMLVEEL 198
162 6.000e-25UniRef50_A0A1W9N4R1 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9N4R1_9DELT  ali  21  31...........RILIVCEGEKTEPGYFKWWKEQLKKAAISRTVGRIDIVPDDGIEVKGEGKNTESLVIRAIQYRDQANI------------------------DYTRVWCVFDKDSF--KPKQYNAAINKARKENMKAAYTNEAFELWYLLHFNYVDTGVSREQYQGMLTKLIGKKYKKNDP-------------------------KMYEKLLKHPKSDQQQAIQHAKKLLKCYE--GQTNYADHNPSTTVHELVEFL 228
163 6.000e-25UniRef50_B0PCR1 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=B0PCR1_9FIRM  ali  21  8KRGQRRRKIKPVILIVTEGSQTEPKYFEHYRNRQTNIDIRVVGSRTSGGETDYLSLIRKAVEYQN-------------------------------KNQISVSEGDSVWVVADGDVNYNNPDLLSKARKMADAKGIQIALSNPCFEFWYLLHFQYTTKFFDYPAVKNALTTYLPDYEKAG-------------------------------DVYNQLAEHTAIAIQNAKRVEQYHLQNDSSKPFGINPFTDIYQLVESL 214
164 7.000e-25UniRef50_A0A1F0M3C4 RloB-like protein n=1 Tax=Prevotella sp. HMSC069G02 TaxID=1739496 RepID=A0A1F0M3C4_9BACT  ali  26  16.RKQGTRDQKVRFLIVCEGKKTEPNYFRALIDECKSQNNGAKIDKQRTIVSIVAKIGAGAVGTGNLVNKAKKLKDE--------------------YKRKNQIHFDRVWLVFDKDEFT----DFNKAIEDAKKEKMNCAWSNGAFELWFLLHFQNGFEGK-CKDYVNKIESILKKKLKKTD----------------------FSYEKNDVGFYQILKEHEEQATKRARKLREIRGE--KKNYATHNPRTEVDLLVDEL 226
165 7.000e-25UniRef50_UPI000A0F6FAA RloB domain-containing protein n=1 Tax=Catenuloplanes japonicus TaxID=33876 RepID=UPI000A0F6FAA  ali  21  2..............IFCEGKNTEPQYFEALKREPDVRDVAAVDLRVDPDS--------AGGAPITLVRMAVD---------------------ARRRALRESSEIDEFWCVFDV-EWPTHHPSLHDALELAERNDIHVAVSNPCFELWLALHFKDVRAFHDNDQA-RRLRRGL-------------------------------DGQQGKSITGSQYMPLRKEAARRAAKLAGFHTENSATVPH-DNPSSGMYRLIEA. 182
166 7.000e-25UniRef50_A0A265ACZ4 Uncharacterized protein n=1 Tax=Acinetobacter baumannii TaxID=470 RepID=A0A265ACZ4_ACIBA  ali  21  9QRKSPKFEEYDLVLIVCEGSKTEPNYFKQLVQEERLSSANIEITGDCGSDPMSVVRHAIELYKK------------------------------RKKEKNPATLYDRVYCVIDRDSHKNFNNAILLIDNFNKTEGVDIIKSFSSFEFWYLLHFKNSRSAF------------------YKTGLKTASEMCEDILSAEWKIRFGEKYSKSCQNIYKILLPYYAQAVIHAK-----SCLDDANLTGEYNPSTEVFLLTEYL 217
167 8.000e-25UniRef50_UPI000CF9999F RloB domain-containing protein n=1 Tax=Bacillus thuringiensis TaxID=1428 RepID=UPI000CF9999F  ali  21  16.RRSGFRSQNPTVLVVCEGEETEIKYFSALKKIYRGFGIDIKPTNTKFTDALNIVNNALLQMEKH---------------------------------DINLQEGDTVWCVVDVDKNTT--NQLNAAKKIADDNGMSLILSNPCFEIWYLLHKKYTTSAYSNSD-----------------------------QVIVELEKNGFPKYAKNKDVYPELEKSETTAIQNAIKLKRFHEADGNNLYSKKNPSTAVYEVLEHL 210
168 9.000e-25UniRef50_A0A0E1L950 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0E1L950_ECOLX  ali  28  5QRNVGSKDIEKKILIVCEGARTEPSYFKKF-----KANAKCEVVGAGCNTVSVVEKALDMFST---------------------------------------GKFKEAWCVFDRDSFTK--DRVKSALALARKNNINIAFSNESFELWYVLHFAYLDTKITRGDYVKALTGYLGK-----------------------------PYKKNDDNMYQILLKNQHKAIERAKRLYNEMLPPGACE-CDSYPYTTIHTLVERL 187
169 1.000e-24UniRef50_A0A1Q6R6V7 RloB-like protein n=1 Tax=Phascolarctobacterium succinatutens TaxID=626940 RepID=A0A1Q6R6V7_9FIRM  ali  21  8KRGAKRRNVKPLVLIVTEGSQTEPKYFEHFKT--RQNNIDIRVVGSRSS--------AGETDYVSLVRKARE---------------------YQERNQLSAATGDSVWVIADADVNYNNPKKLNQARKMAYNRDINLLLSNPCFEFWLLLHYQYTTRFIDYSDMKNLLQKYIPTYTKTA-------------------------------DVYELLNDRTKTAIENAKRVEQHHLQDGCMLPVDVNPFTDVYKLLERL 214
170 1.000e-24UniRef50_L1MP58 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 473 str. F0040 TaxID=1035197 RepID=L1MP58_9BACT  ali  24  17RTATEDRNIRGRILIVCEGKETEPNYFNSFP---RRDNVSVVTYGGEGCPSQVVEKASELRDNAQI-------------------------------------PYDVVWAVFDKDNFP----DFKTAIDAAHEKEIRCAWSNEAFELWFLYHFENPTNPISRDKYKGRIENHVQQGAKKQKLSQYQK----------------FSYQKNDKNIRRTLLDNEDNAIKWAEKQAQEQSEWHGEKWDDHNPCTMVYLLVKQL 218
171 1.000e-24UniRef50_F3ZRU4 Uncharacterized protein n=2 Tax=Bacteroides coprosuis TaxID=151276 RepID=F3ZRU4_9BACE  ali  23  20KRREPSREEYPSILIVSEGENTEPSYF----RQFRLTTAEVIPLGIGYNTMSLVNKAIE----------------------------------LRDKKVGTSHEYNQVWCVFDKDDY--SDDQYNSAIFKATQNDVKVAYSNQSFEYWLLLHLKDHQGALHRDNYNKEINNLLPQNVKYDGKGSKLVSADLFKHLLSKDLKTG--------------KTLQELAIRRAKKLHQLKDSYYD-SFAKQESMTTVYKLVEEL 224
172 1.000e-24UniRef50_A0A1G3ML66 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3ML66_9SPIR  ali  22  21.RKERLRNQRSLLIIACEGENTERLYFESWFARLKESQQL--------SSRSCVIASHSHTNPSGVLADLLAFQDGG----------------------LTFKDFEQRWIIIDRDGHTLADFNTALQQAEHKKPKVLVAWSNPCFELWYLLHFRYQNTGTDRDLIKGQLTSALG-----------------------------IKYNKSDPNLFTLTIAKLPDALRNAKRLHNDFLEQG-LSADKSNPCTTVYQLVELL 225
173 1.000e-24UniRef50_A0A1N6ZTX4 RloB-like protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1N6ZTX4_ACIRU  ali  26  17.RKSENRPPYERILIVCEGKKTEPHYLEDIRRQNSIPSAHVKVL------------------PSALGTESRQVVDFAHRTF------------------LETRSYERVYAVFDRDSHLTYCDALDLQNDERKPVRFVAVPSVPCFELWLLLHFEDVQAFSHRTETFSRLKRHIPG------------------------------YEKGSRGIFGLTEPQLDVASARAQRLRVRFDAREA-----SDPYTAMDELVALL 211
174 1.000e-24UniRef50_W4V5F5 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=W4V5F5_9FIRM  ali  24  28...........RYLIVCEGGKTEPNYFEGIKRKIEAKYRDKIDVKNKIE----LEIKGTGRNTEDLVDYTIKLRSLSEI------------------------PYGHTWVVFDKDDFTD--EQFNNAIRKAQNSDIDVAWSNESIELWFVLHFEYLHSAIRRYQYIEKLNEHFTAKSINNGK-----------------------YHKNLDNIFDILNGNIKEAIRRSEKLRKYYEEQGVTSEANMNPCTNVDRLVEEL 224
175 1.000e-24UniRef50_A0A0K1F1Z3 Uncharacterized protein n=2 Tax=Olsenella sp. oral taxon 807 TaxID=712411 RepID=A0A0K1F1Z3_9ACTN  ali  22  33...........RHLVVTEGTETEPRYFNGMRLLLGEANGRKVNVVVRSTGKHT----------------------------------MGLLEYAKEACRRSPDVYDHAWLVYDKDDFSDEEFDRVECQQTIELATYHALWSNPCFEIWLLEHLRYTTAPMDSASCCKALSDALKR-------------------------EFGILYKKNMDGMSELLFAKLEVARANALKLRRYHADIGNDTPSSQCPCTNVDAIFE.. 221
176 1.000e-24UniRef50_A0A1U7N6F2 Uncharacterized protein n=1 Tax=Moorea bouillonii PNG TaxID=568701 RepID=A0A1U7N6F2_9CYAN  ali  24  21.RSPNVEPAKQYILIVVEGEETEYNYFKSFKTSLKLKTTTVEVVPGKGGDPLVIVETANKWR----------------------------LRNKQQKQKGREVTYDKIYCVFDGDKPTEYKKALEQ----AKSYGIIAIPSIPCFEFWFLLHYKYTAKSFDCKDVIYELNSEIK--------------------------KDGIKDYDKARDMYSVLEPRLDQAIANAQRLEKYHEQQKTLNIDCANPSTKVHQLVKYL 227
177 2.000e-24UniRef50_A0A1Z2L4K1 RloB n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1Z2L4K1_9ACTN  ali  21  16.RAPATRPGRDRLLVVCGAKATEKHYLQGLVEHLANPAVTVRIRTKPCSPAQLIAYAAG-------------------------------------ERDRAGDDFDQIWCVFDVDEY-----DVARAVTRARREGIEVAVSNPCFELWLVLHFSDHKAHVTYRELLPYLKRYVPAYDKARLD-------------------------------FRDYEHGWPSAGSRAAVLAEAGHEHAT------NPSTGVWALVDRI 195
178 2.000e-24UniRef50_A0A1I6QSU1 RloB-like protein n=1 Tax=Saccharopolyspora flava TaxID=95161 RepID=A0A1I6QSU1_9PSEU  ali  24  13RRPTGNRRERSRILVVTEGEQTELQYFKGLCRFLRATGVSVDVKTEGRDPLSVVNRARRETRNEKLV--------------------------------GARDGFNAVWCVVDVDDHETLPEAVELAQRMK----FNVAVSNPCFEMWLLFHFEACTRYTTRSELRAKLRK........................................................................................ 150
179 2.000e-24UniRef50_A0A1G2Y6F5 Uncharacterized protein n=1 Tax=Planctomycetes bacterium GWF2_50_10 TaxID=1801959 RepID=A0A1G2Y6F5_9BACT  ali  21  13RRQTNVRVPKQSILIVCEGDKTEPNYFKGLAQHLGILGRNSFEVEIDIRPSNT------ASAPKSVVEKAKLAKDE-----------------RERSPSLITRPYDQVYCVIDTEIPQ--HKSLKEAIETARQCDIEISLSNPCFEYWLLLHYEMSSKAYSSTQVLKDLRNHCPGYKKCKVDQQWF--------------------------------GKIDQAVRNSKAVLKIYGANVDLKTCT---GTEVHKVVE.. 210
180 2.000e-24UniRef50_A6DQ82 Uncharacterized protein n=2 Tax=Lentisphaera TaxID=256846 RepID=A6DQ82_9BACT  ali  22  22KRGYRRMEIRKRYLIACEGQETEPNYFAEIKNQLPRDIV--------------VVPKGDGRNTLSLVKWAEQEDNKLKAS---------------------DQEADEVWIVMDRDSFESHH--FDNAIKSAEAKGFELAWSNECFELWVLLHFEEISVSLPREAIYQKLSAIFGFNYVREGKN------------------------KNLFQLIREYGGDEELAIQRAERLWLQAKEDHDTPYSSTNPATGIHKLVQKL 221
181 2.000e-24UniRef50_UPI00094F03D1 RloB domain-containing protein n=1 Tax=Olsenella sp. Marseille-P2300 TaxID=1805478 RepID=UPI00094F03D1  ali  24  19.RTIETREPRETFLIVSEGTRTEPLYFEGLVRAL-----------AKGEVPNEVEIEGVGRVTTSLVEWTAKRVNRSPRN------------------------YDNVWVVFDRDDFENFDEAV----TAAERSGFCAAWSNESFEYWLCLHLGRYDSALSRGDWFRILNDALKKSG-------------------------YGGFEKNREDLFSVLMGSRNMAKRNARSIREGYGKAA--PPSQCNPCTTVDLLVEQL 213
182 2.000e-24UniRef50_A0A1G0GL83 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_38_14 TaxID=1798279 RepID=A0A1G0GL83_9GAMM  ali  25  18.RRAPKKSPYETILIVCEGEKTECNYFRDLCKFHILNTANIIVMNGEGSAPISVVDHAIEMTEK-------------------------------------TADIDHVMCVFDCDEHSTFNQATDKIRQYKPKRNYHVFTSTPCFEVWLLLHFIYSTKPF------------LKSKNKSAADNL-----------VSHLRQHWSDYTKNHLSLFSALNEKLESAFKNAKKLA-----RHNEDVNSKNPATNIHELVDRL 216
183 2.000e-24UniRef50_D2BE29 Uncharacterized protein n=6 Tax=Streptosporangiales TaxID=85012 RepID=D2BE29_STRRD  ali  20  12.RTSSRREPKKRILVMCEGTVTEVQYFSGIKDHFRALPVEIGTCDIDG----------CGRDPLGVVRAAEKRRDTAHRKAQRQGDAYLA--------------YDEVRAVVDVDEHTS----LEAAIRRARESGIRLAISTPCFEIWLLRHFQECSAALTSAIVQNKIHRYVPGYEKHLPEDFPYGEHGTARRRARTADPHHDSPNRKGRNP.............................................. 195
184 3.000e-24UniRef50_A0A1Y2L925 Uncharacterized protein n=1 Tax=Thalassospira alkalitolerans TaxID=1293890 RepID=A0A1Y2L925_9PROT  ali  17  21.RKKGSRKPNIRVLIVTEGERTEKDYFNRLISHLNLSGIDVDVCADCDSAPISVVNFAE----------------------------------QKVRSLSSDDKYDKVFCVFDRDTHETYHAAISKIISLNKNTRFHSVTSIPCFEFWFIIHFQYTRAPYCEAN---------------------GNSVGDMVVDSLKKIAGFSGYDKKTKQQLDLLISNVDVAIKNSQRISCDVEKTG-----EVNPSTRIHEMI... 220
185 3.000e-24UniRef50_UPI0009F25552 RloB domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI0009F25552  ali  23  14RGKGSSIKPKIKIIAYCEGKNTEPEFLKSFSLIHGNGLIKIECVGAAGVPVTIVNTCAEKIRELN--------------------------KIAKKSNEPLDNDY-QVWAVFDRDEHHN----VEAAIEKARANNIKVAFSNPCFEIWPYLHFDNQTAPIHRLDMQKKLEGVLEGYDHKRSKTVCAKKIHET--------------------------GNYEKAKRRAIDMIAQHEQVGIMK-VDMNPSTNAHELLDLI 214
186 4.000e-24UniRef50_UPI000DAEBB15 RloB domain-containing protein n=1 Tax=Spirosoma sp. HMF3257 TaxID=2183553 RepID=UPI000DAEBB15  ali  23  22.RKQDVNNKRRYYLIVCEGTETEPNYFTGLKDNLLLGVIDTIELRVEGTGHNTLT------------------------------VIEDAQKARKRLEDSSSRTFDEVWAVIDRDSFPEDH--FNNAIFKGQAVGVKCAWTNEAFELWYLLHFQFFHNGMSRKQYKALIEREL-----------------------SQKLGRNYTYQKNSKEMYSLLHGNQEQAILWAEKLEVAFV--GQTDYANHNPCTKVHTLIAKL 224
187 4.000e-24UniRef50_A0A1M7RP58 RloB-like protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1M7RP58_9ACTN  ali  18  13KRRTGFRRPRKTFVIYCEGRRTEPEYLEELKRDPEVRDAAAVDLRIQSSVKSSTPLALVQLAIE-----------------------------AKDRNTREQGEVDEFWCVFDV-EWPQHHPGLIRAVETAQRAGISLAISNPCFEIWLVWHFRDHTSFIDTA--------------------------------GASRLRRACDGQDNKGVSSVHYMPHKHDASRRAKLVEERHRQN-DVSFPNDNPSSGMHRLVDA. 207
188 4.000e-24UniRef50_A0A0U1EXW9 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=A0A0U1EXW9_YERIN  ali  21  21.RRKGAKKPLIKILIVCEGEKTEPMYFKDLIEYYDLLTAVIDVSGDCGSSPMCVVRHAKEQQKIMMEQGA---------------------------------PYDKIYVVIDKDAHVDYLPALDVIRRSQPSKTWVAVNSIPCFEYWLLLHYTYSTKEY-----------------------KSLPGNSSGNQIVSALKKYIKEYEKATKGIFLKTLNSLESKNLNEVITKAKSSLEAAESSGTDNPSTRVHELIEKL 223
189 5.000e-24UniRef50_A0A1B8Q6I4 Uncharacterized protein n=2 Tax=Moraxella osloensis TaxID=34062 RepID=A0A1B8Q6I4_9GAMM  ali  17  15.RKGPKVEDYDRVLIVCEDSKSSPKYFEDLIRSERLSSANVRVTGDCGSDPMSVVDKAIEIYEESLNETNLA------------------------------AKYDQVFCLVDRDKHPNFSSALNKVNQYRNNGYIHWVASDPCFEYWYLCHFTQYTKEIVST------------------GNNSSGDNCVKLLNIEWKKAFNENYDKGKSKSYELLKNDIKIPLANSQNTLKIAISNGVT-----NPSTQVHELIKYL 221
190 5.000e-24UniRef50_A0A2S6H7V3 AhpC/TSA family protein n=1 Tax=Methylobacter tundripaludum TaxID=173365 RepID=A0A2S6H7V3_9GAMM  ali  22  24QRTQNTQNERETLIIACEDSVSAPLYFNAIFDDLKINHAIA----------------------------ASSLVIVNHKHTDPAGVLDDLLNHPNYQ------DFDHQWIVIDRDEERTNGESFNQAIARAKNKNIKVAYSNPCFEIWYLLHFDYRNTAIDRDELVEQLE---------------------------------HKYQYKKNALFILNQDQQDAAIRNAANLIQSWVDYGITKPATDNPSTTVHDLVEQL 221
191 5.000e-24UniRef50_A0A150AE52 Uncharacterized protein n=4 Tax=Flammeovirga TaxID=59739 RepID=A0A150AE52_9BACT  ali  27  4RRKDKTRSLRKRVLILCEGAKTEPNYFNGLKHDAQKRRALTAVDVEVYQP--------KSHSPLGLVREAIIKKKRALVK---------------------GNPYETIWLVFDRDFHKHIED----VIKLANEHDIEIIISNICFELWFLLHFEDLDANQHFTKC--------------------------GMLIKHIQQNHVTRYHKNGKN-YQNLKEYTSVAIQRAKKLEETYVHNMHYKFYEREPYTNVYQLVEYL 204
192 7.000e-24UniRef50_UPI000686CDF9 RloB domain-containing protein n=1 Tax=Actinomadura oligospora TaxID=111804 RepID=UPI000686CDF9  ali  18  1............MLIVCEGEVTEVEYFEGITRLYRAPTVKVECVGIGRDPLATVNRALRLREN---------------------------SEKAARSKRDSFLKIDHVWCVVDVDDHTTLDAALLL----ARRNDVHLVVSNPCFEIWLLWHYQNFASQTNRFDLPKKLDSRIPGYSKRKAIPGDFP-----------------------------FKDGYENARKRA--LGCDPEHDKPCRRGQ-NPSSNAWLAVEAI 184
193 7.000e-24UniRef50_I2F4I8 Uncharacterized protein n=2 Tax=Mesotoga TaxID=1184396 RepID=I2F4I8_9BACT  ali  24  3RKQRRSRKTKDTIVIVCGRTKTEVNYFKSFGKIGRLGKVRVEVIGTGSNT----------AEPIALVKNAISLKDS-------------------------DSSIAAVWAVFDKD-----NFDLGPAIDEARDSGVSVAWSNQAFEIWFILHFEFFTREINRAKYSEILEKHLGS-----------------------------KYEKNDRNLFDKTFAMIENAIENAKKGHQQHITFG-HDPDSACSCTTVYKLVEEL 192
194 7.000e-24UniRef50_A0A2G2KZ86 CRISPR-associated protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G2KZ86_9GAMM  ali  21  20.RRNASRQPYDNVLIVCEGEKTEPYYFEDMRVCLDLGSTNIKVDGSCGSSPRSIVAYAKELFDNERVK---------------------------------SGNYDRVFCVFDRDQHETFHEALLKKEGYSKNNIFAAIRSIPAFEYWFLLHFTPSTKPY-----------------------EPLINNSVGDQVINDLKAYMPDYKKKQEGLYSYFLDLISAAKEHSKRIFEASKKSGDI-----NPSANVHELVEYL 227
195 7.000e-24UniRef50_Q310D0 Abortive phage resistance protein-like protein n=9 Tax=Bacteria TaxID=2 RepID=Q310D0_DESAG  ali  25  9QRPLGERRYRKLFVIAVEGVKTEPQYFAIFNDQQSVIRVNCLKGSHDSSPPQVLKRMEDHLRQEELRSS------------------------------------DEAWLVVDKDQWTDEQLDQLHAWAQARDN-YGFALSNPKFEYWLLLHFEDGTGIASSRDCSDRLKRHLPGYDKGIDARK-------------------------------ITRDRIDEAIRRAR--------LRDNPPCADWPGTTVYKLVENI 195
196 7.000e-24UniRef50_UPI000D6CD8C1 RloB domain-containing protein n=1 Tax=Tumebacillus permanentifrigoris TaxID=378543 RepID=UPI000D6CD8C1  ali  21  62....GSKETRDTILIVCEAKNTERIYFRNFATTEKSGV--------------------------------RVQVAEEHKYSVPADLVDYAQKLAVDTFKLDLQDGDQVWCVLDVDAQQNSDEQLRTLRDRANRRGVSLAISNPSFEIWFLAHFEYSTRNYTNRELLDKLREELGGYQKT-------------------------------KCVFSKIVNLQSTAVRNALRLDQHHRDLGNLDLSESNPSTQVYKLIEQI 260
197 8.000e-24UniRef50_W2CDR5 RloB-like protein n=4 Tax=Tannerella sp. oral taxon HOT-286 TaxID=712710 RepID=W2CDR5_9BACT  ali  26  27..KFEPKEEQIRFLIVCEGEETERNYFNAIIDKIPTVRNGSEVKGVGMNTVSLVNRA---------------------------------LEIKEDLEQKNDMTFDQVWVVFDKDNF----ESFNKAIEMANTHGIQSAWTNESFELWFYLHFDYLDTGISRSQYIEKLEKKISTKKGEKFK-----------------------YEKEDPRIYELLQKYGDEAIRYAQKLRESYE---DTNYAKHNPCTMVDKLVEKL 222
198 9.000e-24UniRef50_A0A149VVB9 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A149VVB9_9PROT  ali  23  17.RKQGRRASYDRILIVSEGSKTEPNYFSEIRAAYRLHTANVEVRPSELGTAPVQVV----------------------------QYAQVLFENGDRHKNIQRRAFEKVYAVFDRDDHASYFDALKLRNDAKQPVVFQAVASVPSFELWLLLHYEDIQAPLHRDEVMRRLKLHISGYEKGAGK------------------------------AFATTSEYLAVATQRAARLAARFTADTDPE-----PFTAIAGLVALL 219
199 9.000e-24UniRef50_A0A1H5LFL7 RloB-like protein n=1 Tax=Jiangella alba TaxID=561176 RepID=A0A1H5LFL7_9ACTN  ali  23  3................CCGKRTEPEYFKGLVGHVRKPSVAVKVRTGSSDPSGLVGQAKVFLD---------------------------------------SDNFDQVWCVVDVDEF----DIVRAVAAVRSEPRIRLAVSNTCFELWLLLHFQDHTAFLTCDKAAKLLRHHVPGYEK--------------------------------SVVFRRYSPGLSDAIERARKL-------GGTDDEHPNPSTGVWRLVERI 164
