current user: public

If you have questions about the server, please let us know.

Query: PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# E-value Template Links and tools%idFirst MDPPVCSPWGRFGCYLLLFACPIIFASIMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVRQVLast
1 5.000e-86UniRef50_Q7MUU3 Uncharacterized protein n=34 Tax=Porphyromonas TaxID=836 RepID=Q7MUU3_PORGI  ali  100  1MDPPVCSPWGRFGCYLLLFACPIIFASIMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVRQV 263
2 2.000e-67UniRef50_A6L0Y6 Uncharacterized protein n=26 Tax=root TaxID=1 RepID=A6L0Y6_BACV8  ali  28  1...............................................MKKTLFVIGMLLCGLSLYAQDMKTLFIAMPDSVAPLLTKVNREDCVD----FLASNMKAEVKNRFGKVSELKLTDDYLFLQTTGSSSMEIKLLPLNDSVKVICVVNTVCGPACDSEVRFYNTDWQQLAKEDFIQLPSVGAFYLPVDTLTDEAYAAIREKADMELVKATLSEDKPIISFTYTTPDYLAKTEREKLVVYIRKEPVVYEWKGGKY.... 209
3 6.000e-62UniRef50_S8FAJ6 PF11644 family protein n=1 Tax=Bacteroidetes bacterium oral taxon 272 str. F0290 TaxID=888054 RepID=S8FAJ6_9BACT  ali  27  1..............................................MKRGFALVVGSLLCLIHIGAQDMRTLLVAMPDSILPLLTKNNRMDCVD----FVDSKMKAEVKNRLGEVSELKLTKDYLLLQMTSQSTVEMKLLSVNDSAKVVCVVRTVCAPVCDSAVEFYDISWKRLKTADYIACPPVDSFFRNPAQ-TDLPYQLLREKADVDLIKASLSVERAVIRFEYTTPDYLSEDDREKIRPYLRKDPLVYSWTEGKFTPS. 212
4 2.000e-61UniRef50_A0A0F5JD48 Uncharacterized protein n=7 Tax=Parabacteroides TaxID=375288 RepID=A0A0F5JD48_9BACT  ali  26  1...............................................MKRLIFSILICVFALGAKAQDMAAVFISMPDQNIPQLENAWRKDLVD----LYKSGKEARLKNTMNGFSSLDLTSDYLSLKATERSTIEMKLLPLVNNTNVICMVRTVNGPVADSQVEFFTTDWEPLAVSDLFTPVDADWFIKEDTDKNSNAFQDAASRLDMNLIQYNLSPDNLTLTATYTTPLYLSKEDRKKVTPFIKDSPKVYTWEKFHFK... 210
5 6.000e-61UniRef50_U6RDK9 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=U6RDK9_9BACE  ali  26  1...............................................MKKLISILIGIASVVGVQAQDMKALFVSMPDSIAPLLTKVNREDCID----FLASNMKAEVKNRFGQPTELKLTDDYLYLQTTSKSSMEMKLLPLNDSVKIVCMVNTVCASACDSEIRFFSTQWQELPKQDYMKLPSVEAFYLPVDSLK-EDFLLLREKADMELLKATLSPDSAVLSIAYTTPDYLAKSEREKLTVYIKKEPIVYEWVGGRFIER. 211
6 5.000e-59UniRef50_A0A1Y4HDA4 Uncharacterized protein n=9 Tax=Bacteroidaceae TaxID=815 RepID=A0A1Y4HDA4_9BACT  ali  24  1...............................................MKKLIISLFFPLAALSVQAQEARTLFVNMPDSLCPLLSAVNRADCID----FLDSKMRAVVTNTLGGKSEMTLTPDYIRVQLTRKSTWQMKVLPLPGDTAVICAVSTVSAPAADSRIHFYTTDWRELPAEAYLSSPAMNDFLPAPDSLDTPRLRNALRQADMLFLRADLQADSTSLVWTFETPRYMSQEAADELKPVMRR-SLVYKWENGQFRP.. 213
7 1.000e-58UniRef50_G9S7A5 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=G9S7A5_9BACT  ali  26  21...............LLVF---IVYLCFSKKDVMNRV--------------ILAFCFLLCVSGLKAQQVAAYFVSMPEELLLQIEPNRRKDMIDFFQH----GQKGGITNALGGNSEITMSDKYMSVSLSDVSKMEIRVLSKDTAD-IIAVVRTVCAPACDSRISFYDEQWQLLDTKDFLQLPVNADFFVAQE---VSGRDEALRMVDMMLAEYRFSPDNDVLTVDCTIKDYLPDEIYKQIAPFLKKEALQYSWNGKRYELE. 243
