current user: public

If you have questions about the server, please let us know.

Query: PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst MEGHEEVRTGWSRWDSLWPFLLFYCNFLKGVFLLRIAVVDGQGGGIGKHITARLRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFLLPINRSGVEVIGVTPEPLPHLIEALVNRVKFFYQEGGDKDLast
1 9.000e-75UniRef50_A0A0S6U749 Uncharacterized protein conserved in bacteria n=26 Tax=Bacteria TaxID=2 RepID=A0A0S6U749_MOOTH  ali  100  7MEGHEEVRTGWSRWDSLWPFLLFYCNFLKGVFLLRIAVVDGQGGGIGKHITARLRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFLLPINRSGVEVIGVTPEPLPHLIEALVNRVKFFYQEGGDKD 181
2 1.000e-54UniRef50_A0A1V1RHZ5 Uncharacterized protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V1RHZ5_9ACTN  ali  46  1.................................MRILVVDGMGGRIGQEVVVRLRQAFGEEVEVLAVGTNSTATTAMLKAGANRGATGENAMRVTVREADVVIGPLSLVVPDSMMGEVTPGMAQALASSSARKVMLPLTNPRIDLVGVTKTPLPHLLDEAIDIVSSMRRKEVDD. 141
3 2.000e-54UniRef50_UPI0009DCA6C1 DUF3842 family protein n=1 Tax=Lachnospiraceae bacterium V9D3004 TaxID=1410632 RepID=UPI0009DCA6C1  ali  37  81.......................YCNMTCSEKKKKILIIDAQGGGIGKQLITGIKSAVP-EAIITAVGTNTTATSNMLKAGADTAATGENAVIVGCRKNDYIIGPMGIVIADSMNGEITPAMSVAVAQSEAVRILIPFNHCDTYIAGTPGKGTGILVKEAIDYLKNRL....... 224
4 4.000e-54UniRef50_UPI000B98FD92 DUF3842 family protein n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B98FD92  ali  53  1.................................MKIAVVDGQGGGLGRSIIEKLSKEISGMATIIALGTNSMATASMLKAGANEGGTGENAIVVNANRVDIIVGSVGILAANSMLGEFTPKMAEAVASSSAKKILIPLNRCGLEIVGTNSESLPGLIDLLVLRVKEICNANG... 139
5 3.000e-53UniRef50_C0QKC4 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=C0QKC4_DESAH  ali  45  1...........................MKPATTYRICVIDGQGGGIGSTIIRKIKDRFGETVEVLALGTNAIATAQMLKSHANRGASGVNAIVQTVRTADLIIGTVGIIMPHAMMGELTPKMAEAIALSPAKKILIPLTQEHIEIVGLASTPLPQLVDELIDA............ 136
6 3.000e-52UniRef50_A0A0U9HP09 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0U9HP09_9BACT  ali  54  1................................MIKIAVIDGQGGGIGSFIIKSLRESFGDKIEIIALGTNAAATANMMKSKANKGASGENAIVWNASKVDLIIGPLSILVANAMMGELTSKMAEAVGNSPAKKFLLPINQEGIEIISVVKEPLPHLVEKLILHIKEEFN...... 137
7 1.000e-51UniRef50_A0A2V2C4Q4 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2C4Q4_9FIRM  ali  47  1.................................MVILVVDGQGGGIGRAVIERLKSEIGPEHEIMAVGINAMATMGMMKGGAKNIATGENAVIFNAQRADIIVGSIGIVAANSMFGELTPAMANAVSESRAVKVLIPLNKCGLRVAGVSSDTLPAVMDDAVRMVKEILDKKSADN 142
8 1.000e-51UniRef50_A0A1W9SYW5 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1W9SYW5_9DELT  ali  48  1................................MFKICVIDGQGGGIGSTIIKKLKDRFGESVEIIALGTNAIATAQMLKAKANKGASGNNAIIQTVKKVDLIIGTVGIIMPHAMMGELTPKMAEAISLSPSPKILLPLTQENIEIIGFSFTPLPMLVDELIDI............ 131
9 2.000e-51UniRef50_F3B8W9 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=F3B8W9_9FIRM  ali  40  1.................................MKVLIIDAQGGGMGKQLVSAIKQEFPA-AEITAVGTNSMATSNMLKAGADHAATGENAVVVGCRRAEIIIGPVGIAIADSMYGEITSKMAEAVGQSEARKLLIPMNHCNNIIVGVGNTSMSFLIASVVEELIEY........ 133
10 2.000e-51UniRef50_A0A1C5P4L5 Domain of uncharacterized function (DUF3842) n=1 Tax=uncultured Eubacterium sp. TaxID=165185 RepID=A0A1C5P4L5_9FIRM  ali  44  1.................................MRVAVVDGQGGGIGRAIVEKVKKVFP-ELEVVALGTNSVATGQMLKAGADDGATGENAIIHNMQHVDIVMGVVGIINANSMMGEMSPAMASAIGGSHTYKILLPINRCHIHIVSVEELSVSGHVDNAVKALGHFLKTKS... 138
11 2.000e-51UniRef50_A0A259UHU9 Uncharacterized protein n=2 Tax=Sporomusa TaxID=2375 RepID=A0A259UHU9_9FIRM  ali  37  1.................................MLIAVIDGMGGGLGVQLVTHLSSQLGQKADIIALGTNALATNNMVRAGAMRGASGENAVIVSIRKVDVVVGPIGIIIPNSLMGEITPKIAEAVASADAHKVLIPVNQQHFDIVGLESRPMVTSIKEAVAKVSELIQGKS... 139
12 3.000e-51UniRef50_A0A2N6BPB2 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A2N6BPB2_9DELT  ali  56  1.................................MTIAVIDGQGGGIGSHIVRRLREELPPEVDIVALGTNAVATQAMMKARANKGASGANAIKVTAPKVDAIVGALAIIAPHQMMGEVTPEIAEALLLSPARKFLLPLRIDGITLAGHTSVPFPHLIDKLVGELKRCFFDSGVEN 142
13 3.000e-51UniRef50_S5ZM91 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=S5ZM91_9SPIO  ali  40  1.................................MKIIVIDGQGGKIGSILIKQLMQEMP-EAEILAIGTNSAATGNMLKAGAYAGCSGENPVVVQCKDADIIAGPIGISIANSLLGEVTPKMANAVWKSRAEKILIPCHRCRLHIPGVEDKKISELIGEAVSIIKDIVSGKK... 138