200 1.000e-23UniRef50_UPI00041DC03F RloB domain-containing protein n=2 Tax=Chrysiogenes arsenatis TaxID=309797 RepID=UPI00041DC03F  ali  17  22KRRENKLEQRHLVILACEDKKSARLYFERYFEILRNARRL--------SGLSCVVANHQHTDPTGVLQDLLAYEGVYGNTYK---------------------DYEHRWIVIDRDEHTRQNFDQALEKASKNRPEIKVAWSNPCFEIWYLLHFHYHNTAIDRDQVIVKLAQAMRA-----------------------------PYEKNDPDMFSQLSNGRESAIRNARRLHDDAKQAG-FQPADTNPGTSVYELVEVL 233
201 1.000e-23UniRef50_UPI0009FB9F60 RloB domain-containing protein n=1 Tax=Glycomyces arizonensis TaxID=256035 RepID=UPI0009FB9F60  ali  21  102..........DKVLVVIDAAETERQYLEQFRSKDSATVPYVKIVTKDKDPLTVVRHAI---------------------------------------RLFKSGDFDEAWCVFDEDDYRDGGTFQRAVAEAGKR--IRLAVSCPCFELWLLLHFEQCGSHLTQKEALRRLRKHLPDYDKTTL-------------------------------RCEKFGPHQDTALERAKALEERHGQPH------RNPSSGIWRLVERL 272
202 1.000e-23UniRef50_I9I4G2 Uncharacterized protein n=14 Tax=root TaxID=1 RepID=I9I4G2_BACOV  ali  22  19.RISSVREVKQTFLIICEGVNTEPDYFNAF----RLTSANVKALGQGMGTLALVHKAI----------------------------------HIKEQEKLKGRTYNQHWVVFDKDDFP--ENDFNSAILLAQQNGFEVAYSNQAFEFWFLLHFNLYQGALHRSRYEKMLSALLGFAYTKKSGV--------------------------SSKMFNTLFSKQEQAINHAKTIMRQF---DGNNPAQQESSTTVHLLVKEL 207
203 1.000e-23UniRef50_R4Z4E3 Uncharacterized protein n=2 Tax=Candidatus Microthrix TaxID=41949 RepID=R4Z4E3_9ACTN  ali  19  10.RRSKTAATRRGLLVFTEGEKTEDGYLLPWRRQYRDS-VLITIDPFHGTPRSLVDRAVETKRAES-----------------------------RDERRGRGRAHDEIWCVFDIDEHPNIPDA----IQKAEAHGIQLAISNPCIELWFILHFEDHTAYLDRHVAQSRSSTLLQCGKTLTPEATG------------------------------ILYDAFEPARDRA--LSLDRKHAGDDSPVRANPSSSVWTLIESI 201
204 2.000e-23UniRef50_A0A0U1QRH7 Uncharacterized protein n=1 Tax=Sporolactobacillus inulinus CASD TaxID=1069536 RepID=A0A0U1QRH7_9BACL  ali  25  1............MLIVCERKQTEPNYFEAF------RLTNVDVVGAGADPLTVVERAKE----------------------------------MDQQQHRLGKDYDQIWCVFDRDEFPAERFNNAIY-ATRKLNKFHAAYSNEAFELWYLLHFEYLNSGISRQDYIEKLTKHLDR-----------------------------RYAKNDPAMYHLLLENQEKAISYAQRLLRCYSQD---NPSENKPSTTVHQLVQVL 176
205 2.000e-23UniRef50_A0A1G0Y5T2 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium GWF2_57_35 TaxID=1798576 RepID=A0A1G0Y5T2_9BACT  ali  25  27..........KVLLIVTEGEKTEPNYLKALCDRLRLSATDIEIVHPEGTDPLTLVRTAVDLRNK----------------------------RKNAAKKGFSVEYDEVWVVFDMERPHDERRRLAVQAKAPEASEIKFACSDPCFEYWLLLHEEYTTASFDWKAVVRRLKKHWKDYAKGQQPT-------------------------------HEFLQKVPTAVTHAERCRVHHRNGGG----DGNPSTEVDRLV... 211
206 2.000e-23UniRef50_UPI000561F57E RloB domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI000561F57E  ali  21  20.RRNANRKPYDHVLIVCEGEKTEPFYFEEMRVHLDLDSANIKIDGSCDSSPKSVVEYAQDLFNKERVK---------------------------------AGNYDRVFCVFDRDQHQTFSYALDKINSYSEADVFMAIRSIPAFEYWFLLHFTPSTKPYS---------------------PVGTKSVGDQMIDDLKIYLPNYEKKQKGIYKYSIDNGLIEGAKAHSKRIFENSKSTGDI-----NPSTNVHDLVDYL 227
207 2.000e-23UniRef50_A0A1H6FPY2 RloB-like protein n=2 Tax=Sphingopyxis sp. YR583 TaxID=1881047 RepID=A0A1H6FPY2_9SPHN  ali  23  8KRRVNLREPKRRFVIYTEGKNTEPDYFRAIRKASLGALIDIEIVEAAGVPATIAKKASADAKARSRRGRARSSF----------------------------EETDEVWAVFDRDEHPHVEEALARC----RAAKVGTAFSDPCFEIWLILHHGDFDRPDNRHEVQAECAKRCAGYDPKSGKTAD----------------------------CDALMPLVAGAEKRAAAQLARRMEEGNPPGA---PLTTVFELTRSI 203
208 3.000e-23UniRef50_A0A1I2VTZ1 RloB-like protein n=1 Tax=Methylobacterium gossipiicola TaxID=582675 RepID=A0A1I2VTZ1_9RHIZ  ali  21  10.RKKASRKSRDTVLIVCEGKKTEPQYFRDMIADLGLSSADVRICGGECGTDPLSV-----------------------------------INYAIKILKDSPRGFDYTYCVIDRDTHANFDAALSQAIKSRKTNSFEVTWSDPCFEYWILLHFGYSAKPYMRA-----------------------GRLSSCDAVIKDLKSHLGDYEKNNLGLYKSLKTSYNTARLHAVRRNEECKDQGGT-----NPSTLIHIVCSKL 206
209 3.000e-23UniRef50_A0A2K2U6N0 Uncharacterized protein n=1 Tax=Rubneribacter badeniensis TaxID=2070688 RepID=A0A2K2U6N0_9ACTN  ali  22  11.RKPGRRQGYRRHLVVCEGEKTEPLYFEGMRDALKPEFRNRIHIVVKGTGLHTTD-----------------------------------LLDYALRECRLSGGYDHVWLAYDRDDFDLQDFDSECARNSDETTTYHPLWSNPCVEVWMLLHFGYTTAEMTSAEAIAK-------------------------TDALFQKELRRRYKKNDMSLFADLSSRLANAEANANRLVKWHENQGALRPSQMNPCTQLNEITQTL 216
210 3.000e-23UniRef50_UPI000495FA15 RloB domain-containing protein n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI000495FA15  ali  24  14.RNTASREPKNRIFIICEGKFTEPEYLKGMVRVIRNPRVELIVREAKGTP-------------ISVVEFAKELKVVAESESKRNGDGDVI--------------FDSFWCVFDRDEHERIPEAVQK----ARDSKIEVALTNEAFELWLLLHFREQPGFKSRAHLKEMLEEYITGYDKHVNYEKD-------------------------------FHSRYPDAFRRAVALYKVLM-NIKKPVHDHNPSTSFHLLTDAI 208
211 4.000e-23UniRef50_UPI000B90FCAA RloB domain-containing protein n=1 Tax=Pseudonocardia sp. CNS-139 TaxID=1904968 RepID=UPI000B90FCAA  ali  25  15.RRSGSRHQRQRVLVVTEGEVTELRYFTNLSRHLRATGVVVH----------SAKYEGTGRDPLWVVDTAKAHAERAA---------------------RHQESFDAIWCVFDVDDHSRLPEAIAKADELG----YKIAVSNPCFEVWLVWHFEDLTGHRTSQQL-KRHAKKLGASDEDLLQRFPYASYLEALKRG............................................................... 173
212 5.000e-23UniRef50_A0A2M7QYG7 Uncharacterized protein n=1 Tax=Candidatus Pacebacteria bacterium CG_4_10_14_0_8_um_filter_42_14 TaxID=1974759 RepID=A0A2M7QYG7_9  ali  24  2....KQRSINPRIYIYCNGEIAEPTYFKEFKDHLRSRTITISYNRFKGDSPWNLIKKVVAE-----------------------------KNALTSRSRFVDEDGDQCWCVFDVDEWNQNPTKLKAALKLAKDNNVYLAWSNECFELWYLLHFQNLQTEIPRNHYHTKLKTHFRHLGSKA--------------------------YAKNCSVFGQILEKQPVAIKNARQIYQANK-------VEKNPSTTVFKLVEEI 195
213 5.000e-23UniRef50_UPI000D0FD0D4 RloB domain-containing protein n=1 Tax=Butyricimonas sp. Marseille-P4593 TaxID=2042309 RepID=UPI000D0FD0D4  ali  34  22.RLTDTKQARYSMLLICEGTHTEPNFLELMIEDFKEAGIIDFATTIKPKPTISPSDNTLDLNRGKEKRRKRLLKNTTQKQQEIENMDFFPGEQPLNWVKGGIDNYDEVWVFFDKDGHPKAKEAFEMRITEIDGKKINIAFSSRCFEYYLLLHFELIYRAFEKSECNGKKSKTISYYCMTDRAVEGKACNGDVCINGYARKNNYWKNSKGDLSTYTFVKEKIWTGVYNAHLIRWKSNTLHQNEYYERNPYVDVDKFVCRL 290
214 5.000e-23UniRef50_UPI000DCFAB5A RloB domain-containing protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DCFAB5A  ali  21  9.RKTNTRKPIRKFFVFTEGKNTEPEYLQALGRLYRDADVKIIDLGAAGVPFTLARKAIDFLNGTGLKKSKGRSLDSFEKN-------------------------DQVWAMFDRDTHPKVPEAIDAC----KRNGVHLAYSNPCFELWLILHFEDFNKSDGHTAVQKHFEKVCDAYSTKSGKTSDCESYIGKXXXXXXXXXXXXXXXXXXXXXYNAPWHKLTEAVRIA............................... 209
215 5.000e-23UniRef50_A0A2H3KYE6 Uncharacterized protein n=2 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3KYE6_9CHLR  ali  23  26.RRPGTKIHRP-VLIVCEGKKTEQIYLNALRQYYRLSTIDLHIHGEGAGPLEVVERALELMAER----------------------------RKIVRKERDLRPYAEIWCVFDREA-ANEPVGYREALQLAAQHNIALAVSNPAFEYWYLLHFVETSRAFNADEVKAELCK-----------------------------PNCLPGYQKQKNVFNLIHERTDTAHDRAERLYERHPDRERDP--HPNPSTLIYRLV... 220
216 5.000e-23UniRef50_E5C5L8 Uncharacterized protein n=4 Tax=Bacteroides TaxID=816 RepID=E5C5L8_9BACE  ali  24  19KNKRKARTVICRILIVCEGEKTEPNYFRSFDRHRKGNVVYELTLDGGRMNTVGVVDKAISLRDKANI------------------------------------PYDRVWAVFDKDGFPAKNFNTA--IAKANQNHIECAWSNEAFELWYLYHFHNRITGMTRDEYAVAITK-------------------AVNASPLYKKKTPYQYAKNDKSSFDIVFGSQDNAIRWAE---TKHCEYTDERYAMHNPCTTVYRLVRQL 219
217 5.000e-23UniRef50_R7LDY5 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:891 TaxID=1262937 RepID=R7LDY5_9BACT  ali  66  1....................................................................................................MSEGVDEAWTVYDKDEHPKHEEAMAEADKIIDGKKVNIAFSSRSFEYYLLLHFEYLYYGFEATECGERVKGKKQIYECGTGKNSDKDCNGKKCINGYARKHGYWMESKSSISTFPLVKDKLLKGMINACRLRTESDSKTDEPIYKRNPYTNVDILVGRL 159
218 5.000e-23UniRef50_A0A0P8C4P4 Uncharacterized protein n=1 Tax=Candidatus Methanoperedens sp. BLZ1 TaxID=1719120 RepID=A0A0P8C4P4_9EURY  ali  24  7.RKVGGRERRKKYVIVCEGTETEPIYFKKYRTRYDNLEVIIP-----------------------------------NARCTDPKNLVDFCRESIEHYPLDLKNGDIIWCVFDWDNNKQE----AIFTAFRKAKNVKLCLSNPSYELWYLLHFVDRFSKLNNDELKEKLERHIPNY-------------------------------KKNKDYFELLESKRESAISRAKRLNEMHEKKGDLKSVDSNPSTQVFKIVEEL 195
219 6.000e-23UniRef50_A0A1G0BXY0 Uncharacterized protein n=1 Tax=Gallionellales bacterium GWA2_59_43 TaxID=1798245 RepID=A0A1G0BXY0_9PROT  ali  27  6...........................................................................................RDVQKEEVASGDGYDCIYCIFDRDKHTTFASALQQIKGISSGESLKAITSTPCFEFWLLLHFGFSDAPFHAA---------------------GKKSIGDQAVSKLKTKPGFSKYAKGTKGTYSLLKPKLPDAIKNAKKLRQVIG--GHESQHDANPWTNVDELVESL 151
220 7.000e-23UniRef50_C9LVA9 Uncharacterized protein n=1 Tax=Selenomonas sputigena (strain ATCC 35185 / DSM 20758 / VPI D19B-28) TaxID=546271 RepID=C9LVA9_SELS3 :  ali  23  9QRGERTLPVKRMVLIGTEGRKTEESYFKNFNQ----------------------------------IQNQFIVKFSSGNSTDAVGIVEDVKKSRDKKRNFRHD--DLAFAVFDADLWRTQGNQIQEALHYAKRQNIEVILSNPCFEVWFVLHFEDGKSPYNSSNVIDRLKQHIPDYQK-------------------------------NKDIFGLLRERMNEAIYHAEQLREYHE---GKKTSEQNPMTDVDRVVKLL 199
221 7.000e-23UniRef50_A0A1V4TK18 Uncharacterized protein n=1 Tax=Methanomassiliicoccales archaeon PtaB.Bin215 TaxID=1811728 RepID=A0A1V4TK18_9EURY  ali  19  11QRRSKSKTENPIFLLVCEGEKTEPQYFKQFQSRDYNFKIK-CVTSGRKDPVGILIYAESLIKQMGLSE----------------------------------KKNDVVWCVFDKDRNTKTQ--ICDAMSRCKSNFLTIAVSNPCFEIWYLWHFQDFSVCSTCIDTIEKVKTHIPKYCK-------------------------------NENFNDILSPLTTTALKRARHIEKNYGE--SYHPADSNPSSQIFRIIDFL 199
222 7.000e-23UniRef50_A0A0M5ILZ5 Uncharacterized protein n=1 Tax=Sphingopyxis sp. (strain 113P3) TaxID=292913 RepID=A0A0M5ILZ5_SPHS1  ali  25  8RRATPKRAPKKKFIIYSEGKNTEPQYFQAVRRNLLGALVDLEVIDAAGVPMTIAEKACERATTMRRGRGRRSSF----------------------------EEGDQVWAVFDRDEHPKVPEAIEKC----HASSVQVAFSDPCFEVWLLLHFDNFDRPDDRRQVQAALAKICDDYDPKG----------------------------KKSADFSKLMPKVEDAEKRAE.............................. 176
223 7.000e-23UniRef50_Q13JU2 Uncharacterized protein n=1 Tax=Paraburkholderia xenovorans (strain LB400) TaxID=266265 RepID=Q13JU2_PARXL  ali  23  17.RKKAKRETYDRILIVSEGEKTEVLYFEEIRKYYKLATTHVKVCHSEY-----------GTTPLQVVEFALDLCEE-------------------------TREWEKVFCVIDRDDHPGYEDALNKAKAHDKKIEVRAIPSNPSFELWLVLHFEGVERNIHRDEVLRLLCDRF-----------------------------IPGYEKGRKGIFEVTRTRLETAYTNAARIKARQERQD--LPGMGNPSTCVDELVKVL 215
224 8.000e-23UniRef50_A0A0D6AWC9 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A0D6AWC9_9CHRO  ali  25  9.RPTGQRQYRQLFVIATEGSITEPEYFAMFNNEKTTIQVKCLKTNKKSSPDQVLKKMKEYLLDNKL------------------------------------EKTDQAWLVVDKDQWQDSQLEL-LYQWSQKVNNYGLAVSNPKFEYWLLLHFEDGKGVNTASQCDQKLKKYLPNYDKTIDGRK--------------------------------LKPYVRIAIDRAKQ-----KDNPPCQKWHQTTGTTVYRLVELL 192
225 8.000e-23UniRef50_UPI000A0111F3 RloB domain-containing protein n=5 Tax=Nocardiopsis TaxID=2013 RepID=UPI000A0111F3  ali  21  23..KIGTREPKRRFLIFCEDTYGGTTYFRKLKQEERLANVSIDIGPDHGEPYQLVKAAEKRRD------------------------------SPHPRRREQGGGYDEVWCVIDVEAPESHT-SLDRALRSARVGGIEIAYANPCFELWLLLHQRDVFGHLTTGEAVNLMRGLKCCYNNSKDFNPDHFMG-----------------------------EHQRNAITRAERLAKQHE--GTHHIRQRNPGTDIHVLVRRI 217
226 8.000e-23UniRef50_UPI000998AF4E RloB domain-containing protein n=3 Tax=Streptomyces TaxID=1883 RepID=UPI000998AF4E  ali  20  14.KSRGRRSENKKILIVAEGVKTEPQYFEGLASHLNAQAVHV----------ISVKPIGTGRDPLSVVREADQR---------------------RRQEEQNGDAFDSVWCVVDVDSHATLPSACDL----ASRNSLSIAVSSPCFEIWLLWHFEEHRAWVTAQALAAKLKKHGVSGKSLPSGFPYAGYSEAKVRAEKCEAVRVIHSPPNPSSSVSDLVAELEAACE................................. 203
227 9.000e-23UniRef50_UPI000A02CF51 RloB domain-containing protein n=1 Tax=Oceanibaculum indicum TaxID=526216 RepID=UPI000A02CF51  ali  27  8RRDKFKREPRARFIIFCEGALTEPEYFEAIKRLYTGSLIEFRIIKAAGVPMTMAESAIESSADI-----------------------------RNRRKKDSYEAADQIWVVFDRDEHPNFDEA----IRLCERKKIKIARSNPCFEVWLLLHFCDFDKPGNRHEIQRHLEKIDKDYKVSGRKTLNCDNIVKNVIVAEKR............................................................ 173
228 1.000e-22UniRef50_UPI0009D99586 RloB domain-containing protein n=1 Tax=Pararhodospirillum photometricum TaxID=1084 RepID=UPI0009D99586  ali  20  6.RLVGVINKKRKIYIFSEGRNTEPLYFEAYAHHVGDVAVEVICIAAAGVPLTIARHAQEKIKYISTKKYKKEFGDS-----------------------------DVVWVVFDRDEHPNISEAL----QMCAQNNIYVGYSNPCFELWLILHFKDFDAGDDRFGIQKKCESICPGYKSSSHKVPEL----------------------------STLLPKVEDAERRAEAMEARRREDGAES-----PRTSVYLLTRHI 197
229 1.000e-22UniRef50_A0A1M6WBT8 RloB-like protein n=7 Tax=FCB group TaxID=1783270 RepID=A0A1M6WBT8_9BACT  ali  23  25..QPKKRFVKLTFLIATEGTQTEPNYFNALKKELEKSNRFSIDISVQGKGKPT----------------------------------TTLVNKVYRQIEYNHQEYDRIWVVFDRDEFSDFDEAIQQSADYK----INCAWSNESFELWLLLHFKDVSEHTNRKDLCNLLEAAIRNELHKIDPNTLY------------------DYSKGDSEIYEHVLGSETDAFARAETLKNKSKESSN-APSAQNPCTHVDELVFEL 226
230 1.000e-22UniRef50_A0A2P1S686 RloB domain-containing protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2P1S686_9FUSO  ali  22  16KRKENIKEVEPRFLIVCEGKKTEPNYFEPLKNQINAKYRPDLI----NLKVECIDIVGAGKNTESLIDYTIKLRDNANIN------------------------YGNVWCVFDKDSFTS--NQFNNAISKAGNENIKTAWSNEAIELWFLLHFEYLNTGIGREQYIEKLNGHFKKYKINKGK-----------------------YEKSLNDIYQILEGNYDNAVKYAKKLEKI---NLKETPAKSKPMTKVYELVEEL 221
231 1.000e-22UniRef50_A0A1M6KPY4 RloB-like protein n=1 Tax=[Clostridium] caenicola TaxID=659425 RepID=A0A1M6KPY4_9FIRM  ali  22  11KRKKKYIRPSPFFIIVCEGKVTEPDYFKGFP---------YYNKLGTGYSHAAVYILPDAGQHEAVVKKAYEVWKDLNEEYGTISPN-------------------EVWCVFDCDG---DPDGLNRAIQAARSKKFNAIYSVQCFELWYLLHFQMVRGAINKCEYDKKISEYLG-----------------------------IDYTHGTRGMYALLEERQDDAIRTARQLWEQKAKMGE---LQGDPITNVFLLVEAL 206
232 1.000e-22UniRef50_D8G1H7 Uncharacterized protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=D8G1H7_9CYAN  ali  25  24..............................................................................................KKEGEYSADNNDEVWCVFDRDSFP--PQNFNAAITRAQSNDIKVAYSNEAFELWYLLHFNYYDTAMSRKNYKSMLTNLLG-----------------------------HKYEKNCPTIYDELKDKQEKAIKHAKRLLEAYN---PPKPEQDNPSTTVHLLVIEL 154
233 1.000e-22UniRef50_UPI0009FFEA6F RloB domain-containing protein n=1 Tax=Mesorhizobium sp. LNHC252B00 TaxID=1287252 RepID=UPI0009FFEA6F  ali  21  15.RRAPTRAPYDYVLIICEGSKTEPNYFNGLKADCQLSSANIRVENAAGTDPMTIVSAA-------------------------------------EAAIRSREPFDRVYCVFDRDGHQNYDAAIERLNNHSKAGKLFAVTSTPCFEIWVSLHFIYSTAAFNCDHVIDKLKEYFTKYEK................................................................................. 163
234 1.000e-22UniRef50_A0A1I1QHB9 RloB-like protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1I1QHB9_9BACT  ali  26  13...................................................................................QSLVDEALRLKQLYEKEYNRPVDRLWTVFDRDSFSASDFNNAVLRCQNSKPAIGCAWSNEAFELWYLLHFHYYNHNMSRKDYQGLIEDNLRPFVGDDYK-----------------------YQKNSKVMYDLLKEHLENAIRNAKRLAGNFENRQD--YANHNPCTTVWQLVEEL 165
235 1.000e-22UniRef50_A0A248YLB7 Uncharacterized protein n=3 Tax=Micromonosporaceae TaxID=28056 RepID=A0A248YLB7_9ACTN  ali  24  37RRRPAVREQRRTVLIVTNGESTERAYFTGLKHDR--ATHRVMVAVERGSPLEVVRGA---------------------------------------ARRRDTDDVDEAWAVCDVDQYRTREADAEA-----SATQVRLVWSNPCFEIWLLLHHADCSGFVNAAKASAKLARHVRRWDKTALD-------------------------------FDEFRDSVDDAVRRAKLLGE---------PPVANPSTAVWQVVEAL 210
236 1.000e-22UniRef50_A0A1M3HQR7 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HQR7_9SPHI  ali  24  25.....KRQVQNTFFIFCEGANTEPEYFEAFP-----------------------VNTETIVRAIGLGMCRSSLVKEIIRRVSEQGYLKGQLNYDEDR---------QIWCVFDRDDRPGEDEDFDDAVRLATEHGLHVAYSNDAFELWFCLHDHYIDTQLHRKQFYERLSKRIGFNYEDHGKEKDFA-----------------------KSLYELFLPLQAKAIQHAERLHKVYEAEP--KFSRHNPCTTVYQLVTAL 223
237 2.000e-22UniRef50_I8U1R0 RloB-like protein n=1 Tax=Pelosinus fermentans JBW45 TaxID=1192197 RepID=I8U1R0_9FIRM  ali  24  9.RSRNRRQAGFTVLIVCEGEKTERTYLRNYRR--RDTGVKIEIPNTSNTDPLNLVRFAA----------------------------------LKADELGINKKTGSVWIVFDVD--GNSDALIEKARKLAKRKNMEVILSNPSFELWYLIHFGSTSTALTNTNLVQNLNRYIPGYNKA-------------------------------SNYYDDLKSKQKIAIANASILSSFHRGLGRDLYGRSNPSTHVSKLVQYL 199