8 1.000e-58UniRef50_A0A0N7IAN6 DUF3256 domain-containing protein n=14 Tax=root TaxID=1 RepID=A0A0N7IAN6_BACT4  ali  27  5.............................................KITHTIAFFIIGLFTFVSSQAQEAKTLFINVPDSLCPLLTKVNREDCID----FLSSKMKAQVENRFGQKSEMTLSKDYIRMQMTPETTWQMKVLALNDTTNVICTVATACAPACDSSIRFYTTDWKPLTADSFITLPVMNDFLLTPDSTAIYEFDEASRSADILLMKVDMNKENTELAVTLSTPDYMSKETAEKLKPFLRR-PIVYQWKNGAFTK.. 216
9 1.000e-58UniRef50_A0A0B2JQV4 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A0B2JQV4_9BACT  ali  28  1...............................................MRTIIYLFFSLFIAVSVEAQRVSSFFIIMPDELLPQIETNRRKDMIDLFQHSQKGG----ITNSLGGRSDVTLSDNYISVGLSSSSTMQIKLLPLKGKETVIAVVNTVCAPACDSRIDFYDTNWKPLDKKDFIVLPDNRDFLLDDGKFNGDANEMIQR-VDIPLMRYDFCEGNDNLQITYTIDEYMPEEMYKQIKPYLRDSSLEYVWDGNHFKKE. 212
10 2.000e-58UniRef50_E6SV60 Uncharacterized protein n=154 Tax=root TaxID=1 RepID=E6SV60_BACT6  ali  27  1..............................................MKKFNILLLLFFVGIQVLQAQEAKTCFVNMPDSLSPLLSSVNRADFVD----FLESKMKAEVTNNFSGKSEMELSSDYIRVKMTEQSSWQMKLLPVNDSTKVICTVSTVCAPACDSHINFYTTDWKELPSSSYLQLPVIDDFVVTPDSVDVYEYQNVRRQADMILMKADLSAVDSVLTFTFTTSDYMEKQAAEKLKPFIRR-PISYTWSQGRFIL.. 213
11 1.000e-57UniRef50_A0A1M5END7 Uncharacterized protein n=1 Tax=Bacteroides luti TaxID=1297750 RepID=A0A1M5END7_9BACE  ali  28  1...............................................MKKIILLCFLMASVISLHAQDAKSVFINMPDSLSPLLTKVNREDFAD----FLESNMKAQVKNKMDKMSEMTLTKDYVYLQTTPQSSFQMKLLQLNDTTKIICVVNTVCGPACDSRILFYTTAWKELPVKDYIELPKMEQFFITPDSTQLEAFNNARAALDFYLLKSDLSKDSSDITFTFASSEYLDETAAKDLASFVK-KALVYVWKEGRFTLKM 212
12 2.000e-57UniRef50_F0R0X9 Uncharacterized protein n=18 Tax=Bacteroides TaxID=816 RepID=F0R0X9_BACSH  ali  27  2.................................................KWIIGLVCMLCSVSMQAQDLKSLYIALPDSLSPLLTKVNREDFGD----FLASNMKAEVKNRFGQTSEMKLTDDYLLVRISKSSKEEMKFLPLNDSVKVVCVVRTYEGPVADSDIRFYDTAWKELPASRFFTLPPEEQFYRQPLTETADSLRNLRLYADMYLKELRLSEKDQSLTVTYTTPDYVDKETAEKLKAYVLEKPVVYQWCNGKFR... 210
13 4.000e-57UniRef50_G5SS25 Uncharacterized protein n=3 Tax=Paraprevotella TaxID=577309 RepID=G5SS25_9BACT  ali  23  1...............................................MKRFLPLIITLALGQALQAQKMRDVFAAMPDSVLGIMTKNNRLDCID----FIENDMEAKVRNRFDGFSVLKLTADYLDLQLTPNCRVEMKLLPAEDTLNYICVARTYSGPVTETKVALYAPDWNVLPEEKWIPFPAYADFWETNDSVDKEEVSRLQHLQDMRFVTASLQPDDMRLTFVLQPGEVDKEEAERMKKVL---RPVVYEWQGKRFVL.. 208
14 2.000e-55UniRef50_A0A1Q6HIK0 Uncharacterized protein n=1 Tax=Bacteroides sp. 43_108 TaxID=1896974 RepID=A0A1Q6HIK0_9BACE  ali  22  12..........................................................AFAQNNYAQSMRQIMVSMPDSIMPLLTKVNREDCMDYL----DSKMKAEVTNRIGSKSEMTITDDYAQFKLSKSSERTFKLLPTADNDTIICMITTCCGPVCDSKLDFFDNKWNRYK-KRIIEPPTLKDFISKPDSINEDKFNNLLNKADILLMKADFKNNSNDLTLTLTTNEYLNEDDRESLKPFFKKE-ITLEWNGKKFEKK. 210