14 8.000e-51UniRef50_E1QIM5 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=E1QIM5_DESB2  ali  49  1.................................MRICVIDGQGGGIGSVIIRRIKDEFGENVEVLALGTNAIATAQMMKARANRGATGENAIIVSIQEADVVIGPVSIVLANAMMGEVSPAIAQAVATCRARKFLLPLTRENVEIVSVNHEPLPHQVDQIIQVLKEMMKD..... 138
15 1.000e-50UniRef50_UPI00082ACF83 DUF3842 family protein n=1 Tax=Clostridiales bacterium MCWD3 TaxID=1766203 RepID=UPI00082ACF83  ali  44  1.................................MIVAVIDGMGGGIGSKIVSALRDELPSYVEIYALGTNSAATSAMMKSRANKGATGENAVAVSIRNASVIIGPVSIMMPNAMMGEITPRIAESIMLADGLKILLPIMQENYEIVGLENKPILLLIKDAVERIKKEFN...... 136
16 2.000e-50UniRef50_D7GPK2 Uncharacterized protein n=42 Tax=Bacteria TaxID=2 RepID=D7GPK2_9FIRM  ali  40  1.................................MTIMVIDGQGGKMGKGLVEQLKKLCPED-EILAIGTNSIATAAMLKAGADAGATGENPAVVTSRTADIIVGPMGIVIADSLMGEITPKMAVAIGQSLAQKVLIPVNRCQHFVVGCRDISMGEYVKLAVEEVLKIRRGE.... 137
17 2.000e-50UniRef50_A0A259UFY0 Uncharacterized protein n=1 Tax=Sporomusa acidovorans DSM 3132 TaxID=1123286 RepID=A0A259UFY0_9FIRM  ali  53  1.................................MYIAVIDGQGGGIGKVIIDKVRKEFHNSVEILAIGTNSQATSAMLRAGANEGATGESALICNVDEVDLILGSLSIILPKSMKGELTGKMAKRVVVSKARKILLPIHRNNIDLVGIHSEPLPHLVDAMVAQMKQYIVSEGRE. 141
18 3.000e-50UniRef50_X1MCQ0 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1MCQ0_9ZZZZ  ali  36  1...............................MGIKIAVIDSMGGSIGSQIITQLRQNFGHKIEIIALGTNAIATSNMLKAKANRGATGENAIKITIEEMDLIFAPISVLIPNSMMGEITPAIAEYIRKFKKKRLFIPLCNPPLTILGVEKKPLPRLIDEGIEIVREMIKKNE... 141
19 3.000e-50UniRef50_D9R6X1 Uncharacterized protein n=48 Tax=Bacteria TaxID=2 RepID=D9R6X1_CLOSW  ali  41  1.................................MKVVIIDGQGGKMGQSVIAQLKKSLPKLP-VVAIGTNSIATSAMLKAGADAGATGENPVIVASRDADLIIGPIGIVIADSLLGEITPAMAEAIGRSRAYKILIPVNRCNHYVVGCEDLTLTESIAQVIKQVENLL....... 134
20 3.000e-50UniRef50_UPI000C865608 DUF3842 family protein n=1 Tax=Clostridiales bacterium Marseille-P2846 TaxID=1852363 RepID=UPI000C865608  ali  45  1.................................MRIAVIDGQGGGIGRALCQELSQKLTPPHELIALGTNALATASMLRAGAHRGATGENAVVRGARSADVIVGPIAIALSCSMLGELTEKMAAAVGESDAYRVLIPTERCNTHVVGAGDRPLTALLQEAVSAVLAYVENAAE.. 140
21 4.000e-50UniRef50_A0A069A5C6 DUF3842 domain-containing protein n=18 Tax=Clostridia TaxID=186801 RepID=A0A069A5C6_CLODI  ali  47  1.................................MIIAVIDGMGGGIGAQIVSSLREELPTYVEIYALGTNSIATSSMMKAHANKGATGENAIVVSAKKANIIVAPISVIIPNSMMGEVTCNISEAIADSEALKILLPIMPENVELVGLEGKPLALLVKDSVNLIKKEFN...... 136
22 5.000e-50UniRef50_H6LD25 Uncharacterized protein n=14 Tax=Firmicutes TaxID=1239 RepID=H6LD25_ACEWD  ali  41  1.................................MNIVVLDGMGGGIGSRIVGILKDEIPPYIEIYGLGTNALATAAMLKKGANKGATGENAIAVTVKKADFIIGSIAMTIPNSMMGEVTPKMVEAIGNSDGLKIYIPILPENHHIVSLEEKPLLLQIREAVSLIKKELNLGDV.. 140
23 5.000e-50UniRef50_G7WA60 Uncharacterized protein n=6 Tax=Clostridiales TaxID=186802 RepID=G7WA60_DESOD  ali  56  1...........................MRNEDRMRIAVIDGQGGGIGKHIVEQLRKRFP-EMYVLALGTNALATGAMVRAGATEGASGESAICFNANQVDMIVGSFAIMMVYELLGEITPAMAAAISASKAEKLLLPIQRGSIQLVGIPRSPLPHQIEVLVNEVEERMK...... 141
24 6.000e-50UniRef50_UPI00056F4B59 DUF3842 family protein n=2 Tax=Bacteria TaxID=2 RepID=UPI00056F4B59  ali  43  1.................................MQIVVIDGQGGGMGRSIVERLKDALP-EAEVVAVGTNALATSNMMKGGANAGATGENAVVYNCARADVIVGPLGIILPNAMYGEVTPKMAMTVSGCAADRVLIPAVKRHVHIIGIQEKTISQYIDEAVAEIKRHCGSE.... 138
25 1.000e-49UniRef50_A0A2M9DNQ8 Uncharacterized protein n=1 Tax=Desulfofaba hansenii TaxID=157842 RepID=A0A2M9DNQ8_9DELT  ali  47  1...............................MKKRICVVDGQGGGIGATLIKYIKAEYGETIEIIALGTNAIATAQMLKVGANCGASGENAVCRMVARVDCILGPIAITWANAMLGEVTPKIAEAVMSSTAVKILLPLSQENVAVVAVLKEPLPHMVRAAMGILKKEME...... 138
26 2.000e-49UniRef50_H1AIA5 Uncharacterized protein n=8 Tax=Firmicutes TaxID=1239 RepID=H1AIA5_9FIRM  ali  43  6..............................GSEMEVVVIDGQGGGIGRSVIEALKKEVSGTF-IIAVGTNSTATNNMKKGGADAVATGENAIIYNAKNAQIIIGPIGFVFANSMYGEVSPAMAAAISCSEAQKYFIPVSKCTGHVLGVEPKSIQEYIRDLVNILK.......... 139
27 3.000e-49UniRef50_F7NEK4 Uncharacterized protein n=24 Tax=Terrabacteria group TaxID=1783272 RepID=F7NEK4_9FIRM  ali  45  1.................................MVIAVIDGMGGGLGVQLVSLLSAQLASKVEIIALGTNALATNNMVRAGAHRGATGENAVIVSIRKVDLVTGPIGIVIPNAMMGEITPQIATAIAGCDARKVLLPVNQNHVEIIGLDARPMAAVIKDAVFRISEIVKEGAAQ. 141