238 2.000e-22UniRef50_UPI0009AD5FC4 RloB domain-containing protein n=1 Tax=Spirosoma aerolatum TaxID=1211326 RepID=UPI0009AD5FC4  ali  26  30.RAAPTREIKPTLLIVCEGQNTERSYFEQF----RLSSARIEQYGGKKSPTHVVEFTKKVATKK---------------------------------------EYDEVWCVFDKDDFTN--DDFLKAIQEAENQKFSVAWSNQSFEYWLILHFEDNHAKMPRTDYEARINSHINPLRAHYDGKGSKLITSAFFDVL---------------SGFDLLKNRVQLAIDRAGRRDGECRRAG-INPAESESCTTVYKLVKR. 228
239 2.000e-22UniRef50_D4K551 Uncharacterized protein n=37 Tax=Firmicutes TaxID=1239 RepID=D4K551_9FIRM  ali  19  19RRDKARMIQPEYHLIASEGTETEPQYFGAIQRIINSKYRDRIQLKVEGIGDNTV----------------------------------NLLMKARQYVQNNGIVFKHVWIVYDTDDFPAENIDMVAQLCEEYNTIYHAVWSNQCVELWYLLHFMYMDTDIDRSRYWPKLSDWLKNIGAG-------------------------SYEKNRPDMYEVLRPYMDIAIANAKRLDKQNE---GRKPSESAPGTKVYELVEML 219
240 2.000e-22UniRef50_A0A2W5UTU6 Uncharacterized protein n=1 Tax=Citrobacter freundii TaxID=546 RepID=A0A2W5UTU6_CITFR  ali  18  42..QEQIIDQKKLFLIICEGDNTEKGYFEGF----PVPTKNVIVEGGCGSKTALVEHALRLQKEKKY-------------------------------------EGREIWCVFDFDVNRTQPEDFNQSIEKAYQNGMKVAWSNDAFELWFVLHYQHLESAFTRFELNPILREKWG--------------LDSFSKEAKSTRFCAAHYERFGGTKSTA----QALAIRRAKALHETF--AGRKDYAKHCPCTTVYELVEEL 241
241 2.000e-22UniRef50_A0A1H1LBC1 RloB-like protein n=1 Tax=Gramella sp. MAR_2010_102 TaxID=1250231 RepID=A0A1H1LBC1_9FLAO  ali  25  21KTSVEHKKEREYFLIVTEGEKTEPIYFEYFKNQLPKNLLETIDLVGEGANTTTVVRRA-------------------------------LELKLKREKDPIKPNYNEVWAVFDRDSFPR--DRVNEALELADQNNINYGFTNQAFELWYILHFQYLDAALHRDRYINILSEILG-----------------------------QKYTKNNEEIVNIIMDRVRQAINFAQRLEEMHLGNQ---PVDCSPYTTIHHLVDKL 216
242 2.000e-22UniRef50_UPI000D59356C RloB domain-containing protein n=1 Tax=Actinomyces TaxID=1654 RepID=UPI000D59356C  ali  19  14RRGVAGTPRRPVVHIFVEGSVTEKEYIERLQDVSEVTGNTFLKVHHRGNSPRRVVDAVIQ-----------------------------------ERATSPDADVHQFWAVFDVEA-PTPHGDLDKAMELARHHQVHTAVSNPCFELWLLLHTTDQYAYLTSAEATRLYRETDGSTDKHLTAIAPVNA------------------------------EGVSRACKRSARLRERHKRNGTVFP-QDNPSTTMDLLIDAI 205
243 2.000e-22UniRef50_I4FMH4 Uncharacterized protein n=2 Tax=Microcystis aeruginosa TaxID=1126 RepID=I4FMH4_MICAE  ali  25  20................................................................................................DNLKKDDSFDQIWCVFDKDNCSKEQFNQAEGLA--KQKNIKIAYSNEAFEIWFILHFQYLDIATSRSEYLTILTNQMKKYGLLNKK---------------------EKYKKNREDMYEKLKPYQTTAITNAAKLIQDRDEAKKH-PFDANPSTTVHELVQEL 158
244 2.000e-22UniRef50_A0A162TPW8 Uncharacterized protein n=3 Tax=Wohlfahrtiimonas chitiniclastica TaxID=400946 RepID=A0A162TPW8_9GAMM  ali  26  2................CEGQKTETQYFQEIVAAHKLVSANIKILFKGSAPISVVEGAIECYER--------------------------------------DPDFDFVYCVFDKDEHATFQKALD-RIATYTKIQLRPIVSVRQFEYWFILHFVDSTKPCQSYEMQKWLETAIERYTGMPYK-----------------------YQKGASGMYELTNPYLEKAIQRAKRMAQQAFDDKEM---YRNPYTNVYELVEHL 180
245 2.000e-22UniRef50_UPI000C7BDFCB RloB domain-containing protein n=3 Tax=Actinobacteria TaxID=201174 RepID=UPI000C7BDFCB  ali  20  12RRKTQIRPEKKTIVVFCEGRRSEPDYIRGLKRISTNAAIRIEIVVAPGVPATLVRRAV---------------------------------------EKARDPEIDECWCTFDV-EWPTNHPNLKQAVSLARENGIRLAISNPCFELWLVLHFEDHRRFSDNATIERRSRELDGRSGKGIDPAV--------------------------------YMPRRWEAVERARALEAMHLRNSVRFPA-DNPSSSMADLV... 197
246 3.000e-22UniRef50_A0A1G6G4B5 RloB-like protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1G6G4B5_BACOV  ali  24  35...........RFLIVCEGARTEPNYFQALVKDKYSEVRDEKIVGEGKSTCALVNRT---------------------------------LQIKEELEQRRQLPFDRVWVVFDKDDFPDFNEA----IKLADSLSFNCAWTNEAFELWYFLHFQYLDAGISRHDYIIKLENEIRKH----------------------PNYENYKYKKNDPSVYKMLIGDENFAKQCAVRLRSFFE--GDLDFKEHKPCTTVDLLVEEL 223
247 3.000e-22UniRef50_UPI0009E9B758 RloB domain-containing protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=UPI0009E9B758  ali  27  9RRAPPTRSPKRKFIIYSEGKNTEPDYFRAVQRDLLGALVDLDMIDAAGVPMTIAERACERASSMKRS----------------------------RGRKSSFEEGDQVWAVFDCDEHPKVPEALERCRTSD----VKAAFSNPCFEVWLILHFDDFDRPDDRHQVQAALAKVCEGYDPKG----------------------------KKSADFSKLMPKVGDAEVRAKRQLACRESEGQPP---RRPFTTVFNLTNAL 204
248 3.000e-22UniRef50_A0A099BEN1 Uncharacterized protein n=2 Tax=Helicobacter TaxID=209 RepID=A0A099BEN1_9HELI  ali  24  19KRNTKNLLPKQVILIVCEGEKTEKNYFETLKKQLNLTNANIIIDPDSNPSPSNVVKYAKQKLEQN------------------------------------PNEYDEIYCVFDRDRHRDFNEALN----MVKDTIIQTIVSDPCFEFWILLHF-----------------------TKTSKIFGESGGSPCKKVQEEKAFRENVKNYAKDYDFKEIITQHLETAINNAKEINSQNEAQRQT------PYTQVVVLVERL 208
249 3.000e-22UniRef50_A0A1W2E3D1 RloB-like protein n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1W2E3D1_9PSEU  ali  22  10RRRTPSRVSASRVLVVCCGQ-TEQAYLDGLKRL--SKPVTVKPVVKVGSPAQLVRYAA-------------------------------------KMRENDRGGFDEYWCVVDVDDF-----DIGEAIAEAGATGISLVVSNPCFEVWLILHFADCMASISSKAAAERLRRHLPCYMKGMLD-------------------------------FALLAERVDKAVERARALGA------------GNPSSDMWRLVE.. 179
250 4.000e-22UniRef50_UPI000B86FD2D RloB domain-containing protein n=2 Tax=Streptosporangiaceae TaxID=2004 RepID=UPI000B86FD2D  ali  18  19....NTRSEKSRILIVAEGEKTEPQYFKGLARLLRATGVDVYKLDVERI----------GRDPLRVVERASFLYRKAHP----------------------GERYDHVWCVVDVDRH----QLLEAALREANRLSISMAISNPCFDLWILWHYADHRSYVDQEALRRKL-KSFGISDKNLPVGFPYGDYKVAIRRAESCGFPGRDGLRVPDNPFSSVSDLVK..................................... 199
251 4.000e-22UniRef50_UPI0009FE7201 RloB domain-containing protein n=1 Tax=Bacillus oryziterrae TaxID=1191699 RepID=UPI0009FE7201  ali  23  29.RNPRHREPRKRILILCEGQ-TEVKYIKNFKSRRVNIKVISQ----------------------------------RAKFRNPDGMIKEMLRKIKDDELYVRSGIDEAWCIYDIDTEPEDNKILQN-ITNARKNYINVAYSNPCFELWFLIHFEKCSTHLQCTEILNRLKNYLPNYQKG-------------------------------KDIYNQISDKTTTAIQNAQYLEHQQQNLSQNKYKNANPYTTVYQLTSRL 220
252 4.000e-22UniRef50_A0A229I9J6 Uncharacterized protein n=1 Tax=Prevotella copri TaxID=165179 RepID=A0A229I9J6_9BACT  ali  22  22..QTNAHKIKCRVLIVCEGLKTEPNYFKSFHMMENSGGLVFEITNAGG-----------GINTIQVVQKAIELRDKAIGDKKP---------------------YDITWAVFDRDSF--DAADFDNAIHMADSNDIRCAWSNEAFELWYIYHFENRITPMSRKEYAHKITTLVREKQK-----------------LITGKKSTFVYKKNDPEMRSILLGNEQRAIGWAKK---QSETFSNNSFHLHNPCTKVYELVSLL 227
253 4.000e-22UniRef50_A0A0P0M4F1 Uncharacterized protein n=8 Tax=Bacteroides TaxID=816 RepID=A0A0P0M4F1_BACVU  ali  25  16RRQSQKREQKVIVLIVCEGTKTEPNYFEAFAEKQQGVIVYDIEVKGLGRGTKDVVEKAIDLKNKN--------------------------------------NYDRVWAVFDRDEFPAK--DFNEAIAMGQKNSIEVAWSNEAFELWYLYHFQNVITGVSRKDYEEKISTAVN------------ASPKYKSKKKYRYAKKDPNNYKIMTTY-----GSMESALRYAE---AKHLEYADSRYANQNPCTTIYQLVRQL 217
254 4.000e-22UniRef50_A0A1T4RBB1 RloB-like protein n=1 Tax=Geobacter thiogenes TaxID=115783 RepID=A0A1T4RBB1_9DELT  ali  20  12KRKQNIILPKIEIYVLCEGKVTEPDYIEKFSKKHINKLVKVFPIKGVGVPLTVVEEAVALKRKLLIKARKKGDSYRRAFC---------------------------VWSVMDIDDHPNIPAAINLAL----NNKIHICISNPCFEIWPFLHLKDHDAYIHRDDLHRRLNKEMPQY----------------------------HHEDNPTVDYDLIADNYEIAKCRAIRINKRRHEEDN---DRGNPTTDVYNLLDCI 208
255 4.000e-22UniRef50_A0A2N2NF50 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-3 TaxID=2013726 RepID=A0A2N2NF50_9CHLR  ali  28  23KRRREFKTPASILTIVCEGKKTEPIYFDDIRKQFRLSTLRLSIIPDQGAPISIVNRAI--------------------------------------KEKKKASKDDDIWCVFDV-EVIHENPTFTKAVNLAKSNNINLAISNPAFEIWFLLHFEKTNRPFNADEIIEYLKNYLPEYDK-------------------------------SKSVFNELESKTSEAISNVCSIRNNSVDDWNNFP---NPSTGVDILV... 206
256 5.000e-22UniRef50_A0A1I0QF07 RloB-like protein n=1 Tax=Luteibacter sp. 329MFSha TaxID=1798239 RepID=A0A1I0QF07_9GAMM  ali  21  11..KRPTRPVKPTYLIVCEGKKTEPNYLKELKNDLRMSTADVTIVGEGRDPSAVVEQAINMS-------------------------------------EDSSADYDYIFCVFDRDMHARYSEACNRCAQKQLSKEDDTITSNPSFEYWLLLHLNQTTKPY------------------RMAGRKSSGDVVLAEFQKAFKADTKTSYTKGARGIYQALRPKLDEAIKYSAR---------NNRDGLRNPHSLIGDLV... 209
257 5.000e-22UniRef50_A0A2H9PL51 Uncharacterized protein n=3 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2H9PL51_9ARCH  ali  23  11..........RTVWIFCEGT-TERLYFEKHRVAERLSRLRIEVQRSRRTDVEGI---------------------------------IHYAVNYRKSNSRDFQKDDLVFCVFDCDQ--STEEQLQRCEKLAKDNGIIPIYSNPSFEYWLLCHFGYHPDYYSQTALMQKLREHLPG------------------------------YEKVDPNTYDHIKERQHQAIANAEKILRAHRGAGTHILSKCNPVTLVHQLMETI 194
258 7.000e-22UniRef50_A0A2P8GDC5 RloB-like protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A2P8GDC5_9BACT  ali  34  2..SKKKRVPPTSIFIACEGKNTEPIYFEKIKEIVEEDFNLAITIYPDKND------EAHSSHALGLVEEARSRI----------------------------DEFDEVWAVFDKNGYTKHREAFDLANQQVLGKKVNIAFSSISFEHWVLLHFEKSNTAFPSKDIIDRLAGYFPEYEK-----------------------------KTYIDTFSRLQERTAIALENSAWLEYQKTSSGDTPVYQLNPYTNVGKLVKRL 201
259 7.000e-22UniRef50_UPI000B546C13 hypothetical protein n=1 Tax=Haliangium sp. UPWRP_2 TaxID=1931276 RepID=UPI000B546C13  ali  21  23KRARIARQPGDAFLIVTEGTVTEPHYFDRLRGLLSLKAIHIRIEPGEASDPRRLIEQAAAFVRDHARRAKRDALRIDEPQR-----------------------YDHVFAVIDTD-VAQRQGHWNDIVQLAQARHVQLAHSSPCFEYWLLLHIAYS----TRTDLVD--------------------GPAAKHAVKQAIDCDYAKSADTLRAAIDGLVDKWPQAVVHAERVAEHHARAGTPIPA--NPSTEVGRLVRAL 235
260 7.000e-22UniRef50_C7N5V3 Uncharacterized protein n=1 Tax=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) TaxID=471855 RepID=C7  ali  22  10RRKPGNRPPKDRIYILTEGEATEIEYLKGICARLGLPKELVIIKKACNTDPKGIV----------------------------DELVSAKKQNARLAKRGNDALIDQWWAVFDTEG---RPHDLSAVVQKAKDNRVYLAISDPSFEFWLRLHFGYTTASYDSGKLIKELRDYLPKYS-----------------------------EDNKHPDMDILYPLLPQAMKNARLLRAKHTQLGN-----DQPRTDCDLLIDAI 206
261 7.000e-22UniRef50_Q7MXT2 Uncharacterized protein n=34 Tax=Bacteroidales TaxID=171549 RepID=Q7MXT2_PORGI  ali  24  35...........RFLIVCEGQKTEPNYFKALIDNHYSEVREAEIRGQGCSTCALVERAKE---------------------------------IRDNLEKERELGFDRIWVV----FDKDDFDDFNQAIDLAKSYGFGCAWTNEAFELWFLLHFQYLDVPISRDAYISKLENLIQK----------------------RLNDNSFRYNKNDPSFYNILKDHGDLAKRYAEKLRLKHK---DKDYANHNPCTRVDLLVEEL 222
262 8.000e-22UniRef50_A0A257K9R1 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A257K9R1_9FLAO  ali  25  33.RQMPSKSEKPLILIVCEGKNTEPSYFRQF-----------------KLVTATVVPVGEGYNTISLVNRANYLAQKR--------------------------DYDQVWCVFDKDDFPDS--DFNNAIITAQANNFGVAYSNQSFEYWLILHFDDHQGGMNRGQYNSRINSLLSPYNIVYEGDSSKVITSDLFELLEGIDEKTGRERK-------------LLAIDRAKRNAAFFNYA---NPAREESSTTVYKLVEEL 230
263 8.000e-22UniRef50_T1BJS4 RloB n=3 Tax=mine drainage metagenome TaxID=410659 RepID=T1BJS4_9ZZZZ  ali  27  12RRKPGRKPGRALILIIGEGD-TERAYFRALCANLRLPNIEVQFSCRQGSAPINIVDCAV-------------------------------------QKAKEPGGYESIWCVFDRDEHESFARARAKLQQHARRMPLHEALSIPCFELWLLLHFEFTDALFNCNALIQRLRQHLPQYIK-ANXXXXXXXXXXXXXXXXXXXXXXXXYAHIG-----------------------------------DNPSTSVHRLVRHL 197
264 9.000e-22UniRef50_UPI000DDA1720 RloB domain-containing protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DDA1720  ali  21  9.RKTETTLPYARFVIFCEGANTEPAYLHAYKDTLTRVLLKLKIEGGAGGPKTLAEKAIR--------------------------FKKGLRTSSGRGASSSFEKDDRVWVVFDRDEHLKVKETFDNC----QGARVGVAYSNPCFELWLTFHYEDFDKPIDRHKIQSHFETLCSSYSVKTGKNPD----------------------------CNEFIGRVSDAEKRASKTRQRRKDEGAEL---DAPFTNFDLL.... 201
265 1.000e-21UniRef50_A0A2G6NPM4 Abortive phage resistance protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2G6NPM4_9DELT  ali  21  11.RKKPLRDYRKLFIIATEGAETEPAYFAMFQSQSATVRVKLLDSRHKSSPKQVFARAREYIIKQGLRK------------------------------------GDSVWLVLDRDNWTVKQ--LHAVFLWCQESLFHLAVSNPCFELWLLFHFQNGSSVTSARNCREKLLRELPNFEKG-------------------------------HVEIKKLEPLVPIAIKHAEQ-----KDNPPCFDWPRSIGSTVYRLVKEL 194
266 1.000e-21UniRef50_A0A2W6YYA2 RloB domain-containing protein n=2 Tax=Pseudanabaena TaxID=1152 RepID=A0A2W6YYA2_9CYAN  ali  19  7KRNAPKKEVAKKILIACEGKHTERLYLKAIKQDLRLSTVKITILPHDGTDPLSVVNK-------------------------------VLDKRQDVKREGTWEKEDLAWAVFDGDEHQKDPNNWYQAIQKAKKENIKLAITNPSIEFWFLIHFQDYSANIPPDKAEKLLKKHIPNYDKSGCYYPEPLNN-----------------------------ERTSSAIARANKLDELAKR--DSLPEYSNPCSGISQLVE.. 203
267 1.000e-21UniRef50_A0A069ZJY3 Uncharacterized protein n=1 Tax=Porphyromonas sp. KLE 1280 TaxID=997829 RepID=A0A069ZJY3_9PORP  ali  24  14.RSIDTREIAIRFLIVSEDTKSSTDYFKALIKEVQAACSGSEVVGISKDS----VVEGCGMSTSRLLQEAKSIKSRRQIS------------------------FDRCWLVFDKDDFSDFNRA----IKEATDAGFDVAWSNESFELWYLLHFRYHHTAIPRDKCTKALEAEIQKY------------------------KPSFRYDKGNSSMHSILAEHQGQAIKYAEKLRNTYQ---DTDYSSHNPCTHVDRLIREI 214
268 1.000e-21UniRef50_R5RXA5 Uncharacterized protein n=3 Tax=environmental samples TaxID=2231195 RepID=R5RXA5_9BACE  ali  25  23RRNEGTRELFYSFLIVSEGTKTEPEYFRHFTSRRS----RVQVVGADPSTKKLLEEAL---------------------------------------RIRDLGTFDYKWLVFDKDD----NEDFNEAILLAEKAGFQCAWSNESFELWFCLHFIDLRTSVSRRQYIDILEREI------------------------RRHVPEFTYKKGGDVMYDILRGSQENAVLRAQNLRLAYS---GTDYASHNPCTTVDILVDNL 209
269 1.000e-21UniRef50_A0A0S9DX58 Uncharacterized protein n=12 Tax=Actinobacteria TaxID=201174 RepID=A0A0S9DX58_9MICO  ali  17  11KRPVAKLPERRTFLIFTEGEVTEVEYLKSLPEVKTANAVDLQIASQRGVPLTLVELAVEAQSK--------------------------------------NDEIDQIWCVFDV-EWPKHHPHLNEAKLLAQNHGIQLAISNPNFELWLILHHANTEGFLDNDGARRLRRDHDGVADKHLD--------------------------------HAVYLPLRAAATMRAIDLDAKHRNDGTKFPS-DNPSSGMHRLLRAI 200
270 1.000e-21UniRef50_UPI0009DD9BAA RloB domain-containing protein n=1 Tax=Asticcacaulis sp. AC460 TaxID=1282360 RepID=UPI0009DD9BAA  ali  20  19.RREIGRQPNKRILIVCEGTRTERGYFDPVIKSLGITGIDVVIRDDCGSAPISVVRHAEAI--------------------------------VKSEGSFKSGGYNYVFCVFDRDSHDTFEAAKSKIESLNRSERMCAITSIPCIEYWFVLHNAYTRSPY---------------------AAVKGKSVGDLCVEELKRNKVFEKYEKKSSEQIHYLIDNLQKALRNSRAALSDSKDTG-----EENPSTRVHEMFDFL 224
271 1.000e-21UniRef50_A0A1G3KST0 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_27_13 TaxID=1802173 RepID=A0A1G3KST0_9SPIR  ali  25  16.RKEKTRGIREYFLIICQGEKTEPNYFEKYKEKLHKNQISIKTLVNPLNPTKLLEYAVKIIKKYSNSNINYN-----------------------------------FWLIFDKDDFTN--QDFNDTIKNAKSQNIKCAYSNECFELWYLLHFNYYDTSLSRKQYGEKLSEQLG-----------------------------LEYKKEDKTIFDKIYEKQQNAIRNSKKLYNSYNHN---NIALENPSTNVFNLIEQL 204
272 1.000e-21UniRef50_A0A1G7Y945 RloB-like protein n=1 Tax=Nitrosomonas sp. Nm132 TaxID=1881053 RepID=A0A1G7Y945_9PROT  ali  22  9QRPLGKRRYKKLFLIVAEGVKTEPIYFGIFTDDTSIVRVSCLKGKHDSSPPQALKRMTGHLESEGL------------------------------------RPSDEAWLVVDKDQWSEEQLT-QLHQWSLQQENYGFALSNPKFEYWLLLHFEDGIGIASSRDCTDRLKRWIPDYDKGIDTRKISQAQ-------------------------------IDDAIRRAKKRDHPPCGDWPRSLGQ----TTVYRLIENI 195
273 2.000e-21UniRef50_A0A2X1UT72 Uncharacterized protein n=3 Tax=Oligella urethralis TaxID=90245 RepID=A0A2X1UT72_9BURK  ali  24  20..RKARRQAYDKILIVGEG-KSERFYFNDARNFHQLNTVTVQ--SLGKDPMRLVQSAIKEY----------------------------------EQSELIGDAYDMVYCVFDKDQHVEYKEAIAELNRQQPIGKWHAITSVPCFEYWLLLHFKYTTQPFNCASVIQQLTGFLPSYSKGLD------------------------------GLYHKLSDKMDKAIANAQKATIEARNNRT-----DNPSTLVYQVVKHL 205
274 2.000e-21UniRef50_K0KDV0 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=K0KDV0_SACES  ali  19  12RRKIATRPERKTIVVFCEGIASEPDYINGLKRLKGNTAINVEIDPDSGVPLTLVNLAI---------------------------------------ARSADREVDECWCVFDV-EWPQHHPNLRQAISLAREHGIRLAISNPCFELWLALHFQDCTAHQNTDVAERHSRRLDGRSGKRIDAAKYMPLRGKAAERAAAL--------------------------------AQRHERDETECPH-DNPSSGMYELLAAI 200
275 2.000e-21UniRef50_UPI000A055994 RloB domain-containing protein n=1 Tax=Komagataeibacter oboediens TaxID=65958 RepID=UPI000A055994  ali  19  5.RPIARRPQRIKIYIFMEGSNTEPVYFKSYERHVANSRIDLHCEKERGVPKTLLSLAKDKFSEISSKRYIRENGKN-----------------------------DQVWIVFDRDEH----EDVKYVLDTCKEIGIKTAFSNPCFELWLILHFVDYDKDEHRHQTQKFCESICIGYEKDKRKLPE----------------------------MSALMPNVENAENRAEIMEKRRSEDGAEAPL-----TTVYRLTKVI 196