15 3.000e-55UniRef50_G8UQF0 Uncharacterized protein n=46 Tax=Bacteroidales TaxID=171549 RepID=G8UQF0_TANFA  ali  31  1...............................................MKQLIISMLLAACTVGVGAQDMAELFVKMPDEYTIGLEDAWRKDLV----NLYRAGKEAKLQNMMQGASLMKLTPDYLKIQTSGRSTVELRRLPLVNHTWIICMVTTVSAPVSDSRIHFFTTDWKPLPDDGLYSPVSVDDFLLPDVDTTDVAFLDVMAALDMDLFVYRLNEDAQTLTAEYTTLYYLDTAMRDKAKQFFKTEPKVFTWAKGRFE... 211
16 3.000e-55UniRef50_UPI0006844004 DUF3256 family protein n=1 Tax=Prevotella oryzae TaxID=185293 RepID=UPI0006844004  ali  27  6...............................................LKKVYISFLILFLAAPVVAQNIREVFKQMPDSMFPYITNTNRLDFID----FKDANMKAEVNNSLGGKSEMKLTDNYIEVELSSVSNLQIRLLP-KDSTKVICMVTTFFGPEADSKVQFFSLNWKPLDIKSAV--PSFDDFFVKPDSINTERFVQLKKMVEPVMYYVILSSKDNTITYSLSLPLLNKEDKKALDAVL---RKVTLKWTGKSF.... 208
17 5.000e-55UniRef50_UPI0000F734E9 Hypothetical protein n=1 Tax=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) TaxID=242619 RepID=UPI0000F734E9  ali  99  3...........................................................ASQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTEWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVRQV 206
18 5.000e-55UniRef50_A0A239RPQ6 Uncharacterized protein n=2 Tax=Prevotellaceae TaxID=171552 RepID=A0A239RPQ6_9BACT  ali  19  23................................................................QAQRVKDMWISMPDSLIPYLNKSMRIELVD----FVNMKVKAEVKNLLGEESVMTLTASYLSVTLNAAATVQMRMLPLQNGDSIMCMVRSSHGPACDSELSFWSKNWQRIEQKGFIPQSLRDRLIVKPDTMTEARFEELSEMIEPFLVCASLSPTDNSLTLKVSLPMLSADDKKAVKAILMQRK---LNWNGETF.... 216
19 5.000e-55UniRef50_R6EWF6 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1320 TaxID=1262922 RepID=R6EWF6_9BACT  ali  20  1...............................................MRRIFTLCVCLLFALGGHAQSVKAAWLAMPDTLSPYLTKAQREECID----LKEKNLEAKVANMLQGETVLTLTAVYLQATLSQSATLQMRVMPADGVDSLICVVKTLQAPAKESELSFYDSSWRPLTELQQVVDSLLEKLVSRPDSMTEERYQELVQMIDPVMVEATLSPDEDALTFRLSTPLLPSGEKEAVARVLSQRK---FKWNGHSF.... 211
20 3.000e-54UniRef50_R5U4H1 Uncharacterized protein n=7 Tax=Bacteroides TaxID=816 RepID=R5U4H1_9BACE  ali  25  2.................................................KWIIGLVCMLCSMSLQAQDLKSLYIALPDSLSPLLTKVNREDFGD----FLASNMKAEVKNRFGQTSEMKLTDDYLLVHVSKSSREEMKLLPLNDSVKVVCVVRTYCGPVPDSEVKFYDTAWNELPAADFVTLPEENEFYKSVSETASDSLRNLRLNADMYLKEVRLSDKDLSLSVSYTTPQYMDKTTADKLKSYLINAPIVYTWSNGKFLK.. 211
21 9.000e-54UniRef50_A0A255T1L2 Uncharacterized protein n=1 Tax=Prevotella sp. P3-122 TaxID=2024223 RepID=A0A255T1L2_9BACT  ali  21  16........................FARTLAWRWRGQMASAFILLMACMADL-----------PLWADGIRDVWQTVPDSIVPAIDRVRRLEMLD----LVDYKVKAEVKNMLGSNSVMTLTADYLHITISASSEMAISLLPCGDSDSVICVLRTYMGPEPDSEINFYTPCWQPLDAAAYLPFHSLSESWQRPDTISPERYGELMTLVRVPLVGAVMSCDGRHIDLSLSLPMQGIDDRPAMAAI---ASCRRLTWNGQRFV... 238