28 6.000e-49UniRef50_A0A101H9V9 Uncharacterized protein n=1 Tax=Clostridiales bacterium 38_11 TaxID=1641393 RepID=A0A101H9V9_9FIRM  ali  42  1.................................MMITVIDGMGGGLGVKIILDLKKRYDERIKILALGTNSTATAAMKKAGADLAATGENPVVVNCKKATLILGPIAIITPDGLMGEITPRMAEAITLSDAKKILLPSDRCNIDVVSTPRLNMTDLIKELVDRVGEEL....... 136
29 1.000e-48UniRef50_G2FPX2 Uncharacterized protein n=226 Tax=root TaxID=1 RepID=G2FPX2_9FIRM  ali  58  1.................................MRIAVIDGQGGGIGKHIVEQLRKRMP-ELDILALGTNALATGAMLRAGATEGASGESAICFNSDRVDIIVGSIAVMMVYGLLGEITPAMAMAISASRADKLLLPIQRGNIQLIGVVRIPLPHQIEALVTEVEERLKGK.... 137
30 1.000e-48UniRef50_A0A0J8Z1G5 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=A0A0J8Z1G5_9FIRM  ali  41  1.................................MEIVVIDGQGGGIGKNIIQVLKEKHP-EYTIIGVGTNSMATTQLKKGGADIIATGENAVVYNAKHASIVVGPIGIAFANSMYGEITPAMAKAIGESEARKYFIPVSKCSAQVVGVASKSISEYIDDLVVMIEKLEK...... 135
31 2.000e-48UniRef50_A0LLI3 Uncharacterized protein n=19 Tax=Bacteria TaxID=2 RepID=A0LLI3_SYNFM  ali  51  1................................MIRIAVIDGQGGGIGATVIKRIKEVYGERVEVWALGTNAIATSQMMKARANRGATGENAVCHCAGRVDVIVGAVSILLAHSMMGEVTPAMVNAVGASKAHKLILPLTQEPLTVVGAGREPLPHLVDKLV.............. 129
32 6.000e-48UniRef50_J5UK85 PF12953 domain protein n=6 Tax=Firmicutes TaxID=1239 RepID=J5UK85_9FIRM  ali  44  1.................................MDILVIDAQGGGIGRQLVTKLTERLP-EAEIVAAGTNSMATNAMVKAGAKRAATGENAIGFCAARAQIITGPIGILVANAMLGEITPTIAESVGTSEAPKVLVPTAYCNVMIAGTKELPVKECIEDAVDRIVRMYSRGNN.. 139
33 1.000e-47UniRef50_A0A1I5VTF3 Uncharacterized protein n=2 Tax=Oscillibacter sp. PC13 TaxID=1855299 RepID=A0A1I5VTF3_9FIRM  ali  43  18................................EIKVAVIDGQGGGVGRALVEHIKRAYPDLH-VRALGTNSAATAVMMRAGANDGATGENAIVYNASRMQVILGPIAILVGNGLLGELTPAMAAAVGGSDAVKILLPSQRCSIRLAVGPLQPMQVYLEKAIRQLGEELQR..... 154
34 1.000e-47UniRef50_UPI000C266E78 DUF3842 family protein n=1 Tax=Sporolactobacillus pectinivorans TaxID=1591408 RepID=UPI000C266E78  ali  28  1.................................MKIAVLDGQGAGLGQSLIKKIRQELPQNLTIIALGANTFATSKMVRAGADIGISGEKGFCSFCRRIDCIIAPIGMMQPGSIHGEITKSMVHAFSDLSCCKYLIPLRHPKICIPGTANIPIKDCMEDIIIAIRHQMKQSLLEK 144
35 1.000e-47UniRef50_E3PXY0 Uncharacterized protein n=21 Tax=Clostridiales TaxID=186802 RepID=E3PXY0_ACESD  ali  41  1.................................MIIAVIDGMGGGIGSQVVHALRDELPSSIDIYALGTNAIATSAMMKQKANKGATGENAIRVSSKNANIIICPFSLLIPDSMMGEVTLSISESITQSDAYKIILPILPENYSVIGLEAKPLLLMIKDAIDIIKKEFS...... 136
36 2.000e-47UniRef50_A0A176U5P5 Uncharacterized protein n=26 Tax=Bacteria TaxID=2 RepID=A0A176U5P5_9FIRM  ali  39  1.................................MKIVVIDGQGGRMGSAFIDKWIKSGGDPKELIAVGTNAMATSAMMKAGAVKAATGENPVVVNTSGADFVVGPIGIIAADALLGEITPKMAQAVASCTAQKVLLPVNTCMFHVVGVSDNRLSDNIDEAISYILQ......... 133
37 3.000e-47UniRef50_A0A1G9PHC7 Uncharacterized protein n=1 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A0A1G9PHC7_9FIRM  ali  39  1.................................MQLAVIDGMGGGLGAQLTEKLDGAIGDEVEIIALGTNAQATGRMLEAGADRGASRDNAIIHMSGRVDIIAGPLGIMIPNSMMGEISPAVAEAVAKSGAKKFILSIQQPHFELVGRKSNSLDELLDELTEEIAGYVEGESGE. 141
38 3.000e-47UniRef50_A0A161QBG3 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A161QBG3_9FIRM  ali  47  1.................................MIIAVVDGMGGGIGSQIISLLRQDLPPDVKIYALGTNSAATTSMMKEKANRGATGENAIVTTVKKVDVIVGSLGIVIPNAMMGEITEKIASAIVESRAKKILIPLVDCDIVLLGIEKRPLFLSIKEAIEKIK.......... 133
39 1.000e-46UniRef50_A0A1Y4LQ89 Uncharacterized protein n=2 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A1Y4LQ89_9FIRM  ali  40  1................................MAKIVVIDGQGGRLGKLLVEEVKARLP-QAELLAVGTNGIASSAMQKAGASQVATGENPVVRGVMDADVVLGPLGIVVAHAILGEVTPKMAEAVGGCRAKKFLVPMNSCGVVVAGVQELSLSAHVRQAVDRAVEFLEGAS... 139
40 1.000e-46UniRef50_A0A1M5UY16 Uncharacterized protein n=1 Tax=Clostridium grantii DSM 8605 TaxID=1121316 RepID=A0A1M5UY16_9CLOT  ali  45  1.................................MKIAVVDCQGGGIGKKIIEKLKENLSEKIDIIALGTNSIATMEMLKAGATSGATGENAIKVMSQKVDIISGPIAICVPNSMLGEISSEIAFSIGTSDAKKILLPLNRCGLLVAGVKDCKIVELIDDLVDLIIKEI....... 143