276 2.000e-21UniRef50_F4L4R5 Uncharacterized protein n=2 Tax=Haliscomenobacter TaxID=2349 RepID=F4L4R5_HALH1  ali  23  1............MLIVCEGEVTEPEYFSLLRRMAIDAAIEIRPKPKVDENQTSSTRSPHKSTRPKRKLIPVAIPDEADPIEKKYDIKSQPSCWVKEARDGLKDDFEEVWAVFDDDGRNKTANAFQLAREKVSGKVVNIAFSSIAFEHWILLHFERNASAFKRSLCR---TGHQIHECGSSTSTDDCGGTHCLIGYLRHNHYLVPNSSTKKPGEISALFENRWIAYANAAWLRHVVPHDP-LKPYLVNPFSNVDLLVQRL 254
277 2.000e-21UniRef50_A0A2G8I849 Abortive phage resistance protein n=1 Tax=Prevotella intermedia TaxID=28131 RepID=A0A2G8I849_PREIN  ali  18  22..........PTFIIFTEDKVSERVYFKSFETD----KVKVNAIGNQKSKIANVINAITHCQQNALFDKSDNVAETGL----------------------------QVWCVFDRDYDSDSNESFDESLRTAEGHNIKVAWSNDCFELWILLHYEDHTEQLLRDKYYERLTKIMEA---DAELRKNFSKAIDTGHYNYKECFKRESNFKNHILPILQDKTRRTAAIERAKALENHHKKD-NVKPHEMCPCTMVHHLVEEL 242
278 2.000e-21UniRef50_A0A2T6DL94 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium LW23 TaxID=2161867 RepID=A0A2T6DL94_9BACT  ali  19  20..........RRVLIVCEDTKSSCYYFESFP--YNKSLVELKILGTGSNTDSLMTEAI----------------------------------RLKNEAYQHKRPYSKVWVVFDRDSFPKSNYSRAFDLARAHSE-VEACWSNECFELWYLLHFQYQNAAIGREAINRKLSKLLGA-----------------------------TYNKADKTIYSKLTELQPIALKNAKKLAFEMQHY-------DNPSTKVHELVDEL 195
279 2.000e-21UniRef50_UPI000D6B520A RloB domain-containing protein n=1 Tax=Chryseobacterium oncorhynchi TaxID=741074 RepID=UPI000D6B520A  ali  32  2......RPIFKSLTIFCEGTVTEPQYFADLREEVQKKVPDYVIEISPIPPIQNYEEENEQSYKRPAAKRRNIIEVEVEPQHNPLDFKAQPLEYVWKARESLKVHG-EAWAIFDRDEHPALEEAFELAKQPVDAKLVNIAFSSRSFEFWLLLHFEKRLLPFSKTTKGKNAKKKDKYHECGEDKGNELDCKGEVCITGYLKENDFIAKDSKNSRFKEAFKDNVYIAIKNAIELRSKIGYRGTHAIDTLDPYTDVDRLVFKL 265
280 2.000e-21UniRef50_A0A1U9WXF2 Uncharacterized protein n=2 Tax=Planktothrix TaxID=54304 RepID=A0A1U9WXF2_PLAAG  ali  20  31.......ETRKRLLIVCEGQETEPNYFNSLYKNLNKIHLYIQVKGAGRVTLSLVEKAIELKNE--------------------------------------DGEYNEVWCVFDRDSENNNQQNFNRAIALALKENIRLAISNDAFELWYLLHYEYYTSATHRNNLSQKLEERLGKKYEKNLDLYEQYLKQRQQTAI-----------KNAENLWKDTSSDTTKAIYFDKQHPENFPEITDQLIHEFNPSTTVYSLVQRL 241
281 2.000e-21UniRef50_A0A1H5FD67 RloB-like protein n=2 Tax=Amycolatopsis lurida TaxID=31959 RepID=A0A1H5FD67_9PSEU  ali  17  2................CEGKKTEHQYFSRIAAFFRASSVNVATCDIEGMGKDPV------------------------------SVVKRAIEKRDKAAKNVDEKYSQVWCVVDVDEHKNLEDALLL----AKQNRIGVVVSNPCFEIWALWHYEDHNAHITTKAVQRKLKRWIPEYDKDLPGNFPYANCDEAKKRAVARQKNTEGSISQNPGSAAWL---VVDAVKRAKSFN........................... 180
282 2.000e-21UniRef50_A0A1D2QWD0 Uncharacterized protein n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_86-2 TaxID=1849364 RepID=A0A1D2QWD0_9EURY  ali  21  13..KTHPIKPRRFVVIVCEGAKTETQYFNGFNE--RNSGVKIVPLYENCNGPKSIVESAEKQIDK---------------------------------YDLNLDEGDGLWCAFDVDENTNDMIAYAVKIA--DENNIRIALSNPCIELWFLLHYPWSYNWLTRKEAFKELKGFIK------------------------------DYDKNYPEIYSMLKDKLPTAIENAKKLDRIHEKNNIKLISESTPSSQVFKLIESI 204
283 3.000e-21UniRef50_A0A2N6EA71 Abortive phage resistance protein n=6 Tax=Bacteria TaxID=2 RepID=A0A2N6EA71_9DELT  ali  24  2............FVLATEGAETEPRYFKIFEDGDKVIHVQLLKGGHKSSPPQVLKRMDAYLRKEGL------------------------------------RPEDEAWLVVDTDQWTELQLQQLYQWGQTKEN-YGLAVSNPQFEFWLLLHFEDGNGVRTSRECVERLLRQIPGYQKGAFDAK-------------------------------QFASGIANAVDRARRR--------DTPPCQDWPGTTVYRLIERL 175
284 3.000e-21UniRef50_A0A1J5TST7 Uncharacterized protein n=1 Tax=Bathymodiolus thermophilus thioautotrophic gill symbiont TaxID=2360 RepID=A0A1J5TST7_9GAMM  ali  27  13.REPPTKEDYDRVLIVCEG-KTEVNYFKELIGYLKLSTVNIEILDIKQTTPDSLFNRAKELY---------------------------------RASKKQGNPFDRVYCVFDKDGHAKYQQTKSHIDQVTPKNTYYYAFSEPCFEFWLLLHFVKTDKPFSN----------------------------FDDLKKDKKFKQYFPNYDKSENIFNNLQDKVSIACQNAK----------------HNPHTNVDELIDYL 192
285 3.000e-21UniRef50_A0A2W5NXE1 CRISPR-associated protein n=1 Tax=Novosphingobium pentaromativorans TaxID=205844 RepID=A0A2W5NXE1_9SPHN  ali  25  21.RKGPSVKAGKRLLIVCEGSKTEPAYFKAMRKDLGLTGTDVRVCGEE-----------CGTDPISVLEFALELWSE-------------------------DRGFDEIYCVFDKEGTPERKLKYDQACERIKNKDIVAIRSVPCFEYWYILHFNYHDAPFS-----------------------GAGKKSAGDMVVDMLKRKIPRYEKSDDSVYDLIKDDYKKARKAAIR-----SQAAADAAQTDNPTTNVHLLVHSL 220
286 3.000e-21UniRef50_UPI000463AAB3 RloB domain-containing protein n=1 Tax=Clostridiales bacterium VE202-01 TaxID=1232438 RepID=UPI000463AAB3  ali  27  20...ENRQPHAHSYLIICEGKETEPNYFNGLNTKIQKKIGGQIKIE----SIPIIDVIGEGQNTTSLVNIVEKRVKEAKII------------------------YENIWIVFDKDDF----EQFDKAINEAESKEYKVAWSNECFELWLLLHFCYIDSALSRKVLFQKMTEIYNDYG------------------------YNHNYQKNDPNIYKFCSESVKNAIGNSKRLMSNYK--PSLSPSKCSPGNTVYQLVEEL 219
287 4.000e-21UniRef50_W6EDF4 Uncharacterized protein n=3 Tax=Sulfurospirillum TaxID=57665 RepID=W6EDF4_SULMU  ali  21  22KRTIATKEQIPDIIIACEDEASAPTYFKALIGQLRESRKI----------------------------TPDSFVIAKHTNTHPTGILEDLKKHRCKFSGKSYKDFKHKWIVIDRDKEHHSPEDFNSALAQAKSLKVDVAYSNDAFELWYLLHFNPRETAILRDELLTQVIEKLQARNESKFGQLDKDTIKQAV---------------FTKLIFDELQALQETAIKNAERLMASYEVAHN--PENDNPSTTVHVLVKLL 240
288 4.000e-21UniRef50_A0A2G2M2D3 Uncharacterized protein n=1 Tax=Alkaliphilus sp. TaxID=1872455 RepID=A0A2G2M2D3_9CLOT  ali  27  25.....KLAQPEKYLIICEGEKTEPNYFEGIKKK----------IEEKYDRRIHIETEGTGRNTLSLLEYAKAFVVS---------------------KSKNGELYDHVWLVYDLDDFPRDNFDNKVNAADEDSPKWHVAWSNQCIELWFLLHFNYYNSNISRREYFEKLAEIFKDRAET-------------------------KYEKNDQKVFEFLSEHLEFAINNAKRLCEESK---GKSPSQMVPATTVYKLVEKL 230
289 4.000e-21UniRef50_A0A2A3Z090 Uncharacterized protein n=2 Tax=Brevibacterium TaxID=1696 RepID=A0A2A3Z090_BRELN  ali  18  14KRTTETKAVRATFRIYVEGAATEPEYISALSRLPELAAVEVLIEETGAVPSTLVDSAC-------------------------------------EDKRRNDLDIDQYWCVFDVESPVPHPNLKGAMIK-ARDNGVATAVSNPCFELWLVLHHAAQTAFLETDQAISI--------------------------------RNAIDQSDGKHLAAADYMNRRTEAVRRAKSLEKRHRNNGTDFP-DDNPSSTVYKLLEAL 204
290 4.000e-21UniRef50_A0A285PY66 RloB-like protein n=1 Tax=Marinobacter sp. LV10R510-11A TaxID=1415568 RepID=A0A285PY66_9ALTE  ali  20  4QRGRSVRQVKSRVYIFCEGKKTEPNYIRAYIKMFYPACARLKDAEKPVTLQDTVKNTPKQLVNEAVTFSKSLDFKK-----------------------------DQVWVMYDRESPAKYDDNHGQAWLNAKRNGVHVALSNVCFEYWLLLHLTETSQPANSFDDL----------------------IGTVAFKSAFREIGFSNYQKGEARVAEELKDRVENAKSRARRINKQAQAPDIELPYRLNPYTNVYEVLDAI 218
291 4.000e-21UniRef50_UPI000A0515E6 RloB domain-containing protein n=1 Tax=Azospirillum sp. B4 TaxID=95605 RepID=UPI000A0515E6  ali  20  20.RVSPSREPLSRILIVCEGSKTEPNYFNALAKLHRARNVKVKGSGDVFGTDPCNVLSLALEYAK------------------------------------HDGPYDHIYCVFDREGTEERKKNLEIGRRKRGTIKITAIKSNPCFEYWVLLHFEFTTKPF-----------------------VAEKGRSCCDALVSKIKEHIPEYNKGKIDLMSQLVNNAEVAIQRSEESLSLSRGDGSE-----NPSTYVHLVAKKI 221
292 4.000e-21UniRef50_A0A258AQ04 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AQ04_9BACT  ali  21  48............FLIVTEGTVTEPVYFDLLLDEMKLARAHVKVIPGDKPDPKRVIQTARRMVRELAERASKDQLKFGEP-----------------------PAFEHVWAVIDTDKAVQ-EETWDEVMQLASNEAVQLAASSPCFEFWLLLHLSDSTAPINGKKAKSVLERKLK--------------------------MAYSTNAKVARAATETFIKQWPKAVNRARRVKEQHIKAGTALPA--DPSTDLDLLVRAL 243
293 5.000e-21UniRef50_B5GEZ0 Uncharacterized protein n=4 Tax=Streptomyces TaxID=1883 RepID=B5GEZ0_STRSH  ali  21  14.KPRARRQEHRKFLVVTEGTRTEPQYFENLAALLNAKAVQVVKVKPVGIG-------------------------------RDPASVVKEAERRRRQERKGGDPFDEVWCVVDVDRHETLPRACKE----ARDLGIEMAISSPCFEIWLLWHFESRTRWIDAGELKRLLGKQ-GFADKNVPENFPYGEHGLAAGRAAACEPIVHPH..................................................... 182
294 6.000e-21UniRef50_UPI0005001A4E RloB domain-containing protein n=2 Tax=Clostridium botulinum TaxID=1491 RepID=UPI0005001A4E  ali  22  15...RKRKKANPTIVIICEGKDTETMYFDNFNSKYTKVDVRIA--------------------------DKNSKGKNKGKATDPENLVRKAIEISKKDYDINEKDGDRVWCVFDVDINYNNNNATQSKIDESNKNKIRLGISNPCFELWYLLHFEYTTANLNYDDVKKRLDKHISNYNK-------------------------------SKNVYDELKDKLTIAISNSKKLKKHHESLNKILPVKSNPYSNIYDLVEY. 234
295 6.000e-21UniRef50_UPI00037A4E74 RloB domain-containing protein n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI00037A4E74  ali  20  23QRLRGVRDLEKRFLIVCEDDKSAPNYFNALKKHYNLTASSIRIAGSGGKTQ-------------------------------PIQVVERAIEIKEMNNKTEDEPFDQIWCVIDGD----YGSKINNARNKAKANDIKLAISTKCFEYWVLLHFEENDTAMDCDGMVHVLKDHLTDYQKG-------------------------------SCDFCEVVTRATEACTRAEKLRKPGIDRGD-KPEDQNPCSEVYLLVNAI 215
296 6.000e-21UniRef50_A0A1G0CJ41 Uncharacterized protein (Fragment) n=1 Tax=Gallionellales bacterium GWA2_59_43 TaxID=1798245 RepID=A0A1G0CJ41_9PROT  ali  23  11KREVEKLKPKVEIIIVCEGKNTEPQYFEECVDYYGAGLVSLRVIAPAGVPITLVRAAITERNE--------------------------LLRRMRSTRDSYGKCF-RVWAVFDRDMHPSVEKAIQLAL----DNHIDIAFSDPCFELWPLLHLMNYGAMSDRHALQALLATHMPKYDHAKGAIIDCQRQIE.................................................................... 170
297 7.000e-21UniRef50_X1UPZ0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1UPZ0_9ZZZZ  ali  21  23RRRYAFRPQRERILIVTEGERTEPNYFEGFKTIIPRGILHVEVIGTGFNTKKVVKEAQDK----------------------------------RDDKRGIDIEYDQVWVAFDKDDFPNKNFNDAVFL--SEADNIGCAYSNESFELWYVLHFQYLDTAINRRQYIEILEGILGHPYRKNDPNIFFELQSKGN.................................................................. 179
298 8.000e-21UniRef50_A0A1H9KF35 RloB-like protein n=2 Tax=Lewinella agarilytica TaxID=478744 RepID=A0A1H9KF35_9BACT  ali  21  6KKHRKAIQRGKRFLIFCEGQ-TERLYFKSFHD--------------------------------------------KGVSVEPRDPNGDRKQLVKDAINSDDGSYDQIWVVFDLDYLPAKGNAFDATISKARAAGIRVAYSVDAFELWFCLHYAYVNTRQERAYYYQQLSKRWSINYEREGKKAKFCLGIRALLENDEAASE-------------------EEAIKRAKKLLATHSEE---PPHRQNPVTTVFELVEEL 201
299 8.000e-21UniRef50_A0A246RTS7 Uncharacterized protein n=2 Tax=Micromonosporaceae TaxID=28056 RepID=A0A246RTS7_9ACTN  ali  25  25RRRPASREQRTTVLIATNGESTERDYFNGLKQE-PWVRPRLVVVAERGSPVNVVRGA---------------------------------------ARRRERDDFDEAWAVCDVDDFATEPAAREAV-----DSDVKLAWSNPCFEVWLLLHYESCTRFVNAKRARDLLRAHDPDWDKTALD-------------------------------FAKFRDRIEDARRRAEGLD---------PAPEGNPSTSVGQIIDML 199
300 8.000e-21UniRef50_I0KHH0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=I0KHH0_9BACT  ali  20  33.RPEPNVPEFVRLLIVTEGVNTEVSYFQQF----RMPNMQVRAVGTGYNTVSLVRRAA----------------------------------QIREEEANKGNEYDQVWCVFDKDDFSPEDFNEAVRLAEGMFGAECVAYSNQSFEYWLLLHFLDHQGAMHRRQYDIRLNECLQPYGITYDGSKSKRISIDFFDLMLAVDPQTR-------------KRRIDQAISRAERVFDQYDHR---SPAFEESSTAVFRVVNVI 237
301 9.000e-21UniRef50_B2J7R1 Uncharacterized protein n=7 Tax=Cyanobacteria TaxID=1117 RepID=B2J7R1_NOSP7  ali  26  7.RRPPSRNIAQKILIACEGSKTEPIYFNSIRNELRSSTLDIIVLP-----------HQNKTDPRSIVERLIEERQQRKDNQQW-------------------SKEDEAWAVFDGDEHIEKSENWQSAINRATSQKINLAITNPCFELWYLIHFQDHFAQINRDRLVNLLGKHIPNYDKS................................................................................ 155
302 1.000e-20UniRef50_G7I211 Uncharacterized protein n=2 Tax=Corynebacterium casei TaxID=160386 RepID=G7I211_9CORY  ali  22  7RRKTNNRNYRTQFVLAVEG-KTEKAYFEQFKGHISE--VQLMVNTGKGSNPTAVMAQADRMLE-------------------------------DLRSKGSLRAGDQAWCVIDRDEWEDDQIQ-EIWSWASQRGDRGIALSLPQFEWWLLLHFEDGTGAGTRKEILDRLNRYIP------------------------------DYQKGSSSQLPNENEQHKEAIRRAKKRIPSELTNFEDLKDLGGSWTTVHLLTEKI 200
303 1.000e-20UniRef50_UPI0008FBA20F RloB domain-containing protein n=1 Tax=Polynucleobacter asymbioticus TaxID=576611 RepID=UPI0008FBA20F  ali  27  17.RKAGNTPPKEVTLIVCEGE-TETKYLKAICQSLRLATATIYVCGNGTDS-----------APVNLVNKAEQL-------------------------NLTNDGYDHIYCVFDKDIHESFDRAREKIRRTKKPLPIKEAISIPSFELWVLLHFEQTDRSFTSAEVVRYISNQ----------------------------NHIRAYKKADDLICQELITRLEIAITNAGWLERR------GHTSNENPMTNVHKLVQHI 208
304 1.000e-20UniRef50_A0A0S2P4A2 RloB n=5 Tax=Streptomyces TaxID=1883 RepID=A0A0S2P4A2_STRHL  ali  19  20RRRPAHRDPLPPILVVCGAKNTEPAYLRGLLASVDNRAVAVKIKVCDQDPVSVVRHTVT-------------------------------------ERDRAGDHYHQAWCVLDVDEFAHLDEALRLAA----DEDVEVALSNPCFELWLLLHHRDHRAEVGYQQAKRHLVAHHPGYSKAVREF-----------------------------DFGRYRGGWPHAVERARELAKKGEEAKT------NPSSGMWRLVREI 203
305 1.000e-20UniRef50_UPI00098D5AA3 RloB domain-containing protein n=1 Tax=Spirosoma sp. 209 TaxID=1955701 RepID=UPI00098D5AA3  ali  20  39...........RLLIISEGVNTEVSYFRQFEQ----PNIRVKAVGTGFNTVSLVRRA----------------------------------EQIRADEAAKSRHYDQVWCVFDRDDFPSQDFNEAVRLAEQLFGPGRVAYSNQAFEYWLLLHFLDHQGAIHRRQYDARLNECLHPFGVRYDGQDSKRIGSDFFDLLLSVDPKTD-------------KPRIRQAIERAERLYGQYDHS---SPATEESSTTVFRLVKVI 233
306 1.000e-20UniRef50_A0A1F4KGR3 Uncharacterized protein n=2 Tax=unclassified Burkholderiales (miscellaneous) TaxID=80841 RepID=A0A1F4KGR3_9BURK  ali  23  19QRQKQERARNKRYLIVCEGTKTEPHYFLELREDLGIRPQMVRVAPNDGVSPDRVVDHALALYKEDAV---------------------------------GGDVYDTVYCVFDRDRHTTFDAAVQRTKASAAGTPLVAITSTPCFEVWLLLHFGYTDQPFHCA................................................................................................ 149
307 1.000e-20UniRef50_UPI0005C6537D RloB domain-containing protein n=1 Tax=Lewinella persica TaxID=70998 RepID=UPI0005C6537D  ali  22  6RRHRKAISRGKRFLILCEGQ-TERLYFKSFHD--------------------------------------------KGVSVEPRDPNGDRRQLVKDAINSDDGSYDQIWVVFDLDYLPAKGKEFDATILKAQEAGIRVAYSVDAFELWFCLHYTYVNTRQERTYYYEQLSKRWSVNYEREGKKARFCLGIRELLEKDEAASE-------------------EEAIKRAKRLLQNH---DGMPPHSQNPVTTVFELVEEL 201
308 1.000e-20UniRef50_A0A2D5Y212 Uncharacterized protein n=1 Tax=Micavibrio sp. TaxID=2024841 RepID=A0A2D5Y212_9PROT  ali  18  27RKNTETKTSRNRILIVCEDSLSSPHYFDAMIRDYNLSGTDIRIYGEGGSAPSSVYSDAERIYRE------------------------------DAEKYGEDNTYDKVYCVFDKDQHADYDDTIEKCKQSTK---IDAITSVPCFEVWLLFHFIDSEKPLENGEATKKLKEHIKKYDKANLIN----------------------------TYHDQLKNKTNTAIKNSESVMKRVTKAET-----DNPSSHIHILVKHL 220
309 1.000e-20UniRef50_A0A1H9GC60 RloB-like protein n=1 Tax=Lewinella agarilytica TaxID=478744 RepID=A0A1H9GC60_9BACT  ali  24  3..RGKQRRTRFALLIVCEGEQTEKHYFQSFKSD----KLHLDVRPYVGQPRQIVLRAESLMARKS---------------------------------------YDEVWVVFDLDYDASQYQEFEKAIKLAKEKGCEVAYTIDAFELWFRLHYERITSSLDRKALYKDLSKRWSINYEKDGKRADFAKAIPQRLSADEAADVM-------------------KAIDRAKAM---FHKRGGLPLVDRNPITTVHLLVERL 198
310 1.000e-20UniRef50_A0A2W6PN55 RloB domain-containing protein n=1 Tax=Streptomyces sp. SW4 TaxID=1453555 RepID=A0A2W6PN55_9ACTN  ali  19  11RKAYQRRDPNKRFLVYFEGAETERLYINGIRKLLREARAPIVIDPGNRNGNPLEIVRGAK---------------------------------KRKEESRQTDPYDAVWCIFDVEA-PEPHASLDSALKLARAADIQCAVSNPCFELWLILHLKDCNRHYTTKKICQLAEQEIDSYSSKVF-------------------------------NFDDLASGIPGAVDRAKVLDGNYPPHAHCK--QKNPWTSMWKLIQFL 202
311 1.000e-20UniRef50_A0A2I7YQY3 Uncharacterized protein n=3 Tax=Actinoalloteichus TaxID=65496 RepID=A0A2I7YQY3_9PSEU  ali  21  2..............VVTEGKVTEPTYLTELRRRLRATGVSVSVVPGKHSDPSRVV---------------------------------DTARTQRDNAKRAGEAFDSVWCVVDVDDHRGLADA----IRDASRARLKVAVSNPCFEIWLLWHCEDQTGAISSKALRKRVERYLDG--KRLLPTFPYGAWGEACRRAAMDNPAVPP...................................................... 153
312 1.000e-20UniRef50_B9Z8H9 Uncharacterized protein n=5 Tax=Proteobacteria TaxID=1224 RepID=B9Z8H9_9NEIS  ali  23  4KKSAVQRKLQAVLHIYCEGAKTEPNYINSYLQETSPGNRRKNVIRVEPT--------------------------------KKNTPVQLVDEAVKHKKSPTCPKSDIFWVVFDRESVAKYPDALAEASQKAKSNGINIAISNVCFELWLLLHFQENGSPYSSYADLSKLKEHLKE-------------------------KGIHEYDKANASIFDSVKGGLDSARKAAKKMNAQSADPQRTKPYQLNPFTEIHLLLDAI 212
313 2.000e-20UniRef50_A0A1W7D6N4 Uncharacterized protein n=1 Tax=Streptomyces sp. SCSIO 03032 TaxID=1109743 RepID=A0A1W7D6N4_9ACTN  ali  19  2..............VVTEGTRTEPQYFDGLCAHVRATATQVVSVRTVGVGRDPVRVVREA-------------------------------EQRRAEEQRKGDPFDEVWCVVDVDEHRNLEQALAL----AGKRGVATAVSNPCFEIWVLWHYEDCVAACTQEELRRRLKRH-GFSDKNVPRNFPYAAYPDALRRAESPPRC......................................................... 153