41 2.000e-46UniRef50_A7VTG2 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A7VTG2_9FIRM  ali  41  67.............................GDNRCRVLIIDGQGGRIGKQLAEAIGQD--PRIELTAAGTNSAATVNMMKGGVRTAATGENAVVVGCRRADIIAGPIGIVIADALMGEVTPRMAAAVGQSLAKKILIPVNKCDNIVIGTGGRPVAELIEEAVALILKAVNSGA... 207
42 2.000e-46UniRef50_A0A0U2MHL0 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A0U2MHL0_EUBLI  ali  43  1.................................MNIVVLDGMGGGIGSRIVGILKEEIPPYIEVYGLGTNALATAAMLKKGANKGATGENAIVVNAGKADVIIGSIAMTMPNEMMGEVTMRMVEAINASEAIKIYIPILPENNYIVSLEEKPLLLQIREAVALIKKELN...... 136
43 3.000e-46UniRef50_B1C6T8 Uncharacterized protein n=1 Tax=Anaerofustis stercorihominis DSM 17244 TaxID=445971 RepID=B1C6T8_9FIRM  ali  36  1.................................MLVMVVDGKGGGIGVSLIEKIL-ECNLDVDIIGIGTNSVAMSGMNKLGVD-CASGENPVVYNAGRADFILGPMGILTANSMFGEITPKMAYAISESEAKKILIPMNKCNVITVGVINKSINEYIEEAIDILKEEIEKKKSR. 139
44 3.000e-46UniRef50_A0A1V5JME3 Uncharacterized protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5JME3_9DELT  ali  40  1...............................MAKRICVIDGQGGSVGATVIKSLKQACGDEAELIALGTNAIATAHMLKAGAVRGATGENAICYTVGTAAALVGPISVTWPNAMLGEVTPRTAEAIMASPAVKVFMPLSQEDALIVGLAASTLPALVREVVEAIGTLLVAEE... 141
45 3.000e-46UniRef50_A0A2N3G4Q9 Uncharacterized protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G4Q9_9ACTN  ali  48  1.................................MIIAVVDGMGGSIGTQIVLRLRQSLPEDAEVIALGANAIATGSMMKAKATRGATGENAVRVSIGEAEIIMGSLSIVVPNSMMGEITPTMATAIASAPGRKVLLPISNPPIDLLGTNKKPLQALIGEAMLLVRSIY....... 135
46 4.000e-46UniRef50_A0A223AQR5 Uncharacterized protein n=2 Tax=Mogibacterium TaxID=86331 RepID=A0A223AQR5_9FIRM  ali  41  1.................................MNILVIDAQGGGIGRQLVIKLLEKFP-EADIVAAGTNSMATNAMIKAGAKKAATGENAIRYCAAQAEIIAGPIGIIVANAMLGEISPVISESVGSSSATKVLIPVTHCNTIIAGPKDLPIKDSIEDAVDRIVRICGVEEN.. 139
47 1.000e-45UniRef50_A4XFZ1 Uncharacterized protein n=14 Tax=Caldicellulosiruptor TaxID=44000 RepID=A4XFZ1_CALS8  ali  29  1.................................MVIAVLDGQGAGIGREFIKRLKKEFEDKIKVVALGTNKVAMQNMLKNGADSGYCGEDEIVYFLTNFDAIVGPIGILTCGGINGEITAKIAYLVFSLDCKKYIIPLNLHGIFIPGTVNLSMKEIFSQIIEDIKETLKKEDEQK 144
48 3.000e-45UniRef50_V6IW09 Uncharacterized protein n=2 Tax=Sporolactobacillus TaxID=2077 RepID=V6IW09_9BACL  ali  30  1.................................MKIAVMDGQGAGLGQTLIKKMRQNLPGDWIIIALGTNTCGTSKMVRSGATIGMSGEKAFCAFCRRIDCIIAPIGILQPGSIHGEITESMTHAFTQLSCKKYILPVHHPKLLIPCTADIPIKQFIDDIITDLKKVCS...... 138
49 3.000e-45UniRef50_W0FNR0 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=W0FNR0_9BACT  ali  35  42..........................YAAGGMSVNILIIDGQGGRMGKSLAEEIRKICP-DASITAVGTNSIATGNMMKANADHFATGENAVITACRKAQIIVGPIGIAMADAMMGEISPAMANAVASSPAYRVLIPMNLCDTYVAGTVKGS-SAILADAMEHIRQLTERKTDE. 188
50 4.000e-45UniRef50_UPI000375A30D DUF3842 family protein n=1 Tax=Succinispira mobilis TaxID=78120 RepID=UPI000375A30D  ali  38  1.................................MVIAFIDGLGGGLMAQVISNLPEHLKKKVELLALGTNSMATLAMVKAGAKNGASGEHAICYSIQQVDLLVAPLGLIIPNAMYGEVTPEIAQKVAGAVAKKIFLPIANINIKIVGLENKSMNQLIKETVSEITTFIEKES... 139
51 5.000e-45UniRef50_A0A1I5Z274 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium XBB1006 TaxID=1520827 RepID=A0A1I5Z274_9FIRM  ali  44  1.................................MKIMVVDGQGGRIGSMFIEKWIKSGGSSQELVAVGTNSAATTAMLKAGAIAGATGENPVVVNAKDADVIVGPIGIIAADALLGEVTPKMAVAIAGARAKKLLIPMNNCDHIVMGIGEQKLTYLVDEMVERIQGM........ 134
52 7.000e-45UniRef50_D3R1G3 Uncharacterized protein n=2 Tax=Mageeibacillus indolicus TaxID=884684 RepID=D3R1G3_MAGIU  ali  48  1.................................MRILVIDGQGGGLGKELIEQVRIYLPAEYTLLACGTNSAATQNMLKSGADLGATGESAIIYNAQKADYILGPAGILSANSLLGELSPAMANSIGSSEAIKYIVPINKCRVRIAD-DNLPLPQRITDCVKM............ 135
53 1.000e-44UniRef50_UPI0004BB2102 DUF3842 family protein n=1 Tax=Lachnospiraceae bacterium VE202-23 TaxID=1232456 RepID=UPI0004BB2102  ali  35  1.................................MKILIIDGQGGRMGGLLAEKIKKAAIPGAEIYALGTNSAATTAMLKAGADYGATGENPVLVNCRDADYIIGRWE-SWPPTPFGGSHSCHATAVGQSRAMKILLPVNKCSQHVVGVTDYSMSELTEQALSYLLSCIQGTD... 138
54 2.000e-44UniRef50_A0A0D8IDS2 Uncharacterized protein n=16 Tax=Bacteria TaxID=2 RepID=A0A0D8IDS2_9CLOT  ali  44  1.................................MIIAVIDGMGGGIGGQIVSHLRQELPSHFEIYGLGTNSTATSVMLKNHANKGATGENAIVVSTKKASVIIGPLSIVIPNSMMGEVTDQIATAIADAEAFKILLPVVPENFELVGLENKPLMLLIKDAIKLLKKEFN...... 136