314 2.000e-20UniRef50_A0A1V5YZN7 Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium ADurb.Bin170 TaxID=1852848 RepID=A0A1V5YZN7_9BACT  ali  22  10.RTYGQRSYKKLFVIATEGKKTEPAYFRMLADSSKLVKIKCIKGDAKSAPGYVLKRMVLCLQEEDLQK------------------------------------GDEAWIVIDQDQWEEHQMETLFVWEKATENR-GIALSNPNFEYWLLLHFEEGTKLAHAEDCSRRLKKYIPGYDKGIDPGHFTSEQVRQAVERARARTKGKPAACFGSTSVYRLVENILTA................................... 195
315 2.000e-20UniRef50_UPI0003A54033 RloB domain-containing protein n=1 Tax=Actinoplanes globisporus TaxID=113565 RepID=UPI0003A54033  ali  20  10.RPGSILPERRAVLIVIGADRTETAYLKGLRTHDRLGAVTMKIVEKAAAPDRLVEYT---------------------------------------RATFTLGEYDEVWCVTDVDHYERDGGKVTAAVALA-GDDIKLAVSNPCFELWLLLHHEDCAAHCGCREVHARLRKHLPQYDKTRL-------------------------------RFGDFAAGLDEALHRAEKLGDDHT---------RNPSTGVWRLV... 185
316 2.000e-20UniRef50_A0A1Y0IM18 Uncharacterized protein n=1 Tax=Tumebacillus avium TaxID=1903704 RepID=A0A1Y0IM18_9BACL  ali  24  10KRGARRVQPLKTILIVCEGSKTEKIYFERFKE--RDSGVKIEVPTNKFTDPVNLVKFA---------------------------------RDYAKKHDISVAEGDSIWVVFDVDQ--NRDEEITKAKALADDLDIIITPSNPSFELWYLLHYEPSTAHLTNEQLGKKLKKCIPHYAK-------------------------------NICVFDEIAPTQKLAIKRAGDLNAHHTG-KNLYSRSSNPSTQVFRVVVHI 199
317 2.000e-20UniRef50_A0A1J5TXK4 Uncharacterized protein n=1 Tax=Bathymodiolus thermophilus thioautotrophic gill symbiont TaxID=2360 RepID=A0A1J5TXK4_9GAMM  ali  20  8.....KRHIRKSVLIALEDTKSSKYYLQALTKDKRIALQVEYAKHRGSDPRNVLKAIEKHKTNV---------------------------------------PFEQKWIVIDRDEHQ--QENFNSTLAQANKMGVKVAYSNECYELWLLLHFKEVTGYITRHEIRSQLDQEFIKA-------------------------FNCTYKKHEKDVYGMLIDRQNMAISRAKKLINKLDEDGELDPYNNNPSTTMYKLIEYL 197
318 2.000e-20UniRef50_A0A1H9LQT8 RloB-like protein n=1 Tax=Lentzea albida TaxID=65499 RepID=A0A1H9LQT8_9PSEU  ali  28  13.........................................................................................LVRYAARVRENDRGGFDEYWCVVDVDEF-----DIHEAIAEAEAMGISLAVSNPCFEVWLILHFADCAAGISSKAAAEKLRRHLPGYAKGTLD-------------------------------FALLAERVDKAVERAKAL------------SPGNPSTDMWKLVE.. 133
319 2.000e-20UniRef50_A0A1Y2K0H7 Uncharacterized protein n=2 Tax=Magnetofaba TaxID=1472292 RepID=A0A1Y2K0H7_9PROT  ali  18  8KRKKASKKPGQRFLIVCEGEKTEPIYLEDVKRALRLPSAKIEI-----------TQCLKGTAPIQIVAYAEKLFVEGDS-----------------RRRIPAREWDHVYAVFDRDAHQSYFNALSKITSLHNQRMFTAICSVPNVELWFLLHFHDQLAPLNRDAALKALKKFLPKYEKGMGGVYDATYRSLPLAIRRARRLRDAGY..................................................... 194
320 2.000e-20UniRef50_A0A2D5JGC5 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2D5JGC5_9PROT  ali  19  13.RNTKTRYSGDIVLIICEGTQTEPNYLIELKDFLYLDKAAIHIVPSEGSAPNSVVKHAK---------------------------------DAIKGACNKGNPYSKVYCVIDKDQHPTYIKDFNESTRKKCDTIICPITSVPCFEYWILMHYSRSTQSF-----------------------GTSGHSPCGQLIRTALRTHIEGYEKADRSLAKKLIEKLEDARQNSAATYKAAQSAGT-----DDPSTKMHLLVDEL 216
321 2.000e-20UniRef50_A0A1I5ADH6 RloB-like protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1I5ADH6_9ACTN  ali  20  18.RGRATRD--RQVYIYTEGEVTEPEYIDIIVRK------GLWDRPDRKVQHHIANENAESKYRKPYRMVQEAVRTRIKAEGEARRAGLKPYEVHQDGTEEGDWNWPQVWVVFDRDDHQGIPEAMTL----ADDEKIHVAYSHPCFELWRLLHYTNYTSTFGCGDANSRLRSRAGFAGTYGPGVQRVSEQESKHLREDQVLSEDGH--------------RYESARKYAKKINEYHS---TPNPNAWDPYTNVWCLVEQ. 247
322 2.000e-20UniRef50_A0A1H6KFX8 CRISPR-associated protein n=3 Tax=root TaxID=1 RepID=A0A1H6KFX8_9GAMM  ali  28  13.RKNATRESYDRVLIVCEGKETEINYFNKLIEDLKLSTVNIEILDIKQTTPDSLLRKAKELYEGSIGK---------------------------------GNPFDRVYCVFDKDGHTKYQETKNTIEQIKKKGVYYYAFSEPCFEFWLLLHFTKTDRPFTNFDELRK----------------------------DKYFKEYFPNYKKSEIIFNDLKAKIPTTCQNAKN----------------NPHTNVNELVNYL 194
323 3.000e-20UniRef50_A0A140DSP5 Uncharacterized protein n=4 Tax=Faecalibaculum rodentium TaxID=1702221 RepID=A0A140DSP5_9FIRM  ali  22  49KKRLARQDYAKLYLILTEGTKTEPYYFEGFKKAVES-----------CHPEILVEIIGVGKATTKLLEFADEFIEEFSVHNA------------------------ELWLVTDKDDFQADHFNKLVSECLRRDNWWHAAWSNECFELWFVLHFSFYQAAATRTEYYKILKEQFRKHRLGSWKKNDPEIFRIMTCKGNPRL-----------------------AIHYAKKL---HKEKQGQIPSSVRPCTTVYALVEEL 252
324 3.000e-20UniRef50_U7QRS2 RloB-like family protein n=26 Tax=Bacteria TaxID=2 RepID=U7QRS2_9CYAN  ali  27  18.RKIAVRDLKERFLIVCEGEKTEPNYFKSFP-----------------IPEEWLDIYGIGDNTLGIVRKALLLKKEGN--------------------------YDQVWCVFDRDSFP--AQKFNRAIELAGKNNINIAYSNEGFEIWYLLHFNFYDTAIPRREYKRMLSQLLDHRYQKNSETIXXXXXXXXXXXXXXXXXXXXXY--------------------------------PSPHPVRDNPSTTVHLLVEQL 199
325 3.000e-20UniRef50_A7BT95 RloB n=1 Tax=Beggiatoa sp. PS TaxID=422289 RepID=A7BT95_9GAMM  ali  30  31................................................................................................ARYKKNTDYDRVYCVFDKDKHTTYQKALQKIRRLPKKGKLYATNSVPCFEYWLLLHFVYTTRPFHANGKKSICEQVIVELKE-----------------------HFPNYQKGNQGIFEKIKDKTDIAIQRTKQVEQYHKDNATET---DNPSTRVYELVQYL 169
326 3.000e-20UniRef50_A0A1G7VCP0 RloB-like protein n=2 Tax=Sinosporangium album TaxID=504805 RepID=A0A1G7VCP0_9ACTN  ali  26  25.............................................................................................VRDQRRGRGAAYDEYWCVFDIDEHPNLGQAMELAVAHD----INLAVSNPCLELWFLLHRQEQWASLDRREAQRQVRELLGFAKV------------------------------PSQAALESLTERHDQAMKRAQALDGKH--AGDGSPSRANPSTDVWRLIERI 154
327 3.000e-20UniRef50_UPI000CD5BC22 RloB domain-containing protein n=1 Tax=Streptomyces TaxID=1883 RepID=UPI000CD5BC22  ali  21  10.RAGRRSPEKRRVLVYCEDECAGRQYFLGLRAELRYHPVQIAIGDGCGEPL-------------GLVRDAIAHRKRAPTSP-----------------ADRRSGYDEVWCVIDVESPP--HARLHEALALARGENIRVALTNPCFDLWILLHFSDVTAHVLPQAIQKRIETETACGFTARRKHLR----------------------------FEALEGRHDGAAERAQSIRARAESVGRAGPLLANPWVEVDLMVAEL 207
328 3.000e-20UniRef50_F5UGE5 Uncharacterized protein n=2 Tax=Microcoleus TaxID=44471 RepID=F5UGE5_9CYAN  ali  26  5KTKIKSRQLKQTIYIVCEGTNTERIYFEAIGQQ------------------------PDVFEKYDITVYPSEEDQRKASTKEGESIKTDAVNLVKRAKEEINNNYNEVWAVFDKDGYTKHEKAFD----DAQKHGIKLGFSSIAFEHWILLHYEQNGTAFPKSQ---------------------------NVIDYLEQAGYFTGYSKKDISIYPRLQHLTQTAIENAAWLRMEMAKNLDDKIYELNPYTTVDELVMKL 212
329 4.000e-20UniRef50_R7MAZ3 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:567 TaxID=1262820 RepID=R7MAZ3_9CLOT  ali  28  11RRNTEKRKRNPFVIIGCEGKKTEKIYFNNFNSR------------------------------------QCIIKFSKGNSTDPIGIVQDLINFIK-SNEIELEENDKVYAVFDTDVGQNKKQRIEEAKSLAAENGVEIITSTPTFELWFLLHFGFTTKVFSNKALKEELARKIPNYSKI-------------------------------NNTYLTVKDLTGQAIENAKRLEQYQLKEGQALDSECNPYTGVYKAVEEL 204
330 4.000e-20UniRef50_I2F0R7 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=I2F0R7_EMTOG  ali  23  33.RPVAELTEKPSILIVCEGENTEPSYFNQF-----------------RITSAKVKSVGEGYNTISLVNRALALSQQGN--------------------------YDQVWCVFDKDDFN--ENDFNSAIQIAVANNFGIAYSNQSFEYWLILHFNDHQGGMHRDSYNDKINEHLKPFKVTYDGNGTKLIEEDFFGLLDGIDDKTSRK-------------RAELAIDRAER---NYNHFDHTNPAREESSTTVFRLVREL 230
331 4.000e-20UniRef50_G2T430 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=G2T430_ROSHA  ali  20  35..........PYTYIVSEGTKTEPYYIEAMAQVINEKYREF-------STGKFVVVEGTGRNTKGLLEYARANVARNFPQAEV------------------------VWLMYDKDDFPLDNFDNTQYSAEGKKREYRVAWSNECIELWFLLHFQELSVNVGREKYRELLK-------------------------------GYCQYEKNMKSIYDVLRDKTPIAIARAKR---QYEAYGDTAPSQRCPATRVYQLVEEL 220
332 4.000e-20UniRef50_A0A1F3BY34 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3BY34_9BACT  ali  21  12...TRKADSKPTFIIFCEDEVSEPIYFKYFET----PNIQVNPIKNQKSKVDNVFKAICYCENNDLMTKKGTKSFLKNKNP-------------------------QVWCVFDRDLENEDPKSFDESINTAKSKGIKVAWSNDAFELWILLHFEDVDDNKNRITYYNRLTEIFKS-----LKNPNNDLIKVLTHQSFSYKQDFKHENNFRNIVRPEIVGKTKIAIERAKKLEKHFKS-PNIPNHEKAPCTLVHHLVEEL 242
333 5.000e-20UniRef50_A0A1G0Y7M5 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium GWF2_57_35 TaxID=1798576 RepID=A0A1G0Y7M5_9BACT  ali  23  9RRQIGYRKPKKHFHIATEGNETEPRYFE-LFKTTREDEIQLKIIPSKHKSRPLQV-----------------------------------LEHLKLHVAKNGRKGDEAWLVIDRDAW--DEAELNDVFREAQSYGYEVALSNPCFELWLYLHMRDNRLFANRHQCQDMLQDVLDGYD----------------------------PNKKSTYKTECLLPNVDMAIQRAQGL-----DLHPNDLWPRNQATRVYKLIHRI 196
334 6.000e-20UniRef50_R6VZB4 Uncharacterized protein n=13 Tax=root TaxID=1 RepID=R6VZB4_9FIRM  ali  22  9RRSFGSRKRNPVVYLICEGSETEIRYFKKFRS--RECHIDIVPIPSQYKSADKLVQKA---------------------------------RSTIAMNPYYPDEGDIIWCVFDCDDNTNQMLAKAKQVAI--KEGYKLAFSNPSFEVWFLLHFNNQITPVENCDAAIKLLKQKGR---------------------------LEQYEKNK-NVYDQLKPLQALAIERAKNRVSVLKEEHTEIISRQNPATTVAELVEYL 203
335 6.000e-20UniRef50_A0A2X4DNM5 Uncharacterized protein n=2 Tax=Clostridium perfringens TaxID=1502 RepID=A0A2X4DNM5_CLOPF  ali  22  3RRKGKKKELNNKILIVCQG-ITEYNYFEKFRVDLAEVSVAKCDTG-----CAKIVSKKCTESPKRVVEYAIKISK--------------------------DTKYRMIWCVFDKDTFPDFEEA----ISLAKKNGISCAFSNKDFELWFLMHLKKQHTHISDDECKKKLGEYLNK-----------------------------KYEKTDPELYNRFKSKMDIAINNSKIVHQSWRKAGVVQYDKMVPCTNVYALVEEL 196
336 7.000e-20UniRef50_A0A0A6P564 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A0A6P564_9GAMM  ali  22  17KRPFRLKKYAQFFLIVCEDEKTEPGYFKQFQKKFPEKTMYIRTVGTGRDPKGVIEQAIEKREEFKL-------------------------------ELEYHKEIDFVWAVFDKDDNETKINRFNDAFKIAERENIQIAYSNEAFELWLLLHISYISKPLSRSEIYAKLQSQIRKSAKKYNDYE------------------YDHYKANKIVEIINEIGNEEQAIQKASKLLDYHK---NKEPIEANPSTKIHILVKEL 228
337 7.000e-20UniRef50_A0A1H0GI55 RloB-like protein n=2 Tax=Lentzea jiangxiensis TaxID=641025 RepID=A0A1H0GI55_9PSEU  ali  25  38.........................................................................................LVRYAAKRRQADRGGFDEYWCVVDVDEF-----DIGEAVAAAGAEGISLAVSNPCFEVWLILHFADCTAGISSKAAAEKLRKHMPGYAKGALD-------------------------------FAVLAERVDQAVERAKAL------------GSDNPSSDVWRLVE.. 158
338 8.000e-20UniRef50_A0A1H6H341 RloB-like protein n=2 Tax=Phaeospirillum fulvum TaxID=1082 RepID=A0A1H6H341_PHAFV  ali  22  10KRKPAIRDPKHRFFIFCEGENTEYAYFSALKRDFPGALIELKIIAPAGAAYTCAEKATSAVHKRGY-------------------------------ARDSFEKNDQIWAVFDRDETDRYQDAVSLC----QRSNVGIGRSNPCFEIFLILHIENFNKDCTTRDVERYLQKIHPAYNKKIPDXXXXXXXXXXXXXXXXXXXXXRDREGNSFGAPSTTVFLLTRAIRSAAK............................. 207
339 8.000e-20UniRef50_A0A1I1IQQ8 RloB-like protein n=1 Tax=Clostridium uliginosum TaxID=119641 RepID=A0A1I1IQQ8_9CLOT  ali  23  15...RKKRKTNPTIVIICEGKDTETMYFDNFNSKYTKVDVRIA--------------------------DKNSKGKNKGKSTDPENLVKKAIEIKKNDYDINEKDGDRVWCVFDVDINYNNNNAIQSKIDEIQKSKIRLGISNPCFELWYLLHFEYTTANLNYEDVKKRLDKYLSNYDK-------------------------------NKDIYNELKDKLTCAIDNSKKLKKHHESLDKILPVKSNPYTNIFDLVEY. 234
340 8.000e-20UniRef50_D4RX80 Uncharacterized protein n=6 Tax=Clostridiales TaxID=186802 RepID=D4RX80_9FIRM  ali  25  16QRKHEYKPPKASYLIVTEGERTEPLYFKGMQKLIQEKVGGVVDIIE----QPLIDVHGEGCSTTRLVEVADQIIKDAKII------------------------YQNVWIV----FDKDDFDDFDQAIQEAINRGYNVAWSNQSFEYWLYLHFYYSDSVLHRHQWNAKLDEIFKKNNLGDGT-----------------------YQKNYDDIYSDIYGGVTVAIKHAKRRMAEFER-GGYKPSEYDPGTMVYKLVESL 221
341 9.000e-20UniRef50_A0A259PK18 Uncharacterized protein n=1 Tax=Polynucleobacter sp. 39-45-136 TaxID=1970427 RepID=A0A259PK18_9BURK  ali  27  17.RKAGKTPPKEVTLIVCEGE-TETKYLKTLCQTLRLTTASIYVCDNGTDS-----------APINLVNRAERL-------------------------NLTNDGYDHIYCVFDKDVHESFDRARELNKRSRKPLPIKEAISIPSFELWILLHYEQTDRSFNNSAEV---------------------------VRYITNQNHIRVYKKADDSICQELVGKLETAITNAVWLEKRGHTQ------NENPMTNVHKLVEHI 208
342 9.000e-20UniRef50_X1S1L0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1S1L0_9ZZZZ  ali  21  11KRKQAVRTPNRIELIVCEGSRTEPAYFESLIQNFRLHAIRVHVMASDDSEPINVVELAIAKKEKGVA---------------------------------PGLPYSQIWCVIDVEVPP-HKTLGDAWNKAASVNNLELILTNPSFEYWFLLHFAKVVTPFHSTDIQRELKKFHPTYKKTRK.............................................................................. 158
343 9.000e-20UniRef50_A0A2A5HDZ8 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2A5HDZ8_9FLAO  ali  22  33.RPEPKLIEKPTILIVCEGENTEPSYFKQF----RLSSATIKPVGEGFNTISLVNRAIQIANQGS---------------------------------------YEQVWCVFDKDDFSDV--DFNNAISIAEANNFGVAYSNQAFEYWIILHFDDHQGGMHRDDYDNKINNLLKPYKLVYDGTKSKIISEDIFELLDGIDEKTKKERKI-------------LAIERAKRNLNHF---DQINPAKEESTTTVFKLVEEL 230
344 9.000e-20UniRef50_A0A1C3REW1 Uncharacterized protein n=1 Tax=Terasakiella sp. PR1 TaxID=1867952 RepID=A0A1C3REW1_9RHIZ  ali  19  12.RAAASRDVYEKILIVCEDELTSPQYLNAHIRTLGLPRSIQAKATGDSNPTPDQVVAYALK-----------------------------WLDGEKCRDGFGEHKTTVFCVIDRDEHEKFDSAMAERNHLNKKVHIRAFPSYPCFEVWYLLHHVKTRKGFNRA---------------------GENSPADMVIKDLKKIPVFANYDKGDNKHYEVLVPQQATAMANAVWSKNDAIATG-----ELNSSTEVHELMDYL 221
345 9.000e-20UniRef50_A0A1Y2ZZM1 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y2ZZM1_9GAMM  ali  22  9...RPTKNLKPILHIYCEGTKTEPNYLNGYLDTFFPTNRRLLKVIKI--------EPTEKNTPVQLVSVAMKAQKEF-------------------------PDGDVFWVVYDRESEQKYADKFHATYDRAESKGIFVALSNVCFEVWLLLHFQDVTAQYNNYDDLR----------------------SSSALRTKCKERKMLDYDKGDMSIFSIFKGDIELARRRAKKLTEQSANASQTKPYQWNPYTDIYKLLDFI 214
346 9.000e-20UniRef50_A0A1X2DCL3 Uncharacterized protein n=2 Tax=Mycobacterium riyadhense TaxID=486698 RepID=A0A1X2DCL3_9MYCO  ali  23  16...............................................................................................RAAKRFGDPYDEYWCVFDVDEHANLSDALE----MARANEVKIALSNPCLEQWFLLHFREQTAHLDRRQAQKLAYEYLSCG-------------------------------KSMTDAAQALLDRYEDAKNRARHLITRHLQNGTPFPA--NPSSNMFELMETI 143
347 9.000e-20UniRef50_A0A085BB43 Uncharacterized protein n=1 Tax=Chryseobacterium sp. FH1 TaxID=1233951 RepID=A0A085BB43_9FLAO  ali  27  18.RPIRHKIYKKFILIVCEDENTEPYYFRQIKKEFPADTVYLKEIGTG---------------------------------LKPKGIXXXXXXXXXXXXXXXXXXXXXVWIVFDRDDEGKNVKSFNEAWALAESEKMNIAFSNEVFELWLLLHLSDVDPDLPRDEIYRLLEELIKSSEHYND--------------------FVYKHGKSNIIDAVIDIGNEKVAIKRAKRLLIHH---GNKSPIDANPCTYVHLLVEHL 224
348 1.000e-19UniRef50_A0A0Q7Y4J5 Uncharacterized protein n=12 Tax=Rhizobiales TaxID=356 RepID=A0A0Q7Y4J5_9RHIZ  ali  19  16.RKAGRRRPYDRMLIVCEGSKTEVNYFSAIRREKRLPNADIAIVPSDY-----------GTAPLQIVEYAIDRFNEA-------------------------KGFDRVYVVFDRDDHDSYHNALAKAEATHEKVQFQAIPSVPNFELWILLHFRDVLAPIHRNQVYAELKKFYPSYAKNSLTVXXXXXXXXXXXXXXXXXXXXXYTSHNGTDPY............................................. 202
349 1.000e-19UniRef50_UPI00080B0D75 RloB domain-containing protein n=1 Tax=Bifidobacterium pseudocatenulatum TaxID=28026 RepID=UPI00080B0D75  ali  16  10..RGKTKPRSKRFLIYSGGIVTEVEYFQYVRRHLFGDYVKSLRIKNGEVDDP-VRVEADGVDPKTLVDGAVELLQED----------------KKDAQKESYDPFSVVWAVTDVDDFGKNGDKLRAAVDKGHRNGVEVIISNPCFDVWLIDHKQSCPSSYTQTPDCEKLAKKLGLIDMSRNRNNP------------------------KHICQKEIAGKYAMAAKNAQRMSEQQRRIRGCKPSSGDPWTDVPKIVDTL 228
350 1.000e-19UniRef50_A0A1J5KFX8 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A1J5KFX8_9FLAO  ali  21  33.RKEATLEEKPTILIVCEGKNTEPSYFKQF----KLSSATVKAIGEGYNTVSLVKRTEQLAKIK---------------------------------------DYDQVWCVFDKDDFNDT--DFNNAILMSEGLDFNTAYSNQAFEYWLILHFNDHQGASDYDDVINGLLESLPSTVVYDGKRSKLIEEDFFNLLVGIDTKTNNR--------------RVDLAIKRAERNYNQHDHL---NPASEQSTTTVFKLVREL 232
351 1.000e-19UniRef50_UPI000A0087B5 RloB domain-containing protein n=1 Tax=Promicromonospora sukumoe TaxID=88382 RepID=UPI000A0087B5  ali  23  2.........RKTVWVFTEGRKTEPDYVRALKQL----------DHVRESTSIEMEIARDHVVPYPLVQKAL--------------------------AKAGVDDVDEVWCLFDVESPQAHPR-LREAIELAEQGGVRVAVSNPCFEVWLLLHDRAVSGNLTTSQAEKHAQDLLGVDGKNIVDP-------------------------------SALIGRRAEAGRRAVRLRAGHQSAGTRFP-DDNPSTTVDLFVE.. 180
352 2.000e-19UniRef50_A0A2A5DNW2 Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5DNW2_9BACT  ali  21  13.RRHNKKLPSDLILIVCEDAVSAPAYFYAIVSQRKPTFLEIRGEECGSDPRSVVRYAVELI-----------------------------------RKRKKEPKYDQVWCVIDRDQHPDK--VLNDARQLAKSKNIKLVISVPCFEIWYLLHFSYSAKPYT---DFRSLNQDLKSID-------------------------GFENYSKSDPPIEVLLPETDTAIKNSKRLRASNEKSGSE-----NPATDLDKVVESL 200
353 2.000e-19UniRef50_A0A1G3QJP8 Uncharacterized protein (Fragment) n=1 Tax=Spirochaetes bacterium RBG_13_51_14 TaxID=1802193 RepID=A0A1G3QJP8_9SPIR  ali  23  19RREKARRDPIPRVLIVCEGAKTEPNYFKGLRSAFGLNPMNI-----------VIADKKHGLDPKGLVEYAVEEYKKDH-------------------------DFNDVFCVFDRDKHTTYNAALDKIFRMKKGAKLHPITSIPCFEIWLLLHFTYTTRPFNCELVMSELKQHMPD.................................................................................... 166
354 2.000e-19UniRef50_UPI0009B829CA RloB domain-containing protein n=1 Tax=Dehalococcoides mccartyi TaxID=61435 RepID=UPI0009B829CA  ali  23  26...ENVRPQRRLFLIATEGEKTEPQYFN----------LKVFTDSAEKSIKIEVIPHHTDSAPSDVLKRMKKVLNEYIRECKIRRD-------------------DYAWIIIDKDNWSTGAIDQIFEWSQEHPNR-GVAVSNPKFEFWLLLHFNNGDGIISSQKCSEALQRSCPDYKKDCIPLGKFK------------------------------RENILNAIQRAKQL-----DNPPCPKWPKNTGTTVYRLVEKL 216
355 2.000e-19UniRef50_A0A0S4SXG4 RloB n=9 Tax=Campylobacteraceae TaxID=72294 RepID=A0A0S4SXG4_CAMFE  ali  21  29KRSKDTLNPIYSVIIACEDKVSAPTYLNMVINDLKQNHSI----------------------------RNESIVIAPHEHTDPKGVLDDLLKYKKDKITY--KDFEHKWIVIDRDNNRHNAQDFNDAILKSKSKKIEVAYANDSFELWYLLHFKYLQTPIMRDDIIKDLIKELKKLNE---------------IKFRDLNRDNIKSKKISELIYVELLKLQNTAIRNSKRLLEYYGDDHN--PESNNPSTNIHELIELL 245
356 2.000e-19UniRef50_A0A1J4Y806 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1J4Y806_9PROT  ali  22  5.RGKPLRPLPPVLHIYCEGEKTEPNYLNSYLDKYHPTNKRLRVIKIEKT--------------------------------RKNTPCQLVDEAVNKKKSKETPAIDLFWVVYDREENYSDGQLHAKAFHKAKANNVKVALSNVCFEVWLLCHLEYSTAQYSCYDDLKHNSNL---------------------DNKIKELGFPSGYTKFDKDLCKALVEKVTTAKQNAIQMNQAVISPSRRDPYQLSPFTNVPDLLDAI 213
357 2.000e-19UniRef50_A0A1F9AM55 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AM55_9DELT  ali  29  28...........................................................................................KFLKQEFKKEGLSVDEVWCVFDRDVHRGIEAAF----QQANANQFNIAFSNPSFELWYLLHYKDQTSHIERREVIRKLKRYIQRYHKAME-------------------------------VYQILLGHQSVATKRAQDLRKYHRDNQDQE--TKNPSTSVDQLVSYL 158
358 2.000e-19UniRef50_F7V2L3 Uncharacterized protein n=27 Tax=Bacteria TaxID=2 RepID=F7V2L3_CLOSS  ali  24  13KRRQEHLEMKERYYIFCEGEQTEPRYFSGFKKLIEDNPIYRDMVLIQIEPCGAETMRVIGQAERYVKENQITKG--------------------------------QIWCVYDKDSFPAQNFNAESLNKENPLVQYHAAWSNECIEFWFMLHFAYYTSNNHRTEYIRFLNERYAQLGLG-------------------------KYKKNSADTFDILMGNPKLAARYAKRIIKEHK---GLSPTDIAPGTKVYELVEEL 219
359 2.000e-19UniRef50_A0A1S7D0X4 Uncharacterized protein n=2 Tax=Microbacterium foliorum TaxID=104336 RepID=A0A1S7D0X4_9MICO  ali  24  2............VFVVCGGVETEPQYIDYLKMALGLKNVHIRLSKLGKSPVEVV----------------------------------------RRAIGTREDADEIVWALVDVDDFGS---GVAEAVELGRQNGVQVAVSNPCFELWLVWHFEKLGGHLNQGQVQARAAKLELTYGKDH-----------------------------KSIHIDKLRDRYEHASAQAKRMRKYHAENETACP-DDCPSTNVDLFVDSL 175
360 2.000e-19UniRef50_UPI000A1CA446 RloB domain-containing protein n=1 Tax=Carnobacterium iners TaxID=1073423 RepID=UPI000A1CA446  ali  28  14..........................................................................................IEEIEDVRRHAPIIYEHTWAVFDKDDFPNDH--FDNAITKAEAHNIKTAWSNESFELWYCLHFSLQQSALSREAYNASLDNLLK-------------------------AKGYSGYSKIDSGIYPILRPYMDTAIKNAKKLDTRYT---DLTYSKRNPCTKVYKLVEEL 152
361 2.000e-19UniRef50_UPI0005942DB0 RloB domain-containing protein n=1 Tax=Nocardia exalbida TaxID=290231 RepID=UPI0005942DB0  ali  21  14KRKTGIKPVRTTFRVYAEGVSTEPEYIDALKRLPEFAEVV----------SVDVSIEESGATPMHLVESACVDRRRA------------------------DLDVDFYWCVFDV-EFPQRHPHLDRARQMAKDNGVHLAISNPCFEIWLVLHHRRHAGHLSTAEAIQLRRELDGSDGKHLDG--------------------------------ALYMKLVHNAIHHAQVLREKHQRDGTNFP-EDNPSSSVDQFVGHI 204
362 2.000e-19UniRef50_A0A1I5HLP0 RloB-like protein n=1 Tax=Chitinophaga sp. YR627 TaxID=1881041 RepID=A0A1I5HLP0_9BACT  ali  21  33...EETEEPIKSFLIICEGENTEPSYFKSFP-----------------VPSKLVKIEGGRHSKNSLVDYAIAQMKKEENQGR------------------------EVWCVYDPDEAATQPQDFNSSITKAEANGINVAWSNDAFELWFVLHYQKIEGQQTREQLYPILKKEWQLKSFTKEAKK------------AQFCKEMYERLGGTKSAAQSL------AIRRAKELHDSFK--PRTDYSNHSSCTTVYLLVEEL 231
363 3.000e-19UniRef50_UPI0009C1154F RloB domain-containing protein n=1 Tax=Burkholderia stagnalis TaxID=1503054 RepID=UPI0009C1154F  ali  23  14.RKAATRDLRPIIYIFCEGAVTEPQYLISFYRHLRKLTVMPKPRGGEGEPLTIVQTCIDFRDVLKRAEPSKRWKV-----------------------------IDQVWAVFDRDIHDRFDAAVAL----AKANNVNLAISNPCIEVWGLLHGEECNKPMGRHEAQKAVKAVFPDYDHDDNPVFDWARCEEVWRR----------------------------AADNAIRGLRSRVGEGN-PFPTGNPSSNFHCLLLAL 211
364 3.000e-19UniRef50_UPI0009DEC9BE RloB domain-containing protein n=1 Tax=Hymenobacter sp. IS2118 TaxID=1505605 RepID=UPI0009DEC9BE  ali  19  36.RAAPVREENPVLLILCQGTVTEVEYF----NHFELATADIKALGRAYDPEKLVQHALD----------------------------------LREAARPTKNPYQQVWCVFDKDD--TGPGNFHAAIQRAEAQGLRVAYSNQAFEYWLLLHFDPHPGGGMSRELCQRLEELITAVDPHVRYHSTKGKHISRALFDLLEA--------ADPGAAGQL-PRRKVAVGRARAIAERWAAQG-IEPAYRESTTEVYRLVQVL 244
365 3.000e-19UniRef50_UPI000CEAC613 RloB domain-containing protein n=1 Tax=Arcobacter marinus TaxID=505249 RepID=UPI000CEAC613  ali  23  19QRAKESREPYDKVLIVCEGEKTEPHYLMALRDHLKLSQANIKIDPNSDSSPTSVVKYAKELIKES-----------------------------------PKDPYNHVFCVIDRDRHADFDTAIAQINYRNKDTKLHSIVSNPCFEFWILLHFDYTTKLFGTSGCMDLIKNNLKVFVEDYEKGDKAIMPPIIXXXXXXXXXXXXX------------------------------XXXXXXXXGIDNPTTQMDELVDYL 216
366 3.000e-19UniRef50_A0A1I4GAG8 RloB-like protein n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1I4GAG8_9ACTN  ali  20  25............VYIYAEGEVTEEEYLDLVMEHGPADPARRTTHHICTTNAATKDRKPITLVDKAVDRLREEERKAKRAGLKPKDWAWP-----------------QVWCVFDRDDHPQIPTAF----SRARKAGVHVAYSHPCFELWRLLHYRNHTTSM----------------GGVCNDAGARLRGCQGFAQTYGANVRSVDVDRSKHVMPGQIKGRYEKARDFAKKLNEQHTTTDQT---RWDPYSNVWELVE.. 230
367 3.000e-19UniRef50_A0A2K2H9B3 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2K2H9B3_9DELT  ali  22  4KRKSNQKNLKPRLHIFCEGEKTEPNYLKGYIERRFPGTRLSPVRPTPKNTPIQLVEEAIREKEKN-------------------------------------PSGDIFWVVYDREAPTKYPDALAEARSKADAHGIKIAFSNVCFEVWILLHFQPTVAAYANYDDLQKLKTHIKNYDKGTKRLFSGEE--------------------------------ISTARKYAEDLNRRTIAGADTKPYQWNPYTDVYKLLDAI 200
368 3.000e-19UniRef50_A0A254RSH3 Uncharacterized protein n=1 Tax=Fibrobacter sp. UWH1 TaxID=1964354 RepID=A0A254RSH3_9BACT  ali  21  13KRKRKTLSLRKLFLIACEGEKTEPNYINDLIQSEKDARRIA---------------------------SGSKVLIVNHQHTDPCGVLTDLCSDPKY------EDAEQRWIVIDRDAVENIQENFDKALCGASEKGVDVAYSNPCFELWLILHFEYRDSSSSRIDVQ-------------------KKALQLLKKSKLLKPNATINDLKAEKGLFTALGERLEKAVKGAEKLYEINGGT------RQNPCTTFHKLIEAI 222
369 4.000e-19UniRef50_UPI000C9FE78B RloB domain-containing protein n=1 Tax=Salinivenus lutea TaxID=890426 RepID=UPI000C9FE78B  ali  19  28.RRPGDRRKLPRILIVTEDDVTEPNYLDDLRQDENLPSVVVEPAP-RSEPWSVVGYGLRKFLPSDGEE----------------------------------SEYERLYCVFDRDEHDRFGDAIERLKRISNNRSVYWIYSIPCFEYWILLHFRQM---------------------GPLKYYTGSRSPCSGVVQDIESESHIDDYQRVKPNIYKETKTNMDRAISNA---RTMWGQNGGRRFDDPHPRTRMHKLVAYL 227
370 4.000e-19UniRef50_A0A2D2M6B2 Uncharacterized protein n=1 Tax=Pseudomonas sp. HLS-6 TaxID=2049589 RepID=A0A2D2M6B2_9PSED  ali  20  5.RAKAIRKLPRKMHIYCEGAKTEPNYITGYIGTLEDRALRNVICIEKTRKNTPVELVDVAISQK---------------------------------RNNSTPKGDVFWVVYDRESITKYDDKLDQAYKRAKDNDINIALTNVCFEQWILLHFIDSSTAYSCFDDL----------------------ITNSNLKRLIKDTIGQDYHKASLDIFNHLKPNIAQARQRAIRINERSAQTGRTKPHHLNPYTDMPTLLDAI 211
371 4.000e-19UniRef50_UPI00097540B7 RloB domain-containing protein n=1 Tax=Chlorobium sp. KB01 TaxID=1917528 RepID=UPI00097540B7  ali  21  10.RPSGTLRYKKLFIIATEGVKTEPQYFAALQTEQSVIKIRCLKSKNNSAPLQVLKRIQDHIKEEGL------------------------------------KDSDEAWLVADQDGWEEEHINLMFDWSKQKVN-YGFALSNPKFEFWLLLHFDDGKGITSSRSCSEQLRHHLPDYDKGVSANKITRMI-------------------------------VETAIRRAEQRDNYKSGWPVTT------GTTVYRLVRNI 193
372 4.000e-19UniRef50_A0A0A2DW57 Uncharacterized protein n=1 Tax=Porphyromonas sp. COT-239 OH1446 TaxID=1515613 RepID=A0A0A2DW57_9PORP  ali  21  14....GTRSIQLRFLIVCEGTKTEPNYFEALISDNRLSSVIAVDIQGEGKGTVSLVRKTQKVVEES------------------------------------GLSYDRVWVV----FDKDDFVDFDEAVALAEELGYGAAWSNESFELWYLLHFYCPTAKLNRKQYITRLERQL----------------------RARLENRNYRYRKGSLDMYSILFGSEGKACARAQTLRHVYR---DCVPSEARPCTTVDLLVLEL 205
373 4.000e-19UniRef50_A0A1L7FFL8 RloB-like protein n=1 Tax=Actinoalloteichus sp. GBA129-24 TaxID=1612551 RepID=A0A1L7FFL8_9PSEU  ali  21  24............IWVFCEG-FTERTYFEALARFFRDNGIKATPIECRGRDPLSIVQTAVEARDNGVGRGSIM-------------------------------PHDHVWCLVDRDEHHTFEDAL----RYAGRKEIDIAVSTPCFELWLLLHFGDQRAYLTAKQAERAVRRHLPRYAKKVEPDFPLDAHPAAADRARSTLSTGAFGGNPSTSVWR-LLDVITETRRQARR............................. 206
374 4.000e-19UniRef50_A0A139CRA3 Uncharacterized protein n=1 Tax=Methanolobus sp. T82-4 TaxID=1794908 RepID=A0A139CRA3_9EURY  ali  21  3..RREGRKSTRNMWIFCEGEKTERLYFEKLRINQRIPRLSIKIYSSRSD--------------------------------KAVNRLLEYTIKFMEHHKRDFRADDLIFCIFDRD--ANTNNDFQKAINTASKHNIGLIFSNPSFEYWILCHFGYFPNRFEKETLLRKIENFI------------------------------SNYQKNDPTLYERTIPKIRRALINSKQIAEIHLDSDTELISESNPCTTVFEIIDII 196
375 4.000e-19UniRef50_A0A1Z4V2B5 Uncharacterized protein n=2 Tax=Aphanizomenonaceae TaxID=1892259 RepID=A0A1Z4V2B5_9CYAN  ali  17  27..........KLYIIATEGDKTEPNYFNALITQYEQDFRLSYIH----------------------VEFIDREKEQAGNSDPQYVHKTLLKFSEELEKRYDLKEYDELWMIIDTDDYDSRKKTISQILEKCDDNPIYKLCSNPCFEIWLILHFFDLETSIPEHLLKTSLQEAIPKHLYTTSLKDYIKNQYIQKRPGICKKLWNIIYESRKQPSNGKIIEDIQQAISRAKILGECNPNDPDYPKNKI--GTEIYKLLEKL 256
376 4.000e-19UniRef50_UPI00048BA0E5 RloB domain-containing protein n=1 Tax=Desulfobulbus mediterraneus TaxID=160661 RepID=UPI00048BA0E5  ali  22  10.RKAPDRSYRKRFVIATEGKETEPQYFSMFNSKRSTIQVMVLKSKQKTSSGQVLDRLKKADIGKK----------------------------------------DSAWIVIDRDTWEK--QELDQVFDSCKAQGYKMALSNPMFEYWILLHFEDGNG-VNTGNVKKRLTIQLPHFSK-------------------------------SNVEIHKIKPGIDEAIRRAER--------KDNPPCEKWPGTTVYRLVKEL 188
377 5.000e-19UniRef50_G0G3Q7 Uncharacterized protein n=6 Tax=Amycolatopsis TaxID=1813 RepID=G0G3Q7_AMYMS  ali  24  2................CGAEATEPAYFQGLKQARRNPAVTIKLKAKPADPDTVVRHAAGL-------------------------------------RDNAADTYDEVWCVVDVDEF-----DVAKAVVTARRVRVNLAISNPCFEYWLLLHFEACTAPLTCSDVARRLRRHVPEYDKTAL-------------------------------RFADYASGVDAAVERS-----LGRGHVLTTEHEHNPATGVWALVKK. 166
378 5.000e-19UniRef50_F9DD92 Abortive phage resistance protein n=5 Tax=Prevotella TaxID=838 RepID=F9DD92_9BACT  ali  19  11.RSDDVRKEDKTFIIFTEDKTSERLYFESFQT----SNLKINVVENQKSKMENVFRAIKYCEQKKAF-----------------------------------DKGIHVWCVFDRDFNGNAEISFDESPHTAKRNNIKVAWSNDSFELWILLHYEDVDEPLLRSKYYERLTEILKADTK---INSDFCVAIGNGTFNYYDDIKSLNPFKNYILPILQDKTRRTAAIERAEKLENHHTT-HTDKPHEMCPCTMVHHLVKEL 235
379 5.000e-19UniRef50_UPI00034755BA RloB domain-containing protein n=1 Tax=Geminocystis herdmanii TaxID=669359 RepID=UPI00034755BA  ali  24  8RKNINKRKPNKTFLIICEGE-TEKKYFDIFKTFASDKNILIEVKLG---------NKKSGAVGITVVKTAIDLKDEYYND-------------------------DEVWCVFDRDKENNNQQNFNQAIEFAYNNQINLAISNDAFELWFLLHYEYYCSETHRSNLNKLLTDRLGK-----------------------------KYEKND-DIYNQLEDKQENAIKNAKKLWFSHCKEKQNKIHNMNPSTTVYQLVEKL 214
380 6.000e-19UniRef50_A0A255R570 RloB-like protein n=3 Tax=Prevotella TaxID=838 RepID=A0A255R570_9BACT  ali  23  35...........RFLIVCEGTKTEPHYFEALIKNYISTVREVTIEGEGRATVALIDRTQEIKTEL---------------------------------ERKNAMSFDRVWVV----FDKDDFDDFNDAIKKAHKLGFQSAWTNEAFELWYYLHFEYLDTAISREAYIDKLQDAF----------------------RKKMGDEGFKYRKGNPDIYSLLQGREDLAKRFAKQLRALHN---DGNYAMHKPCTIVDKLVEEL 222
381 7.000e-19UniRef50_A0A174D1R5 Uncharacterized protein n=6 Tax=Lachnospiraceae TaxID=186803 RepID=A0A174D1R5_9FIRM  ali  24  19KRRQEYLELKQRYYIFCEGQQTEPNYFLGFKKLIEENPIYKDMVLIEIEPCQAETMRVIGMAEDYVKKNKILKG--------------------------------QVWCVYDKDSFPAEHFNANSLNKINPELQYHEAWSNECIEFWFLLHFAYYTANNHRTEYILFLNDKFKELG-------------------------IGKYQKNMNDIFTILMGNPKLAIRYAKRIIKDGEGKTSTEIA---PGTKVYELVEEL 225
382 7.000e-19UniRef50_A7BUE5 Abortive phage resistance protein n=1 Tax=Beggiatoa sp. PS TaxID=422289 RepID=A7BUE5_9GAMM  ali  21  17KRPLRLKKYKQFFLIVCEDEETEPRYFEQFQGLFPEGTLYIRTVGTGRDPKGVIEQAIEKREEFKL---------------------------------EYRKEIDFVWAVFDKDDNEAKIKRFNEAFQIAKRENIEIAYSNEAFELWLLLHITKVTNPLSRQEIYIKLQNQIRKSGERYKDYVYDHKKPKENRIVEIIHE----------------IGHEEQAIQKASQLFNYHK---NKKPIEANPSTKVHILVKEL 228
383 9.000e-19UniRef50_A0A0H2SH84 Uncharacterized protein n=5 Tax=Thermotogae TaxID=200918 RepID=A0A0H2SH84_9BACT  ali  30  12KRKKNTREIKPLILIVCEGEKTEKYYFDSF----EVSNAHVKVVGEGRGANVLLKAA---------------------------------------KKYFKKEKFDQVWLVFDKDEI--DDQKFDESIKEIEKKGYNTIYSNPCFELWYLLHFVFYQASLSKEHCLRKLKEKLPEYEKNIGDMXXXXXXXXXXXXXXXXXXXXXKKDINIH--------------------------------SKKNPYTNVYKLVEEL 193
384 1.000e-18UniRef50_A0A1Z5HA80 Uncharacterized protein n=1 Tax=Bathymodiolus platifrons methanotrophic gill symbiont TaxID=113268 RepID=A0A1Z5HA80_9GAMM  ali  24  22KRVKEIRVIRKSILVACEGTKTERLYLEDIFTSLKYQHKIA----------------------------AGSLVIAKHNHTDPKGVLKDLLDHTDY------ESFSYKWIVIDRDIERTKANDFNAALAKAKSKGIEVAYSNPCFEIWYLLRLEYRNTAIDRTELQSKLEDEFNYQKNILFKHGTE-----------------------------------KEAIANAKKLLSSYDSDD---PANNNPSTNVHELITIL 213
385 1.000e-18UniRef50_A0A2T3KEQ8 Uncharacterized protein n=3 Tax=Vibrionaceae TaxID=641 RepID=A0A2T3KEQ8_9GAMM  ali  15  19KRAHEKKEPYPKFLIVCEDTVSGYHYLIEAVRHFRLSTANFSIVGLGQDPLDIV---------------------------------RDAERRFNEEKKSHKPDFERVFCVFDKDNHARYYNAISKVDSINKSPIFTAITSIPCFEIWLILHFEYTTKLYT-----------------------DQERKTASNQVVKDLTGFIKNYDKSNKTALKDTIQLLPSAITNAQRLCTYCEKNNSES-----PATKMHELMTFI 221
386 1.000e-18UniRef50_UPI0009E98254 RloB domain-containing protein n=1 Tax=Bifidobacterium aesculapii TaxID=1329411 RepID=UPI0009E98254  ali  18  11KRGVGKRQVPPRFILVCEGQ-TERGYFQAVNQLLRLAGISVKAVQDEVSPLAIVDRAK------------------------------DYITGNPKRGIEAVEKQDQVWVVFDWDEHTG---EVVRARKEAERLGIHVALSNPCFDVWLIWHLEDMRVGCLAKQTDAELKKVWPSYSKGADNPWAALWTGLR-------------------------KDGLHEASRRAREADAKLRSD-NLAYPENRPSSEVLELMDAI 210
387 1.000e-18UniRef50_UPI0006D26A88 RloB domain-containing protein n=1 Tax=Olleya sp. ITB9 TaxID=1715648 RepID=UPI0006D26A88  ali  28  4.......EFRKTILIVCEGQRSEPDYFHSLKNETIENNKNIFI-RILPIPKEEQLQIDEEVANFKLRNGAKKRSIRKAIIEEPQDKAQPTCYIRKAQLAYFEKGYSELWAVYDKDGHPDHLNAYLLKNKEECNKTVNIGFSSISFEEWILMHFEYCSTSFVKSQCRDSDKRIFNCGTNTH----ELDCHGERCVIGKIIENKYLPYTSSKNFEYNDFSQNTVVAFNNA--LKSRIEAVGKGSFFNNNPYVSIDRLVFKL 256
388 1.000e-18UniRef50_UPI0009A1D657 RloB domain-containing protein n=4 Tax=Pseudomonadaceae TaxID=135621 RepID=UPI0009A1D657  ali  17  20.RRKAVKETKPLYLIVCEGKKSEPLYFEEMRNHERISTVKIRVTGECGSAPISVVNHALELYSNLLSD---------------------------------GEQVEVVYCVFDRDNHESYYRALALVSQKNKEGPLVSIASIPCFEYWVILHYRYHRSPYERKD------------------------KSSVSADLCKEIQQYMPYKKGGKGLYESLKSKQGDAL.................................. 187
389 1.000e-18UniRef50_A0A0C2ZIW0 Uncharacterized protein n=1 Tax=Sulfurovum sp. FS08-3 TaxID=1539065 RepID=A0A0C2ZIW0_9PROT  ali  22  22..........KAVLIALEDTKSSRYYFEKLIHYKGLSGKVVFVEHIGTNPKKVLEAIK------------------------------------KHKKENPNIQFEKEWIVIDRDSFSK--DDFKGTIEEARQKGICVAFSNECYELWILLHFESVNAHTSREDLKSRLNQIFRE-------------------------KFGKEYSKASADVYALIIGQQQTAIDNAKKLVKQHYRDYGKIDIEKNPITMIYQLVECL 207
390 1.000e-18UniRef50_A0A2S8AWC1 RloB domain-containing protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2S8AWC1_9ACTN  ali  17  44RRKQGLRDPADRILVVCGAENTESGYLNGFKRHFKKPTVSLKILEKPGSTVEVVRDAIGAT-------------------------------------ERSQGDYDQVWCVVDVDQYRDFDEAGRL----ADEHEVRLAVSNPCFELWLLLHHADHRAHV---ADYKHVKSLWPG.................................................................................... 174