55 3.000e-44UniRef50_A0A1C6J5E3 Domain of uncharacterized function (DUF3842) n=1 Tax=uncultured Flavonifractor sp. TaxID=1193534 RepID=A0A1C6J5E3_9FIRM  ali  35  1.................................MKIVVIDGQGGRLGKLLVEAVKDRIP-QAEVLAVGTNGIATATMQKAGADYVATGENPVVRGVMDADVVLGPLGIVVAHSILGEVTPRIAEAVGGCRGKKILIPMNSCGVSVAGTQEMGLAGYVKLAADQAEAFLRG..... 136
56 5.000e-44UniRef50_A0A011A3L4 Uncharacterized protein n=18 Tax=Bacteria TaxID=2 RepID=A0A011A3L4_9CLOT  ali  39  1.................................MKIVIIDGQGGKMGQSVIAQLKKSFPS-LSVIAIGTNSIATSAMLKAGADAGATGENPVLVASRDADIIIGPIGIVIADSLLGEITPAMAEAIGKSRAYKILIPVNKCNHYVVGCENLTLTESIALVIKEVENHL....... 134
57 6.000e-44UniRef50_R4K4J8 Uncharacterized protein n=42 Tax=Clostridiaceae TaxID=31979 RepID=R4K4J8_CLOPA  ali  33  1.................................MKVAVIDAQGAGLGQAIIKKIRKEIAHNVYIIALGTNTFATSNMVRSGANVGISGERSICSFCKKIDSIIGPIGIICSSDINGEITPLISKSIFNMDCTKYIFPLQKHGIYIPGTRNLQIKDIIEEIVLDIKN......... 135
58 7.000e-44UniRef50_R7IC54 Uncharacterized protein n=2 Tax=Faecalibacterium TaxID=216851 RepID=R7IC54_9FIRM  ali  35  1.................................MKIVILDAQGGGMGRQLVEGLKKALPNQP-LIAVGTNALATAAMLRAGADQVATGENAVVVCAGMADLILCPIGMVLCDAMLGEVTANMALAVGRSRAHKILLPVSRCQASVAGAPKMSMAEVVAKAVEETVARVSAASV.. 139
59 1.000e-43UniRef50_C7REW0 Uncharacterized protein n=5 Tax=Anaerococcus TaxID=165779 RepID=C7REW0_ANAPD  ali  31  1.................................MKIVVIDGQGGSIGASLVSKIKKE-NLDALVYGLGTNYFSSKAMKKAGADIIATGENAIVVNVKDCDYILGTTGIVITNSLHGEISKKIAKAIGKSEATRILIPFDCCKTLIVSKEKPSIEELLDEAVSVLVNLAKEKG... 138
60 2.000e-43UniRef50_G4KX32 Uncharacterized protein n=18 Tax=root TaxID=1 RepID=G4KX32_OSCVS  ali  38  1...............................MEMNILIVDAQGGGIGRQLITAIK-ASGIHATVTAVGTNEIATGAMIKAGADQCATGENAVVVCSRKADVIMGPIGIVIADAMLGEITPTMAISIAQSNAVRVLIPISHCDNVVVGASNVSISQHIQSAVNILRELAFEK.... 140
61 3.000e-43UniRef50_A0A1W1VH74 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1W1VH74_DESTI  ali  48  1.................................MKIAVVDGMGGGMGAQIVQGLVKGIGEKAEIWALGTNAMATSSMIKAGANKGATGENAIKVSIKEVDIIIGPLGIIMPNSMMGEITPFISETIASSKCRKILIPVNQAHVELVGYESKPLGELIKETIKIV........... 131
62 4.000e-43UniRef50_F5YL00 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=F5YL00_TREPZ  ali  39  1...............................MKRIIVIVDGMGGGIGVQLIGKIRRDWPGQWDIVALGTNSTATERMVKAGAHRGATGENAVKVSVGMGEFILGPIGIVLANSLMGEISPAMAQAVLAAPGERILIPIQQDHFTLAGFDPMPLGKMVEKAVEILKEKMGQAE... 145
63 6.000e-43UniRef50_A0A1E4LGY0 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1E4LGY0_9CLOT  ali  40  13.........................................QGGGLGKSIVEAVRRENPA-WEVIAVGTNVAATTAMLRAGAHGGATGENAAVYNCGDADVVAGPIGIVFANSMFGEISPTIAAAVSGCRAKKLLIPVKRCVGTVVGVAEKPLAAYFDELCAALRELEKD..... 140
64 2.000e-42UniRef50_A0A1I3LQU2 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1I3LQU2_9FIRM  ali  45  1.................................MTIVVIDGQGGGIGGRLIEQLRPYLP-DAEIIAVGTNGMATAAMLRAGANIGATGENAAVYNCRDADIIAGPIGIMQANAMYGELTPAIARAVGESPARRVLIPVSRSRTYLAGLAEKPASRYLEDAVGLIVSLAKEE.... 137
65 3.000e-42UniRef50_UPI000781D9E9 DUF3842 family protein n=1 Tax=Treponema endosymbiont of Eucomonympha sp. TaxID=1580831 RepID=UPI000781D9E9  ali  44  7..................................TIVVVDGMGGGIGVQLVARIREQLGG-AEIIALGTNGTAVERMLKAGASRGAAGENAIRVSARLGAFILGPVGIIVPNSMLGEITPAMAEAILAAPGERILLPLRNDHFTLPGTEQMPLAKAIDLAVALLKERLA...... 140
66 4.000e-42UniRef50_U2E8P7 Uncharacterized protein n=1 Tax=Clostridiales bacterium oral taxon 876 str. F0540 TaxID=1321778 RepID=U2E8P7_9FIRM  ali  28  1................................MLNVVVLDGQGGGLGKSIISKLRSEFFAEINIICLGTNSHAANSMLKAGGNLSYYGDDYIANYINNMSCIIAPIGMLCPGGLNGEVTQKLAEVVFKKDCKKYIIPLKKHGFYIPGTANLEIKEILNEIIYDIKRC........ 137
67 4.000e-42UniRef50_E1R870 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=E1R870_SEDSS  ali  47  1.................................MKIAVIDGQGGGVGKAIVQALKPHLAEIDELLALGTNATATVTMLKSGASIGATGENAIIYNASRVDIIAGPIGIIIANALYGEISPKIASAVAESSATKVLIPIDRCRLIIPGASSRTLQTNIKDAVEQIIALMSEGSS.. 140
68 7.000e-42UniRef50_A0A0S2W103 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=A0A0S2W103_9FIRM  ali  42  1.................................MRILLIDGQGGGIGSRLATLLRPQLPEDCELLCAGTNVLATNAMLKAGCTRGATGENAILYNAGRADLILGPIGVILANGIMGEVSPAAAAAVSGAQAVKILIPSATCGTRIAGVEECRLEDYLKRAVDLALREV....... 135
69 6.000e-41UniRef50_UPI00098531C3 DUF3842 family protein n=1 Tax=Anaerosalibacter sp. Marseille-P3206 TaxID=1871005 RepID=UPI00098531C3  ali  44  1.................................MTVAVVDGQGGGIGSIIIERLKSQVP-NIKIQALGTNSSATKNMLKAGADEAATGENAIVYNVKDADIIMGVVAILMPDSMMGELSPKMAEAIGSSHAMKILIPLTRCNIRVALPGEYNLQECVDYGVELVNDYINNLE... 138
70 7.000e-41UniRef50_D8PB49 Uncharacterized protein n=7 Tax=Nitrospira TaxID=203693 RepID=D8PB49_9BACT  ali  36  1.................................MTICVVDGRGGGLGSRMVAGLRGLADDGHAIIGLGLNSASAEAMARAGATFTETAPQMIHRRLYAADVIVGSLSLLMPGSMFGEVTPVLAQAVLESSARKVLLPLNKRKVEVVGAEGRTLDALIDHALQRCASLLRATA... 139
71 1.000e-40UniRef50_A0A1W9G9P9 Uncharacterized protein n=1 Tax=Nitrospira sp. SG-bin1 TaxID=1827376 RepID=A0A1W9G9P9_9BACT  ali  34  1.................................MRVCVIDGCGGGLGTPLILGLRPLAEQGHELIGIGTNEVARRTMAQAGAGQVAVSQGVVMKEIETADLILGSLGIILPGSLRGEITTEIAEAVLQVPGRKLLLPVNHRGIEIVGAQSRPLRILIDSAIHQVRSTLKTGS... 139
72 1.000e-40UniRef50_A0A1Y4WL26 Uncharacterized protein n=1 Tax=Flavonifractor sp. An10 TaxID=1965537 RepID=A0A1Y4WL26_9FIRM  ali  41  1.................................MEVLVIDGQGGRIGQQLIKAILSRYP-EVELTAIGTNSLATSAMLKGGAAQGATGENALLVACRRADVILGPLGIVIADALMGEISPAMAVAVAQARARRILIPLNQCDNLVAGVADMPVGRLLDSAVDELGRVLKE..... 136
73 5.000e-40UniRef50_A0A1J0GCC3 Uncharacterized protein n=3 Tax=Clostridiaceae TaxID=31979 RepID=A0A1J0GCC3_9CLOT  ali  35  1.................................MKIAVIDAQGAGLGKTIIKKIHKEIDLNIYIIALGTNTFATSNMMKSGANLGISGEDEICSFCNKVDSIIGPIGMICSGGIKGEITPMIASSIYNMDCTKYIIPLQKHGIYIPGTRNL........................ 120
74 6.000e-40UniRef50_A0A1Y4UMP4 Uncharacterized protein n=1 Tax=Tyzzerella sp. An114 TaxID=1965545 RepID=A0A1Y4UMP4_9FIRM  ali  34  4........................CNSLKNIN---ILVIDGQGGGIGKSLVLGISQKF-NNINIIAAGTTDIACENMKKAGANISVWGEENIIKLTKEADIITGVMGVMVPFGIRGEITPAISEAVFKSNAVKIMVPMNKCHIRIA-AKSETLKNHIDMAINMIGEEIEK..... 144
75 1.000e-39UniRef50_D4J6H5 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=D4J6H5_9FIRM  ali  47  8...................................ISVIDGQGGGIGRQYISALTSVLPKDVTIRALGTNSLATSNMLKGGANDGATGENAIVLNAGRSDIIVGVVAIVVANAILGELTPTMAQAIGASNARRILIPFDSCNTRIAMLSNGPLQAFIDQAVRMTTDYVGE..... 144
76 2.000e-39UniRef50_A0A1Q6N386 Uncharacterized protein n=1 Tax=Clostridiales bacterium 42_27 TaxID=1897045 RepID=A0A1Q6N386_9FIRM  ali  39  1.................................MTILVIDGQGGKLGKRLVESIKKSFP-QVEVMAVGTNSAASESMMRAGADRVATGENPVIVASRTAQIIVGPMGIALADALMGEISPAMANAVAASAAYRVLIPMNLCDTYVAGVSQKS-SAIMDDAMEHIRQLLTEMGD.. 138
77 6.000e-39UniRef50_R6T3I8 Uncharacterized protein n=9 Tax=Firmicutes TaxID=1239 RepID=R6T3I8_9FIRM  ali  37  6.................................IRVLIIDGQGGGMGRGLVEAVKKRWPTLH-IRAVGTNALATGAMLRAGADECATGENAVIFNAKWAHVLMGPIGVLTPNGLLGEVSAAMAGAIGGSEAVKILLPSQRCSIRLAVGEPRPLQAYLDEAVNLLDKELRRLEDE. 145
78 1.000e-38UniRef50_T0HZ38 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=T0HZ38_9FIRM  ali  60  1.................................MRIAVIDGQGGGIGKAIVEKLRRELPEDMEIIALGTNALATSFMLKAGANEAATGENAIVFNAGKVDIIMGTVAIIAANSMLGELTPVMAKRLLKVQPKKFF........................................ 102
79 2.000e-38UniRef50_A0A1E5L3T9 Uncharacterized protein n=2 Tax=Desulfuribacillus TaxID=1543703 RepID=A0A1E5L3T9_9BACL  ali  41  1................................MLKVAIIDGQGGGIGKVLTEHIRKALGEEVYLVALGTNALASSVMLKAGANEGASGENAIARGIAHVDVVIGPIGIVIPHSFLGEITPSIASIIACSKPYKILIPLTRGNYSLVGLNNEPLPHLVKESIEILYQYIDNIKSKE 143
80 3.000e-38UniRef50_R9JAI3 Uncharacterized protein n=2 Tax=Lachnospiraceae bacterium 28-4 TaxID=397287 RepID=R9JAI3_9FIRM  ali  42  19...............................................KQLVEKLAPRLSKEVTIRALGTNALATNAMLKAGADDGATGENAIVLNAGKSHIIAGVMPIVMPHSILGEVTPRMAEAIGKSDALKVLIPMPRCNIMVAVPEMAPLGQCIDRAVEIIEEYMKT..... 143
81 5.000e-38UniRef50_A0A1Y4LZR5 Uncharacterized protein n=4 Tax=Pseudoflavonifractor TaxID=1017280 RepID=A0A1Y4LZR5_9FIRM  ali  42  20...............................................KALVARLRERLP-QVHVRAVGTNSAATEAMLKGGAEDGATGESAVIFNVGKADFVVGSVAILMANGLMGEISPRMAQAVGDSSAIKVLIPANRCGIRIAMGGEQPLRRYLDDCVDLIAAELQE..... 141