391 1.000e-18UniRef50_A0A1M3CUL2 Uncharacterized protein n=1 Tax=Chlamydiales bacterium 38-26 TaxID=1895743 RepID=A0A1M3CUL2_9CHLA  ali  25  18KRKKYTVSIRKRYLICTEG-KTEAIYFGHYKSSTGPVVVALDKSDHKVSLVKKTIEERD----------------------------------IRIQAGEFDEEIDEAWVVLDRDANPLNKDHFNRALELAKINNIYVAYSNDAFELWFLLHYQDLWATTHRDKLYKLLSTHR...................................................................................... 158
392 2.000e-18UniRef50_A0A1Q5WV82 Uncharacterized protein n=1 Tax=Paenibacillus sp. P3E TaxID=1349435 RepID=A0A1Q5WV82_9BACL  ali  24  11.RRVGTREPNKRIYILCEGQ-TEEAYFNNFKSRRVNIDVKV----------------------------------AKAKQTDPISLLAEANRIINDKQLDVKSGVDEIWCIVDLDVAVD-NDYVVQLLSRAKKHCTNIVYSNPCFEVWFLLHYERLNTNISIKKLIKKLEKYIPNY-------------------------------KKGECIFTYIGDQTDNAILNAERLEKNAEKIKILQYKECDPHTEVYKLVKKL 202
393 2.000e-18UniRef50_A0A2H0QXD8 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_39_49 TaxID=1973900 RepID=A0A2H0QXD8_  ali  21  30...EKERNERAKVLIVCEDSKSSVTYFKNICKKYRIIG-KVEVSGDCGSAPQSVVEHAIKVCEEK------------------------------------SSDYDEALCVIDRDRHEKFHEAIDKARSWKKRTKLRTIESYPCFELWLLIHFGYTTKSYIYDDLLPDLNKKLKDNR-------------------------CEDYSKSNESNFEVFFPLTDKAVTNSNKLEQDSKETG-----QKNPSTQIHHLIELL 223
394 2.000e-18UniRef50_A0A0H5CQ99 Uncharacterized protein n=1 Tax=Alloactinosynnema sp. L-07 TaxID=1653480 RepID=A0A0H5CQ99_9PSEU  ali  30  19...........RILVYCEGENTEPEYFRGLKKYLRAIPVDIVTCDIKGIGCDPLKIVKEAE-----------------------------IAWARDRRKNGAECYDAVWCVVDHDDHPSLRSAVEYAARAG----IGVVVSTPCFEYWLLLHFDDHRAHVRQSEVTRSLRRHLRG.................................................................................... 149
395 2.000e-18UniRef50_UPI000D15DE0A RloB domain-containing protein n=1 Tax=Photobacterium leiognathi TaxID=553611 RepID=UPI000D15DE0A  ali  17  19KRQIGKREPYPKFLVVCEDTVSGLIYLQKAVIHYKLSTANFSIVGIGEDPLNIVKRAEIE---------------------------------YDKEKKSTRPAFDKVFCVFDRDTHHSYYNALSKITSLNDKPVFVAIQSNPCFELWLLCHFEYTTKLYTKSQ-----------------------NKSASGHVKDDIKKYLPDYDKSSDKVFEQTINLLPSALKHASSLREFCEVNMLEA-----PYTDMDNLMSFL 233
396 2.000e-18UniRef50_A0A1Q5NGB0 Uncharacterized protein n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1Q5NGB0_9ACTN  ali  22  2..............VVCGAEVTEHAYVQGLKNAARNPAVSVKIVKHPKAPSQVVAHTVKLLET-------------------------------------ADDVYDAAWCVLDVDEFTDLDQALRE----ADRKGIGIALSNPCFEVWLLLHFTDHHKHAPSYELVPILNKHTPG------------------------------GYSKTGLDFRHYQDGWPEAVRRAKQLAPDGKER------EKNPSTGMWKL.... 166
397 2.000e-18UniRef50_UPI000B53D564 RloB domain-containing protein n=1 Tax=Haliangium sp. UPWRP_2 TaxID=1931276 RepID=UPI000B53D564  ali  21  11.RRTQHRDA-WLCVVVTEGERTEPQYFLGLQERGVLPRTRFKIEVIPPSPTQHDSAPNHVCQRADQAM----------------------------QERRLVLGLDQVWLVLDVDRWGD--AKLDEARKHARERGYGLAVSNPCFEVWLLLHHTDLEGADTAAECTRLLRQYLGSYSKAALQLDDFPA------------------------------ERVRQAAERARIRHPESSGWPQT------PGSHVYRLIEPL 202
398 2.000e-18UniRef50_A0A2S4F8X8 Uncharacterized protein n=1 Tax=Bacillus sp. MBGLi97 TaxID=2070760 RepID=A0A2S4F8X8_9BACI  ali  25  8RRSRSQKKINPNYLIICEGKATEVNYFNGIKRHIMLPTMNIKVFGIGKSKQELVKFAIG-------------------------------------KRSKSRDEIKSTWVVFDKDDISN--EDIDKTIKFAKDNNINVAFSNKCFELWLVLHFKEIDAILTHSQLYKMVEKEF-------------------------DCKDYKNNGKSNAALIDKIAGSYRVALKNSDKLYKQQNNRH------RNPYCDVNKLVNEL 198
399 2.000e-18UniRef50_R7ANI9 Uncharacterized protein n=16 Tax=root TaxID=1 RepID=R7ANI9_9BACE  ali  26  12..KVKRRKRKPIVYIICEGKETETLYFKHFRSRNCLVDI--------------IPISSKHKAAEHLVKHAKSLVSQADYYPK---------------------DGDQLWCVFDCDD--NKDSELQAAISYSEKHGYKIAYSNPAFEYWYLLHFEKRNGYLDSDTVIDILKN-----------------------------RGYLENYEKSMDVFEELQKHQPEAIEHAKERVERLTRDKVAMICRDNPVTTVYELVEFL 204
400 2.000e-18UniRef50_I4AIQ5 Uncharacterized protein n=1 Tax=Bernardetia litoralis (strain ATCC 23117 / DSM 6794 / NBRC 15988 / NCIMB 1366 / Sio-4) TaxID=880071 R  ali  21  45.......KLPEKVLIVCEGENTEPSYFKELVRFYKLTFIDKKNIIGTGYTQKRIVEEAEKLSIE--------------------------------------DDYDEIWCVFDHDDNLVQSQNFNAAIAMAEARGFKVAYSNEAFEFWIILHFENHQAAMNRSLYYDKINNYLREHNLEYNKDSKIITTEIFEVLQ-------------SIIDVKTGKTRQDLAVERAKKIYEEFGKIDSNSPADEQSSTTVFKMIER. 250
401 2.000e-18UniRef50_UPI000A006E73 RloB domain-containing protein n=1 Tax=Hyphomonas johnsonii TaxID=81031 RepID=UPI000A006E73  ali  19  27KRKQSKRALKKKLHIFCEGAVTETLYFREMARFQRE---------------FVIDFVSTGKIPKTLFDEALAYLKLINKS------------------RTGYSEHDQVWLIFDRDSH----DHVSEVINNARSHGIHVAYSNPCFEVFLLYHFQDYDADEDRSRVKAKLAGICTEY----------------------------CSKKCKLNSANEVVNLRADAIARSKRSLVSRANEGTEMGA---PSSTAHLLIEAL 220
402 3.000e-18UniRef50_A0A2A5HQ15 Uncharacterized protein n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HQ15_9ALTE  ali  19  16.RDTKGLTSHPKVLIVCEDTKSSLFYINDLVKDLGLQATRVEVIPGKGSAPISVVNTAISRSE-----------------------------------PEGEDSFDKVFIVIDRDSHTTFDKALKELDRHNRNAEFYSILSYPSYETWVLYHFTYTRSPMTSKDVIRKIKKE------------------------------GFDYKKNEADIFSSTKGRMEHAIPNSAKSIKDAESEQ-----EPNPSTQFHVLIDRL 209
403 3.000e-18UniRef50_A0A0F7FT59 Uncharacterized protein n=1 Tax=Streptomyces xiamenensis TaxID=408015 RepID=A0A0F7FT59_9ACTN  ali  20  2...............FCDSDVTERDYLRALVGHVANPAVTVRIRNKPCSPSQLVAHAAS-------------------------------------FRDKAPEDFDQVWCVFDVDDYSDIHQAV----KKAGDLGIKLAVSNPCFELWLLLHHTPHTAHIMGRQLVPLLTKHVPAYDKAR------------------------------INFPRDFGPSWARAVERARGLATSGQE------YAVNPSTGVWALVEII 169
404 3.000e-18UniRef50_A0A2P7TQM2 RloB domain-containing protein n=1 Tax=Sphingobacteriales bacterium UPWRP_1 TaxID=2116516 RepID=A0A2P7TQM2_9SPHI  ali  24  16....GFKRLRPSIIIVCEGE-TEKHYFN----------------------------------------------KRFNFSKAIVGKGQRDDIVEYAKKKNRTDDYDIVWCVFDRDTNESDNTKFDKAIELAKKEKIETAWSNDAFELWICLHYRNYNNPIHRTDYVKELNRRVGKYEKGDAKLYEKLIKDPDASE--------------------------KEAIERSKKLHKHFMAQTHLRYCEYNPCTTVYLLIEYL 200
405 3.000e-18UniRef50_A0A2M8CXZ0 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium CG_4_9_14_3_um_filter_47_13 TaxID=1973899 RepID=A0A2M8CXZ0_9PROT :_  ali  22  54.RPEEIDEQKTRILIVCEGQKTEPDYFKAMCSDYKISGANIIIYNTGDRSSPKTVVDDAVKYNKQ------------------------------------HGSFDAVYCVFDKDGHGKSYEEALNRIKSRKE--LIAIHSVPCFEFWILLHFDRSLGCWNRYADIE-----------------------------PDIKSKMPGYNKAMTGLYDCIKDYTEIAIQNAKYAEQEAERAGT-----DMSTTKIYLLVEKI 239
406 3.000e-18UniRef50_A0A1W9R2B8 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1W9R2B8_9BACT  ali  42  5.........NYTILIVCEGEKTEPLFFNSIRDELYNNDIRKIKITIAPEPSIDILYKNNTVVKHKSKRKKRKTIKVEEIDKIKIIDGRPPLRWVLTAQRELLEGFNEVWVVFDNDDHPGKKEAFE----IAKKNKVNIAYSSRSFEYYLLIHFKKIYRPFNKTDCKTKITNKEVYVRCGTNIFPETDCNGSVCINGYAQINNYWENTKNSETTYSLIKDKLEIGFENAAWIRYKSDVLENEPIYDRNPYLSTDDIVKKL 263
407 4.000e-18UniRef50_A0A135L6E6 Uncharacterized protein n=1 Tax=Tepidibacillus decaturensis TaxID=1413211 RepID=A0A135L6E6_9BACI  ali  24  15.RKQNTRERLNKIIIFCEGEKTEKLYFSNFKQSTRC---EIKILETNAKDAESIVKEVV-------------------------------------RKKDQYDSKDIIWCVFDVDNNTNQQLINAKTIA--NRHNVKISLSNPSFEIWFYLHYEYTTRYFLNNDLIHQLNNHISNYEK-------------------------------NKNVYHLLASYEEVAISNAHKLVEHQRNLGNEIFSRDNPVTLVHELLSNI 200
408 4.000e-18UniRef50_U2W1M4 RloB-like protein n=1 Tax=Acidaminococcus sp. (strain BV3L6) TaxID=1111120 RepID=U2W1M4_ACISB  ali  28  19...........IIFIGAEGKKTETKYFNSFNR-LQDTYIVKFARNNRTDPKGMVTSIHKEASTEGI----------------------------------TGRNGDEVYVLLDADSEQYKKEQIKEAISIGKNKNVNVIISNPCFELWLLLHFEYTTKYFSSRELIKELKRYIKNYEKNL-------------------------------DVFTMLEDKQMDALKNAKKLHSVHAETRKQLGYVQNPETDIDILVDKL 202
409 5.000e-18UniRef50_UPI000A041E0D RloB domain-containing protein n=1 Tax=Burkholderia sp. A1 TaxID=148446 RepID=UPI000A041E0D  ali  21  31.RAKPSEAPQPTVLVICEDSKSGKVYIEDAALYYRANVKVSVVHIGKTDPKNIVAEAIKK-----------------------------------------RSKFDKVYCVVDRDSHEGWDEAVRLA---EDSNGVEFIASYPCFEFWLILHFGVSTKPY---------------------VKSGAKSPGECCAADLKKCKSMEKYKKGGDRLFEKLLDRLGDAKKNSKRIYDDATRLG-----SMNPSTKMHVIIGDI 219
410 5.000e-18UniRef50_C8PQJ2 Uncharacterized protein n=2 Tax=Treponema vincentii TaxID=69710 RepID=C8PQJ2_9SPIO  ali  29  5RKPVGSRRCAKRIYILCEGKHSEYAYLSALIKDTPLQGNTVQIELVPTEKNTG----------RELVEEAARKIERKFKKI------------------------DEAWVVYDQDGYTLHKETF----RLAKEKGVKLAFSATAFEMWILLHYKYTTKQFSKSE----------------------------DIIKELKNKSFIDYTKNATNVYSITKNNXXXXXXXXXXXXXXXXXXXXXXXXXXXPYTNLDLLVEEI 200
411 6.000e-18UniRef50_R7IQM9 Uncharacterized protein n=29 Tax=Bacteria TaxID=2 RepID=R7IQM9_9FIRM  ali  17  15QRKQFKVPELGYYLIVTDTEATERCFFKGLHQALPEDVRNKLVI-------------------------------------KVVETKTRAMIDKCLELTAYDAQYRIPWIVFDRDQVQG----FDEIIKEAEDKGIQVGWSNPCFEIWMYAYFGSMPAIQDSWTCCSDFGRVYETKTGQKYSKADEQMYGKICKAGDE-----------------------EKAIQIAQQKLEQCKREGKTKPSEMCPCTTVHELVGEI 209
412 6.000e-18UniRef50_A0A1W9WQS8 Uncharacterized protein n=1 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9WQS8_9GAMM  ali  18  21..........KLYVIATEGYRTEYKYFMSLREQYSAK-----------------------FNEWNLQVEVLRRPEQQDGKSSPNSTEQMLTEFLEDNNEIYDKSYDELWLIIDTDTWKQESIE-KLAEKCHKETHYHLGLSNPCFELWLILHLADSNQDVRTYCVTDKHKQNAPRINKCIETLENNNSLDFSLKNCIEIAQMHLIKSHHHLSSTEALIDYVPQAISRAKALGECEPNDDNYP---KNLCTSVYKLLETL 254
413 6.000e-18UniRef50_S2VI19 Uncharacterized protein n=2 Tax=Actinotignum TaxID=1653174 RepID=S2VI19_9ACTO  ali  18  3.RKRPQRRLRESYLIVTEGSVTEVEYFGLFQQLIRDNRAVTLKIVSGGGEPRRVLDKAMSIA-------------------------------------GHSGKYQHICLVMDTDQHPT----LQAVVKEAQAQGFGVFVSNPCFEIWLWWHIADHFAHVRPGELEKKLVPHLDG------KSVPSTFPVESWRDSY----------------------------ERAKNADKQNGEAG------LNPSSRVGELLSIL 179
414 6.000e-18UniRef50_UPI000A07A2C7 RloB domain-containing protein n=1 Tax=Paraburkholderia oxyphila TaxID=614212 RepID=UPI000A07A2C7  ali  21  46.RHGPVRQPKVEFVIACEGVSTEPEYLTACTNYYGVGAVRLRILKEKGVPLTLVRLAIDE---------RERLMEEYRKNPEKIGYGFV------------------VWAIFDRDEHPHFDEAIKLAIEHK----ILIAVSTPCFEIWPYLHYADCNAHVERDVMQARLAEIAPPYHHKNNPIVGXXXXXXXXXXXXXXXXXXXXXAKENGMPY-------------------------------GNPTTGMHHFVRAI 241
415 6.000e-18UniRef50_D1W2G1 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=D1W2G1_9BACT  ali  19  4.RREAFRDAR-LIVIASEGKATERIYFKALAKEYTNPRVHVHI------------------------------LERSIDEQNNSSPEHVLKQLNDYKSQYELEADDELWLVADKDRWTEAMLSRVAT-ECSQEVAMHMALSNPCFELWLLLHIED-AASLPPEEQKQWMENRRKSRNADPYLKVR--------------LRKNMGSYHESSYDALALIAHVEDAIERARALDENPNDRWPQTL-----GTRVYLLAE.. 207
416 6.000e-18UniRef50_C7R9F0 CRISPR-associated protein, Csm2 family n=1 Tax=Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125) TaxID=523791 RepID=C7R9F0  ali  19  20.RKSKLRSPYDNVLIVVEGEKTEKDYLNALIDKYKINTANFEVVGKGEGPMSIVSTAVQKY----------------------------------DQAYASPNRFDQVFCVFDRDSFGDFNDAVDLCASKNSREYFKAITSNPCFEYWVLLHLNYTDKGYSAT-----------------------GNRSICGKVVDDIKALIGTYEKGSITNLDFLFDCIAAAIKNSERALSQTLESGSQT------YTLVHEVV... 229
417 7.000e-18UniRef50_A7BR05 Abortive phage resistance protein n=1 Tax=Beggiatoa sp. PS TaxID=422289 RepID=A7BR05_9GAMM  ali  21  10.RQPQSSNRFKTFLIIMEGEKQEPNYFNTLKKFYTRQHRESRI--------------------------TIKIVKRKEEQKNNSSPSYLIQLAKEFSNQFDLQKYDELWMVFDADSWGIQAFEELNHWKNEENYHY-LAYSNPCFELWLILHLTEYQTIQKRVETAKI----------------------RIRSRICKQIHGELKQDNKLSGEYIEYLGDIQQAIERAKALDITPEKEFPN-----NICTRVYQLVEKL 213
418 8.000e-18UniRef50_A0A1F6GXD5 Uncharacterized protein n=1 Tax=Candidatus Lambdaproteobacteria bacterium RIFOXYD2_FULL_56_26 TaxID=1817773 RepID=A0A1F6GXD5_9PRO  ali  23  3.RKVGGREQKKL-LIVCLGEKTEKAYFESFKTQ---SGHKVVVLGMGVNPSNLVAKAKGHIGHSK-------------------------------------KNYSQVWLVFDQDQFG---ADIGLAIRQAGEEGYKVALSVKQFEHWLLLHFDSYKAPLNAKDYAKKLGKHLGR-----------------------------EYDKTTPSDLEKLAQGREVAIERARAMN-----------HGDDPSTSVWELVSTL 177
419 8.000e-18UniRef50_A0A2W4T807 CRISPR-associated protein n=1 Tax=Methylococcaceae bacterium AMb10-2013 TaxID=2202815 RepID=A0A2W4T807_9GAMM  ali  25  19QRNKATKSGKETILIVCEGSKTEPLYLNSLLIYLGLK-------PRVDVDEIVVDSRKSGLDPSGLLKHAIKLFDN---------------------KQKQGFTYDRVYCIFDKDSHTKYESTCDKIKNNPKGSIMYDITSVPCFEVWLLLHFSDSSAPFHSRSCCEQVIEKLKVCAGFADYKK........................................................................... 180
420 9.000e-18UniRef50_A0A284VKS0 Uncharacterized protein n=2 Tax=Candidatus Methanoperedens nitroreducens TaxID=1392998 RepID=A0A284VKS0_9EURY  ali  26  2..............IVCEGKRTERIYFNNYKKWGCNLKIE-MPYSGDTDPLSLIEFAKKQISKYELN----------------------------------LKGGDAIWCVFDCNGNNDKIISTACKNAGHN---VKIILSNPSFELWFLLHFEYYSIKLTNLDLINRLERYLHNYEK-------------------------------SKDYYDLLKSKRENAVANAKRLNELHQIKGINLISDSNPSTQIFTIVEEI 178
421 9.000e-18UniRef50_A0A1I1EMB7 RloB-like protein n=4 Tax=Micromonosporaceae TaxID=28056 RepID=A0A1I1EMB7_9ACTN  ali  26  1............MLITTNGESTERTYFDALKRE-PWISAKVAVAVERGSPTDLVRGAG---------------------------------------RRQRDNDYDEAWAVCDVDHYP-----PEEASAEAQRSGVRLAWSNPCFEVWLLLHLCHHAGYVNAKKARDLLRKHLPHWDKTLLD-------------------------------FDSFRSGVTDACRRAARLD---------PPPAGNPSTSVGELVAAL 163
422 9.000e-18UniRef50_A0A1H4DKV9 RloB-like protein n=1 Tax=Thiothrix caldifontis TaxID=525918 RepID=A0A1H4DKV9_9GAMM  ali  22  13RKGQAQKPAGKTVLIVCEGTKTEFNYFNELCHTYHLQAVHTIKVTAGGSG-------------------------------SNAANILHDAKKRYARSKDNGNAFDHVFCVFDRDDDKGANISFQPTIHEISKKDFQAIYSIPSFEFWLLLHFSYTRQCFNPKQVLTCLQKEYPTYQKNQQGLXXXXXXXXXXXXXXXXXXXXX-------------------AIE----------------CGEHNPSTKVHELIHFL 207
423 1.000e-17UniRef50_A0A256YZI4 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon ex4484_6 TaxID=2012524 RepID=A0A256YZI4_9EURY  ali  21  4.RVRRIRSTNPIYLIVTEGE-TEQKYFEGLRRRCPRKIVNRIYVKNPNDTDLM--------------------------------SLIKYCCDQIHQMELNTGKGDRIFCVVD---YPQNEKVIPNSLKMTGKKGIELIFSRPCFELWFLLHFKRVFASLNNREIMKELKKKLP------------------------------KYRKADKRIFEKMEGMTETAISNAESIGI------TNLSDIRNPSTNVQELVKFI 189
424 1.000e-17UniRef50_UPI000D3E7B5D RloB domain-containing protein n=1 Tax=Polynucleobacter rarus TaxID=556055 RepID=UPI000D3E7B5D  ali  25  16KRKDSIRESSPAMLIVCEG-ITEEIYFKSLRSQLNLKTTQIVIANNKKDS-----------APINLVKKAEEL-------------------------QHQDDGFEIIFCVFDKDQHQSFDSARAKIKKLSSQKPIYEAVSVPCFEFWILLHYKRTDMAFSSREIIELLTK----------------------------NQYIQHYRKCDYLLMLELMEKVDIALQNAIWLENQ------DYIENENPMTSVHKLVQK. 207
425 1.000e-17UniRef50_A0A0E3NTM9 Uncharacterized protein n=1 Tax=Methanosarcina sp. MTP4 TaxID=1434100 RepID=A0A0E3NTM9_9EURY  ali  23  3..RKKGKKPIKTAWIFCEGEKTESYYFSXXXXXXXXXXXXXXXXXXXXXDPVGLVNYSVEF----------------------------------KKHRKDYLPGDLIFCVFDRD--LNSNAALAKAKKIAEENGLSLIFSNPCFEYWLLSHFEYYPQAIEKDLLERKLDRNLGEYR------------------------------KNDPELYTKTRDRIDDAVSNSRQVREKHLEYGVEILSKSNPSTFVFDLIEK. 193
426 1.000e-17UniRef50_UPI0009A9475C RloB domain-containing protein n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=UPI0009A9475C  ali  20  9.RGVAKYKPSPTTLIVCEDSRSGKTYLEDAAHFFRVDAKVLVAHCGYTNPSGIVDFAISKL-----------------------------------------SKFDRVYCVIDRDEHPCFNKALVTAAQHPK---ITMIKSYPCFEFWLLLHFGYSRKPFSRT---------------------GKFSAGDNVGRELRTHQLMDRYDKGSQGVFNTLLGKFEDAQRFAPRVLLDAESSQAP-----NPSTELHLLIDDL 198
427 1.000e-17UniRef50_D8DTT7 RloB-like protein n=7 Tax=Bacteroidales TaxID=171549 RepID=D8DTT7_PREBR  ali  16  11.RQEAFRDAR-LIVIASEGKDTERIYFKALAKEYTNPRVHVHI------------------------------LERSEDEQNNSSPEHVLKQLNDYKEQYALEADDELWLVVDKDRWTESMLSRVAT-ECSQNDYMHMALSNPCIELWLLLHLVDATS-LSPEEQQLWLENRRNSRRTDPYLKTRLRQKMGSYHEAAYDAQM--------------LIAHVEEAIERAKALDKNPADRWPQTL-----GTRVYLLAE.. 214
428 1.000e-17UniRef50_A0A087MC47 Uncharacterized protein n=1 Tax=Sulfurospirillum sp. SCADC TaxID=1537915 RepID=A0A087MC47_9PROT  ali  22  18.RKKAQRS-GDLILIVCEGEKTEPHYIEELLKDLNISNTRAIIEMTG----------DCGSAPQSVVEKAIERFEAKN--------------------------YDHIFCIIDRDKHPTFGIALEKIQAYKWKNTNKAIISIPCFEYWLLLHLKKTTKVF----------------------AGNGQKISPCKECLCELKKELTHYEKGSKSIYALTKDKIDTAIKHAKEVVANKSDEH------QNPITYFHELIEFL 220