82 5.000e-38UniRef50_A0A2N2E2L2 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-12 TaxID=2013773 RepID=A0A2N2E2L2_9FIRM  ali  45  1.................................MSILVVDGMGGGLGAQIIMQTRNLMPER-EIIAAGTNSTATTNMVKAGATKGATGVNAIKVCLRNAECIIGPLGIILADAMLGEITPEIACLIGSATMPKVLVPVSHKDIDIIGLENLTMSDLI.................. 124
83 8.000e-38UniRef50_C7H243 Uncharacterized protein n=71 Tax=Bacteria TaxID=2 RepID=C7H243_9FIRM  ali  43  1.................................MNVLVIDGQGGGLGRQLVAAISAACP-EARLTAVGTNSLATSAMLKAGTVRAATGENAVVVNCRIADVIVGPIGIVIADALLGEITPAMAAAVCQSPARRVLVPINHCENIVVAVPDQPIGQLVAAAAQKVKELAET..... 136
84 7.000e-37UniRef50_M1E7A6 Uncharacterized protein n=4 Tax=Thermodesulfobium TaxID=227388 RepID=M1E7A6_9FIRM  ali  48  4...............................NIIKVAIVDGQGGGIGQQIVLKIREILSEIIENIALGTNAFATVNMLKAKANKGASGENAIIKNVPEADYILGSISILVADSMMGEFTPRMSEAVAKSKAIKILLPINQSNIDIALTQQEPLPHQVEDAVLRLKNYIERTS... 147
85 2.000e-36UniRef50_UPI000A26AD56 DUF3842 family protein n=1 Tax=Clostridium merdae TaxID=1958780 RepID=UPI000A26AD56  ali  40  15...............................................KALIERFRQVCP-EVAILALGTNAVATANMMKGGATDGATGENAVAVNIAKVHILAGPIGVLMPNGLLGELTPKMAEAVGLSDAVKILVPSHQCNIRLADKSRQSLKYYLECAAQI............ 129
86 2.000e-36UniRef50_D4K7G2 Uncharacterized protein n=8 Tax=Ruminococcaceae TaxID=541000 RepID=D4K7G2_9FIRM  ali  41  1.................................MNVLVIDGQGGGLGRQLVAALSDQCP-DIRLVAVGTNSVAAQAMHKAGAQRAATGENAVVVNCRNADIIVGPIGIVIADALLGEITPAMATAVCQSSATRVLIPVNHCENYIVGVPDQPIGSLVAAAVQKVKALCAGKG... 138
87 2.000e-36UniRef50_A0A1W6WBG2 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1W6WBG2_9FIRM  ali  44  1.................................MRLLIIDGQGGGIGSRLVSALAPCLPADCVVVCVGTNVIATNAMLKAGGRMGATGENAVRYNAARADLILGPIGIILANAMLGEITPAMAAAVSGSDAVKILIPSAKCSVYLAGAQPCTLEESLKSAVSLALRE........ 134
88 2.000e-35UniRef50_A0A2R3N3F1 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium oral taxon 500 TaxID=712991 RepID=A0A2R3N3F1_9FIRM  ali  42  15...............................................KAIVERLKAEFPELA-VIACGTNVIATNAMLKAGADEGATGAGAIAYNAERADIILGAMGIVVPFSMLGEYTPEMAAAVSKSEALKVLVPMQKCNIQLAVAEASNLNKALTNLINMVREKLAEE.... 137
89 6.000e-33UniRef50_A0A1W1I4B3 Uncharacterized protein n=1 Tax=Nitrospira japonica TaxID=1325564 RepID=A0A1W1I4B3_9BACT  ali  36  1.................................MRVCVIDGHGGGLGSRLVRELRADLSPGHELIGLGMTQAAAAAMGEAGAARICIGPEAITETVRTADVILAPLNVLFPDRDQREVTATMVQTILEARCRKILLPLNRFRVEVAGTESHKLEHLITTSLSRVRTLLS...... 136
90 5.000e-31UniRef50_A0A1V5BI70 Uncharacterized protein n=2 Tax=Peptococcaceae TaxID=186807 RepID=A0A1V5BI70_9FIRM  ali  62  1.................................MRIAVVDGQGGGIGKHITEKLRREFPEDVEFLALGTNALATSVMLRAGANEGVTGENAVLYNAGRVDLIVGPISILFPKEIF............................................................ 82
91 8.000e-31UniRef50_A0A1F8NL32 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_47_49 TaxID=1797639 RepID=A0A1F8NL32_9CHLR  ali  28  487.................................LHIVVLDVGEGHFGRQLVEQLKREIPDDPVILA-----SKTAETEDSGIDQ-----DAITNQLASAGLIIGPWAIAIPGG-NGAVSPQIAQAVLSSPARKLLVPFYSEGWDWVGVDRWDTEAFLRKTVHAVKQVLAGEEVK. 619
92 2.000e-29UniRef50_X0XDW7 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0XDW7_9ZZZZ  ali  26  3................................ELRLLVVDVGGTGFAPSLVAALKQEV-ADLELTPIVLPTAGTE-----GADRTEDAHHEIANQLAQAGLIIGPWTIVVSAGVEGAVSPEIAQAVVNSPALKLLVPTRSAGWEWAGVSRWDVEALVRQAICAIKRIAAGKEVE. 139
93 4.000e-27UniRef50_A0A1V1P3H6 Uncharacterized protein n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1V1P3H6_9DELT  ali  40  1............................................................................MLKARANRGASGENAIVQTVKNVDVIIGTIAIVIAHGMMGEMTPLMTEAITCSQALKIIIPISQENLQIVGAPQIPLPRLVEHLIDDYLSEI....... 92
94 4.000e-25UniRef50_A0A1V5RZS5 Uncharacterized protein n=1 Tax=Firmicutes bacterium ADurb.Bin300 TaxID=1852888 RepID=A0A1V5RZS5_9FIRM  ali  36  1............................................................................MIKGGAKYAATGENAVLAASRKADVIIGSVGIVIADSLVGEISPKMAAAVGQSDAFKILIPTNRCNNLVAGIGNQTMGELLDDVIKKLSAL........ 91
95 7.000e-25UniRef50_A0A1V5LSQ4 Uncharacterized protein n=1 Tax=bacterium ADurb.Bin429 TaxID=1866930 RepID=A0A1V5LSQ4_9BACT  ali  23  485...............................AAIRIVILDAGDGQFGRAVAERLGRELP-DAMLRPIGLTQTAAGVL---GAE-----PAPVMDTLADATLIIAPWYVVSPGAAEGTVTPEVAHAVQASPAQKLLVPLPAPAYAWVGVDRWNFDLILRQLTQAARAVRDG..... 614