429 2.000e-17UniRef50_UPI000D3EDB1F RloB domain-containing protein n=1 Tax=Polynucleobacter rarus TaxID=556055 RepID=UPI000D3EDB1F  ali  22  47.RKNVCRRERGSALLVCEGKCTEPCYLQGLLRYLEISAASVEIIEGQTNSNAIAVVKRARQRFEQVPRDRVFALIDAEQADLTKALKQC-----------------------------EKPLQHENKKKEIPEIRIEPILSSPCFEVWLLLHFRFSDQPFHNASLLPELEVNLPNYQKNDPAIFLKVGGG----------------------------EGLKRAIVNTARLRNALCETGAI-----NPSTDMDKLVEA. 242
430 2.000e-17UniRef50_A0A1Y3Y0J7 Uncharacterized protein n=1 Tax=[Collinsella] massiliensis TaxID=1232426 RepID=A0A1Y3Y0J7_9ACTN  ali  21  20.RPHKKRLRNKRVLIACNAEITEPHYFSMLSESPEFSH---------------------------CSMTIDTKQKRRDPLTLVRAVKTYLDIDAKDAKKEGFEPYYRVWAVADTDDHTVKLDEAQREIKASKAT---LILSNPCFEVWLLDHVCVCPSSCAETKACERLACQKGLVIPTGSNRKASRSRQKEISLTM-------------------IEGKLHTALKNAE----FHNTEEKGLIRKSNPWTDIPKLVKEL 232
431 2.000e-17UniRef50_A0A1Y0XWW6 Uncharacterized protein n=2 Tax=Acetobacter pasteurianus TaxID=438 RepID=A0A1Y0XWW6_ACEPA  ali  18  9.RRKSTVPPSRRVYIFFEGSNSEPDYFYALERSFPCSLIKLVPIKKSGSPDNIVKECLVKKNYLA-------------------------------TKAASYEKNDEIWAVFDKDDFDSFEQAVE----TCRLKNIRVGFSNPCFELWLVLHKKNYTKESNTKEIQKECEKLYPGYLENGKTLNFDKIIKNXXXXXXXXXXXXXXXXXXXXXEYISPSTSLDKLTSRIRRLSDHFPHDD.................... 211
432 2.000e-17UniRef50_R6P9K4 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:343 TaxID=1262796 RepID=R6P9K4_9CLOT  ali  24  12.RLKSKRLAPANYLIVCEGKQTEPNYFNGLKKKINEKY------------GSKVDVLIPNIEIKGTGENTTALVK-----------------YTDKFVNYSNKRYGQVWVVFDKDDYSDEQFD-----KAIKTCDYNVAWSNPNFELWLLSHFKKVNRYISKDNVLQELSKEF-------------------------QKKGLGEYTKNDTNIFEKSEERLHTAIKNCEYMEEL---NKDGQASRKNPMTKVYKIIDGL 209
433 2.000e-17UniRef50_R6M0X8 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6M0X8_9CLOT  ali  25  15.RVRKKRKQKNKIIIAVEGKKTEKLYFNNFDN-GKKSYSISFAKGNYTDPLNLVKMLIEEMKKIGV----------------------------------DLSDGDRAYCIFDTDIEPIKNTVIKEAKKLASLSGIEIITSTPSIELWFLLHYEYTTASMDNKSLINRLKKFYPNYAK-------------------------------NINIFPDINKNINTAIDSTKKLEKHQLENGKIITVEANPSTEIYKIVEEL 208
434 2.000e-17UniRef50_A0A1Q6FGA7 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=A0A1Q6FGA7_9BACE  ali  30  13.........KNNIVILCEGSDTEVKYFCDLKSYVEELHPDSFSDIKILPVADEIIREKKGSRRKKLHSDKHYWCKWEHTDEEYELYKAQPTRYVRETQLYMEEDYVEGWAVFDKDTFTDHQTAFKLAEEI---EGLHIAFSSHCFEEWLLLHFERNPHLFSASVCKN------DDKDRGCGTNVPGDCHGTVCLGGYIREKRYIPDYAKSQESITYTLPHIPLCYLNAAWTRTLS----DNPPYECNPYTNIDMLVKRL 260
435 2.000e-17UniRef50_B0RIU5 Uncharacterized protein n=1 Tax=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C  ali  22  10RRRRPSKPERYVIALFCEGEATEPEYFKALPEIRSRAKLDMRISLTGAVPLTLVESAVAARAR---------------------------------------DEASEYWCVFDV-EWPRQHPHLHEAFELARTRSIRLAVSNPCFEIWLILHMSEHGSHLDNDDARRRRRDLDGAGDKHVDAAAYLPLRAVAAGRARA--------------------------------LELRHERESSLMPHN-NPSTSVYQLVESI 198
436 2.000e-17UniRef50_A0A0D2JA70 Uncharacterized protein n=2 Tax=Dethiosulfatarculus sandiegensis TaxID=1429043 RepID=A0A0D2JA70_9DELT  ali  26  7...........................................................................KQIQATDPFSLVEAALKQAKQFKKDFGFEYTEIWCVFDRDQHTIFSDAQIL----AKKHKVKIAYSIPCFELWVILHYQEQNAEIDPRKLISSLKHKCG----------------------------LDDYDKNGSALFKVLEENREIATIRAKALRRRHEKDDRPPWT--NPSTNMDELMERL 156
437 2.000e-17UniRef50_A0A2G9Z1P5 Abortive phage infection protein n=1 Tax=Candidatus Moranbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_39_10 TaxID=1974675  ali  21  10KRKYEIQDEHRIIYIFTEGEETEPNYFESKKREIRNTNIKIKIKGTGYNTTSLVDYVEDFLVKNNI-------------------------------KIGNSDNSDNYWVVFDRDDFSS---NFDSAVEKAEKLGLKVAYSNECFELWFLLHFNFIDTAIGRKELIKKLDKEI-------------------------SKTNGQSYQKNSKNMYEIIXXXXXX--XXXXXXXXXXXXXXXHSYLKKDPSTTVHLLVNDL 207
438 2.000e-17UniRef50_UPI000C0739E6 RloB domain-containing protein n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C0739E6  ali  20  9..RREGIKSARLVVIAAEGRNTENIYFESMKISLCASDVHVEVLHRDSNNS---------------------------------SPENVYEQIRRFMAEYNIEDDDQLWIVVDKDKWKDKMLSSVAQ-HCAQNSNLRFCVSNPCFELWLLLHVEDI-ALYSKGQLDKLSVNKKINSQDTWLKK---------------RVKDLTGHYHESDYDAMALLPYIDIAIERAEKLDVSPTDRWPQSI-----GTRVYLLVKSI 210
439 2.000e-17UniRef50_A0A0E3P3H7 Uncharacterized protein n=5 Tax=Methanosarcina TaxID=2207 RepID=A0A0E3P3H7_9EURY  ali  21  10KRKENTRYPRGNVYIFCEGLKTEKTYFERYKSKI----------------------CQGRCIRRKLPEVKVIPSKNCGAIANIEFINSYA-----RNEGVSDRDGDCLICVIDCDANKSENINQAIKLAKGNKNKVNICLSNPSFELWYLLHFELCDKPLSQEGLEAKLKNYISDY-------------------------------KKNVDYYDVLEKDMEIAMMHAEYLKKHHFENGIKLLSESNPSTMVPYFLKHI 215
440 2.000e-17UniRef50_A0A1G7MH31 RloB-like protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1G7MH31_CHIFI  ali  20  16.RKEDTIN---LYIIFCEDAVSEPVYFRSFQND----NLKINAIPNQRKGKLNLEATVTQCKKDGLIEFA------------------------ENGYRIKDDRTENIWCVYDRDFQPAKNTAWDLAIQTASTAGLKLAWSNDAFELWILLHFEEIAQPVHRDYIYERLTEIFKAIQPRDAALDAIIKHPKFGYKDSFKHLNAF-----YTHILPLLKGKTNEALHRAATLAAYH--NGNTTFYERNPCTLVHTLVTEL 245
441 2.000e-17UniRef50_A0A1R1SQ63 Uncharacterized protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1R1SQ63_9ACTN  ali  18  2............VYVFTEGTLTEPSYIDALIRFRQQARDAGTFTAEGVESTVEIMWD---ERTHGGTRGPKRLAHERKPLTIVEAAIAHKKKVTREARHLRKQYQPSVWCLFDRDDHQGVQRA----AGMAQKAGVEIAYSHPCFELWRLLHYQDYTTPLGCGEVSARLRRN-PKFIKTYGRHLTSVSDDQAKLVL-----------------PSQVEGGYQQAKKFAKKINEQHTSPDRE---KWDPYTDVWRFVE.. 220
442 2.000e-17UniRef50_UPI0009FD6F71 RloB domain-containing protein n=1 Tax=Curvibacter lanceolatus TaxID=86182 RepID=UPI0009FD6F71  ali  26  79.........................................................................................................DRIVVVFDRDEHQTYHANGKLKNDEGAAVQLDVVVSVPCFELWLLLHFEDVHAPLHRHEALERLKAYLP------------------------------DYEKGGGGHWGKTQAHLSHAIERAHHLAAQNNPNDGIQ-----PYTAMHELVSRL 205
443 2.000e-17UniRef50_A0A1U7NMM7 Uncharacterized protein n=1 Tax=Dubosiella newyorkensis TaxID=1862672 RepID=A0A1U7NMM7_9FIRM  ali  23  3...........TYYIFCEGKKTEPNYFEGFVRYADPEQVKINCFGLGKETLRILELAQNYIRKNEIKQ-------------------------------------SHIWLVFDRDDFVAKNFDKELDQKRKGGNTYRCAWSNECFELWILLHFSYYQTLFHRDEYIRLLKKIFRKHGFLTYKKQEQDLFEIVLKIGDPHL-----------------------AVQSAKKLALQQQK---KRPSQARPCTYVFELVLEL 193
444 2.000e-17UniRef50_UPI000873D4B8 RloB domain-containing protein n=1 Tax=Listeria monocytogenes TaxID=1639 RepID=UPI000873D4B8  ali  26  4RSQDRSKSLNNSYFVVCEGE-TEKNYLKHLRQKYSRGNVEVKTVTGSGQAYELVEYTIKTINNRG---------------------------------KAFKKSIKKTYVVFDKDE--IEATKIQKAFKLASKNDINICFSNINFDLWLLLHFQELQK-------ERVIEVKKLNDNLAEVLNIANWC-----------------EHKASPKICEKLTDKIQQAFNNWEKIKENNKEN--------NPYTDVPKMLQEI 194
445 3.000e-17UniRef50_A0A1I2WL82 RloB-like protein n=1 Tax=Sporolactobacillus nakayamae TaxID=269670 RepID=A0A1I2WL82_9BACL  ali  24  14RRQTGQRSQKNLILIVCEGKQTEPNYFRGF------KLTNVDVEGAGAGPMTVVERAKEIILE----------------------------------QRKLGKNYDQIWCVFDRDDFSAERFN-NAIMTTRQLRNFHSAYSKQAFELWYVLHYEYLNSGITREDYFKKTSNLF...................................................................................... 146
446 3.000e-17UniRef50_A0A0F5YHQ0 Uncharacterized protein n=2 Tax=Oscillatoriaceae TaxID=1892254 RepID=A0A0F5YHQ0_9CYAN  ali  24  12KRTRGQRTPRKLILIVVEGQETEYNYFNDLKAELRLPTTEIKVYSGSGGDPCQVVEKANS------------------------------------YRNQMTSKPDEVFCIFDYD---NKLEKYKQAIKKAQDYGFEEITSIPCFEIWLLLHFQYTSRSFNCSEVETQLQRELVNASSVNKTTNYDKSLRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXH-------------------------ANPSTKVHLLVKKL 208
447 4.000e-17UniRef50_A0A257S6T2 Uncharacterized protein n=1 Tax=Acidiphilium sp. 21-60-14 TaxID=1970292 RepID=A0A257S6T2_9PROT  ali  18  13.RAVAVRDAR-LIVVATEGEKTEEIYFSIF----RSTKIQVKIIPCSGG---------------------------------KSAPEHVFHRLLEYREQFQLEGDDELWLAIDRDKW--KDKSLSEVARRCKNEKIGLALSNPCFEIWLSMHYAKFSESLNSTQATKLFRKHHGSFNKSKFDAVS-------------------------------LIPKVPTAIANAKALDDRPKLRWPIKT-----GSRVYRLVESI 195
448 4.000e-17UniRef50_C4FFP6 Uncharacterized protein n=5 Tax=Bifidobacterium TaxID=1678 RepID=C4FFP6_9BIFI  ali  15  10..RGKSKPRSKRFLIYSGGIVTEVEYFQYVRRHLFGDYVRNLRIK-SGEVRDPVCVEAEGVDPKTLVDDATRLLRED----------------KKDAKKESYDPFAVVWAVADVDDFGKNGDKLRAAVDKGYRSGVEVIISNPCFDVWLIDHKQSCPLSYTETSECEKLAKNLQLIDMSRNRNNPKHICQKS------------------------IAGKYAAAAKNAQKMNERHRLIRDNRPSSGDPWTDIPKIVDTL 228
449 4.000e-17UniRef50_A0A026UIH2 Uncharacterized protein n=11 Tax=Enterobacterales TaxID=91347 RepID=A0A026UIH2_ECOLX  ali  22  3...KNVRKLEKRMHIFCEGSKTEPMYLQGYIDEFASEKAKVIHIP----------------------------------DIKYNTPIALVKAAIKHKESGDTSDDDEFWVVYDREAVTKYPHTLHEAWDLAHANNINIALSNVCFELWILQHFAFKNTPYSSFDDLKKNSTLKKDLLSVGIK----------------------DYNKADATLYKKIRLGIPNARQRAKALNKQSLNAA--PPHSNRPYTNVNELLDAI 206
450 4.000e-17UniRef50_A0A1G0E5L8 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium GWE2_37_16 TaxID=1798261 RepID=A0A1G0E5L8_9GAMM  ali  23  20.RRRGFRNILPRILILCEDSKSSKYYFEEICKEYKLQKIVV-IKHPDTAPCKIVECAKQHEA-----------------------------------------EYDKIFCVFDYDDKDESYKKALNLIGKTKK--IIPITSHPSFEYWLLLHHVLHEAPFHKT-----------------------GNHSIGEMVERELKKHINDYSKDAKNIFQKTKDKLEIAIQHAKQRLRACESYDARK-HLSNPSTFVHELIEYL 209
451 5.000e-17UniRef50_Q4C8M1 Uncharacterized protein n=2 Tax=Crocosphaera watsonii TaxID=263511 RepID=Q4C8M1_CROWT  ali  24  2........................................................................................................................EKLFQQTLNKAEKQGFEVAYSNEAFELWYVLHFEFLNSPIPRKEYLKKLNTLLGK-----------------------------QYTKNSDTIYDELLDRQETAIRNSEKLLKQY---HKSNPGQDNPSTTVHLLVKAL 108
452 5.000e-17UniRef50_F4KVX0 Abortive phage resistance protein n=2 Tax=Haliscomenobacteraceae TaxID=1937961 RepID=F4KVX0_HALH1  ali  25  27.....SREQAKVFLIICEGMNTEPLYFKAF----PLGNAKVDSYGLGSSKTALVEYVIQNVV------------------------------------SDRNNTDKEIWVVFDPDQVEQQKEDYNRAIELAANKGIKVAYSNDSFELWFLLHYQYLELKWTRHQYYQKLEEWWECNYEKEGKKSEFCR-------------------KIYQKLKDDPRADQTEALNRASRLFEQQAE---VSFAERNPCTTVYDLVKAL 222
453 5.000e-17UniRef50_A0A2S1LQ10 Uncharacterized protein n=15 Tax=Bacteroidetes TaxID=976 RepID=A0A2S1LQ10_9FLAO  ali  21  27..KIDTIPVNKIILIVCEGQ-TEKLYFESFP----------------------------------------VLGMKVEAIDLRGQSKLKLIESTQKIIEISDSEYDGVWCVFDMDVKRGAEEDFDNSIEKGIELGYNIAYSNDSFELWFYLHFEYTDAEHLRGFYYDELGKKFGINYVREGKKYAFCLQLYNTLMEDEN-------------------SSQEKAIDRAEKL---FKKVKDLPFHQQNPVTKVFELVKEL 222
454 6.000e-17UniRef50_E3H072 Uncharacterized protein n=3 Tax=Rothia TaxID=508215 RepID=E3H072_ROTDC  ali  17  18..RSKDRVPKRNFLICVEGEKTEPKYFKMLTEHIKNLGINTDIK----------VVKPKGSDPASILKGCLSYLREAEND---------------------GNAYDDCFCVVDVDAHATLDQAL----RDARSHHISMVVTNLKFEVWLLWHVGDQPGGYANNHQLDTLVKKLSNSGKAPLLT--------------------GSNYKGLHPNFP--IENYRDAVKIARQKDPQMAFNRKG----QNPSSAMPLLIEKL 213
455 6.000e-17UniRef50_A0A1G0YNG7 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium GWF2_44_16 TaxID=1798571 RepID=A0A1G0YNG7_9BACT  ali  24  3KRNKEKRSTSK-IFIFTEGEKTEINYIKGYIK---------------------------------AKNYPMTRFVLRQPENHVPYGLLKEVRKTKKKKQCKFENGDIIWLVFDRDKHDRIPATYDEARNVGK---IGIAFSAICFEVWLMLHFHNKIGPFSSCDADKRFSDYIKDYEKNTGKIFDEVGGLY----------------------------GLETAMKNAEKLIEEAEKNPGRKIYEMNPYCNIHLLIKTI 200
456 6.000e-17UniRef50_UPI00055D9330 RloB domain-containing protein n=1 Tax=Ochrobactrum anthropi TaxID=529 RepID=UPI00055D9330  ali  23  9.RKLNVIAKRPVFVLVVEGENTEPEYFEELCRRNNQIIADIETIGAAGDPSAIARQATAIR-----------------------------TRQLTRKYIRDNGANDRVWAVFDRDEHHHFDAAL----KSCSAGDVEVAYCVPCFELWLILHFQDYDKDETRHDTQKACEKACPGY................................................................................... 150
457 7.000e-17UniRef50_E3D7E0 Uncharacterized protein n=22 Tax=Bacteria TaxID=2 RepID=E3D7E0_GARV3  ali  16  9.RSKKQSKRNKRFLIVCGGVVTEFEYFSYIKSEVSKYCATSWDIH------KSINIEKEGVDPLTLTNYAIKLER----------------LDCKEAKKENYNPFTLVWVVTDVDEFGEKIQQ-AQSKSDSTCGKIKLVISNPCFEVWLIDHIKSCPLSCTETRDCQKEAKELG-------------------------LLHNTTGNKNKHIQLEKLTGNYKNAFKNAKQIENRKNHPSVTQKSNYAPWTDVPEIVETI 224
458 7.000e-17UniRef50_A0A1I1XUR2 RloB-like protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1I1XUR2_9BACT  ali  20  21..........KTFILFCEDKISEPSYFKEFAKEYK---VRISEAVDQKSSFKNIANTLEYCEKEGLLETDNKAYKIRSDVKTP------------------------IWCVFDRDVETNNPDNFNLSIQSAESAGLNVAWSNDVFELWILLHFEDVTEWKHRTYIYDRLTAIFK-----ALPDKSPELTALTELSTFNYKTFFKTEKNFNFHVLPRLAAGRADAIVRAQILEAAFIH--TQKSHERNPCTMVHHLVSSI 245
459 7.000e-17UniRef50_A0A1Y1QW34 Uncharacterized protein n=1 Tax=Thiothrix lacustris TaxID=525917 RepID=A0A1Y1QW34_9GAMM  ali  21  13RKKQAQQPTGKTVLIVCEGTKTELNYFKEIRKSYDLQAVHAVEVTAGGAG-------------------------------SNAANILHDAKNRYNRSKDNGNAFDHVFCVFDRDDDKGANVSFQPTIDNINKKDFEAIYSIPSFEFWLLLHFSYTRQCFNPKQLLTCLQKEYPTYQKNQQGLXXXXXXXXXXXXXXXXXXXXX-----------------------------------ATQCGEPNPSTKVHELVNFL 207
460 7.000e-17UniRef50_D4MLQ1 Uncharacterized protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=D4MLQ1_9FIRM  ali  19  17RRDRRITIAPEYHLIVTEGTKTEPQYFEGLKEDINRLY--------RGRISIVIEGVGQGANTLNLLERAQKIVENDPDKYKHIWLVYDKDDFPKDDF-------------------DNTFFKCKSLSGNGNSVVYHALWSNECIEYWFLLHFMALDSALHRNEYYPKLTACLGS-----------------------------KYKKNRKDIYALLKPNIKRAIDNAKRIEANNE---GRAPSQFTPGTAVYEIFEML 216
461 8.000e-17UniRef50_A1VT59 Uncharacterized protein n=39 Tax=Proteobacteria TaxID=1224 RepID=A1VT59_POLNA  ali  20  10.RKKPSLKPQARVLVICEDTKSSLQYLKDAAHHFRAYAEVDIVHCGKNDPLNIVKEAMERQRL-----------------------------------------FDHVYCAIDRDRHENFDEALELAKANAQK--VSLIASYPCYEFWLLLHFQKTRKPYI---------------------GVGKHSSGDLLIKDLCKVAGMENYAKGSSNLFDRLIDRLPKARQLAAQVMAEALNEG-----ELNPSTRLHELIE.. 197
462 8.000e-17UniRef50_Q3B4R9 Uncharacterized protein n=1 Tax=Chlorobium luteolum (strain DSM 273 / 2530) TaxID=319225 RepID=Q3B4R9_CHLL7  ali  21  17.RKLGRRASYERILIVSEGSKTEPNYFEEIRSTLRLHTANVVVRPGE-----------LGTAPFQVVHYAKQLFLEGDRHRNIQRLA-----------------FEQVFAVFDRDDHKNYSNALNARNDNRQLIRFQAIPSVPSFELWLLIHFENIQSPINRHAVL............................................................................................. 161
463 9.000e-17UniRef50_UPI0009E5524D RloB domain-containing protein n=1 Tax=Leclercia TaxID=83654 RepID=UPI0009E5524D  ali  22  17.RKQNRRASYDRILIVSEGSKTEPNYFREIRTIYRLHTANVEVRPSEGTAPIQVVQYAKELFEKG-----------------------------DRHKDIQPRAFEKVCAVFDRDDHDSYFDALKLRNDAKQAVTFQAIASVPSFELWLLLHYEDIQAPLHSH................................................................................................ 158
464 9.000e-17UniRef50_A0A1I1T6B6 RloB-like protein n=1 Tax=Chitinophaga sp. CF118 TaxID=1884367 RepID=A0A1I1T6B6_9BACT  ali  17  11.RKGFNRDTQKLFVIAAEGTETEIKYFEEFKSPQWYHNKAVFIEPLRRIDNSS-------------------------------SPSRVLRQLKEFKKEYRLKDGDELWMIIDRDKQSWKISEISDVAQKCQQAKFGFAMSNPAFEFWLLLHITALT-----------------DYSEDTKREFLDNRKTGDRTRVEMELLHLLGSFNKSNINTNHFLPHLNLAIQRAEEQDNNAGERWPNQL-----GSHVYKLIRKL 215
465 9.000e-17UniRef50_UPI0009A59608 RloB domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=UPI0009A59608  ali  19  14RRRPSTQAQRFQIRIFAEGKETEVGYINHYFRRHRDQVLVSVAEHQGSAPLTVVEAAVAER-----------------------------KYDLREEKRRRGSAYDEYWCMVDVDEHYGLDDALQLAAA----NGVKVALSSPCLEVWFLLHDRLQAAFLDGHAAQHESKKLLGCDKTLSDTAXXXXXXXXXXXXXXXXXX------------------------------XXXHRGDGTQKP--WNPGSNVWELIETI 207
466 1.000e-16UniRef50_A0A1H7HBB4 RloB-like protein n=1 Tax=Pseudobutyrivibrio ruminis TaxID=46206 RepID=A0A1H7HBB4_9FIRM  ali  23  9KRGNKKRRQKAVYLIIAEGRKTETLYLTNFQDQSKSFIIRFVKAGSNTDAESLYKTMVAKWKELGL----------------------------------DANEGDKGFIVIDMDNDEQKAEKIATLINKNSNDAISFVVSNPTFEIWFLLHFKYTTKFYDGNAVIDDLKKYISN</