96 3.000e-23UniRef50_A0A1V5RJW4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium ADurb.Bin325 TaxID=1852859 RepID=A0A1V5RJW4_9CHLR  ali  30  556..................................TVAVVDGANGVAGAALIAGLRRALPDLA-IRPVGLNAVAQGEMLAA-LGAGTDAAPPAAAALATAALILGPADIVTPGGMDGEVTAEIFAAIDASPAAVLLLPPRDTRLQWVAAPEWTLAQWVDHAVIEVQQAL....... 687
97 2.000e-20UniRef50_A0A0E9FM07 Domain of uncharacterized function (DUF3842) n=1 Tax=Chlamydia trachomatis TaxID=813 RepID=A0A0E9FM07_CHLTH  ali  36  1............................................................................MLKAGATRAATGENALIYNAQLADIIIGPIGILLTNSMCGEITSKMAEAVSTSRAKRILIPFLHDDNVIVGVSDYSMKKLISLALEELEK......... 90
98 2.000e-19UniRef50_E1IFM6 Uncharacterized protein n=1 Tax=Oscillochloris trichoides DG-6 TaxID=765420 RepID=E1IFM6_9CHLR  ali  25  490..............................EATLRVVILDMDDGHFGRAVRERLGHEMP-NLNLTPIGLTPVAQAALN------AIPDPRGLAAQLSEAGLIIAPWQAALAHAG----TLEVAQAIAASPAHKLLIPKSVTGWDWVGANGYDEDDTLKAVVHAVRQVIHGEPVR. 623
99 3.000e-18UniRef50_A0A2H3KTP2 Uncharacterized protein n=1 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3KTP2_9CHLR  ali  25  494...................................VAIIAPGDASFGQAVASRLQQELPGLQLIRPDGEVSVAAAQLAEAG-------------------LIVGPWTMATS-GPEG-LSPELVQLVHTSPARKLVVPTRSNAWQWIGVESSSTETLITQTVRTVRQIGEGEEVR. 613
100 1.000e-16UniRef50_A0A2N2PRY9 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-1 TaxID=2013723 RepID=A0A2N2PRY9_9CHLR  ali  34  558...................................LAVVDGGDGALGAALLTALRAALPG-ATLWPVGLNA---AAHVAMLAALGARTPPAVPSDAARVTLILGPSDILVPGGLDGEVPPELAAAVAVSPARVLLLPPRDARLRWVAAPDWPVEHWIGYAVEE............ 682
101 7.000e-16UniRef50_A0A1W9UKH4 Ribonuclease H n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UKH4_9CHLR  ali  25  486.................................LDIAVVDVGDGRFGRALVEALERESPGLGLEPLLLGQSSDEEXXXXXXXXXXXXXXXXXXXX----------------GGARGAVSLVVSQAVMNSPARKLLLPTRAPEWDWAGVERWDADALVRQAVRAVRQTAAGEDVR. 610
102 2.000e-13UniRef50_A0A2E9PS17 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E9PS17_9CHLR  ali  23  495..................................RVAILTPGDEELGAALDSVLREEMPGLRIERAESADAIAELSPEDV---------------------------VVAPGDAAGMVT--------DSPARKLLLPLPRPGWDWVGAPLRTEEAAVKATAQALRQLIAGEAV.. 598
103 2.000e-11UniRef50_I7KAH9 Uncharacterized protein n=1 Tax=Caloramator australicus RC3 TaxID=857293 RepID=I7KAH9_9CLOT  ali  45  1.................................MKIAVIDGQGAGLGKTFIKECKRAFKNNVYIFALGTNEIATLNMLK................................................................................................ 46
104 1.000e-08UniRef50_G9RQV9 Uncharacterized protein n=1 Tax=Subdoligranulum sp. 4_3_54A2FAA TaxID=665956 RepID=G9RQV9_9FIRM  ali  25  1.........................................................................................................................MVVAVGQSDAKKLLFPVKQCSNIVEGTRSLSLSRLMDEAVELLRAMC....... 47
105 3.000e-08UniRef50_G9RQW0 Uncharacterized protein n=1 Tax=Subdoligranulum sp. 4_3_54A2FAA TaxID=665956 RepID=G9RQW0_9FIRM  ali  45  1.............................................MGQPFIERVKAAAFP-CRLLAVGTNAIATSAMLKAGAEAGATGENAILVACRTA............................................................................ 53
106 8.000e-08UniRef50_X1D1D0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1D1D0_9ZZZZ  ali  47  1.....................................................................................................................MTQKMAEAVSECAATKLILPISQENVDLIGVSDEPLPHMVETLV.............. 44
107 1.000e-04UniRef50_UPI0009D96DD9 DUF3842 family protein n=1 Tax=Clostridium arbusti TaxID=1137848 RepID=UPI0009D96DD9  ali  24  8.........................................................................................PPICLFCKHVDCIIGPIGIICSGGIAGEITPMLSESIFNMNCIKYILPLKKHGIYIPGTRHLQIK..................... 74
108 0.002UniRef50_A9WA60 Uncharacterized protein n=5 Tax=Chloroflexus TaxID=1107 RepID=A9WA60_CHLAA  ali  22  474...........................LAKQAQTRVAVV--ADDGLANQIATELRAQFPQLVIYV----------------RDQSAEAEQ----QLANANLIVGTWRQT-----------ENPQWLNRYPARKLLVPLTDTNWMWVGVEPMTGTEIARQLADAVRQVLAGESLR. 587

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.