22 6.000e-53UniRef50_F8WWG4 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=F8WWG4_9BACT  ali  26  1..............................................MRKFILAIIIILSIVSGVSAQDLKTIFLAMPENMITGLDAAGKEKLLSNPNDTTGITAP---RGSFGEVERISISSDYISLQTSEAGTVQIKLLPLINESKIICVVKTVCGKACDSQIQFYTTQWFPIPQNDLFPKINKDTFIIANTDKNSQEFRNAYAALDMNPITIDLSPDSTSLEISYDIENYLTVEDYKMIEPFLIENPKRYTWDKLSFKPE. 213
23 8.000e-53UniRef50_R5FPL1 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:924 TaxID=1262938 RepID=R5FPL1_9BACT  ali  19  1...............................................MRKIIFLVIGLTMAMGVEARSMREIWTSLPDSLLPYVDRNHRLEMVE----FIDMNLNGDVDNLFGGKSEMTITTDYIGLTLSQSSSMQIKRLPVAGGDSLLCVVKTYLGPAAESEVAFYHQDWTPASVMLSLDSAGTARWMVKPDTMSEEHFVHYKTFISPYIVGARLSPDDDNLELRLSLPMPVREEKHALEAM---TPSFSLRWD........ 206
24 1.000e-52UniRef50_D3HWD5 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=D3HWD5_9BACT  ali  17  1..............................................MRRFTLLSLLTFFVAISASAYSITDAWISMPDSFVPSLSATLRRELVD----LKQQGRRPEVANLLGETTLDTLTADYMRVSLSPAAIFEMCRLPMQNGDTIVCVVKTYSAPAKESEVAFYNRQWLKIELKHAFAGKCFDSLVAKPDTMAQSRFEDLSAMLEPVMGWAELSANGPSIVFHRSAPLVESADKKLLEAILLQRR---LKWNGETFK... 212
25 2.000e-52UniRef50_A0A1Q3M6Y0 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 45-6 TaxID=1895719 RepID=A0A1Q3M6Y0_9BACT  ali  22  1...............................................MKYIFSSILLFFCLMTVDSQTIKNVILTIPDDVVMGLTTEQKTALCAD-----PATDSVKVDNALNGQVRLGISNDYLKLQTSDVGTTQIKILPLVNDTKILAVVKTVCSDACDSRIQFYTLDWRPLPEQNLLPKRTFDWFLKPDADHQSVDFKEAIKAVDMNPVILAFSPTDYSLTADSEIGNYIGSEDYTALEPFLRDKPKVFVWNKISFKEK. 211
26 2.000e-52UniRef50_R5Y2F2 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:144 TaxID=1262736 RepID=R5Y2F2_9BACE  ali  27  1...............................................MQKIILFALLLLSSTTISAGTIDAYFISAPAQLIPQLDENRRKDLID----FHNAGVAHHIVNQLGGEVLIDTIDDMITVKLSSSSSIQIALLPVADTVGVIAVVHTVSLPAQDSRITFYNTRWQPIENGKIFTAPTAKTFLNKSSKKTA---QQAVDLIDMLPVSYVIS--GRTLQAREDLKTYLPEEVYERLAPLLRKTPLSYTWNGKRFV... 206
27 3.000e-52UniRef50_R5GRA3 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:755 TaxID=1262935 RepID=R5GRA3_9BACT  ali  22  1...............................................MKRLFILFVLLTATRICVAVPIDTLFAGMPDRLLPLLNLDNRLDCLD----LYNGKMNAEVTNLFGERSRLTVTADYLRVELSAASRMELKLLSMGN-DTVIGRIHTVLTPAADSRVEFFTTAWKPCGTVHVVP-PKENDFWVRPDTVTEARFEELRRAAGLAWVEAVFSSTGDTLTYSLSLDNVRSDWREEMRSCV---RPVTYRWDGTKFV... 206
28 3.000e-52UniRef50_D1PAR4 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=D1PAR4_9BACT  ali  18  1...............................................MKKIILCACLMMASMGMEAKSMKDLLVSMPDSVVPYLNHNLRLEFAE----LQEMGVKAEVKNLLGETSVMTLTADFAQLRTSKSATLQMKKLPSANGDSLLCVVKTFAGVEKESELYLFNQDWQEQDASRIFDGKSLQQLVAKPDTMSEAKFEELKGKIELKIVSALLLQHENSLVVRLALPFVSADDKKAVNAIKVQRK---FNWNGKTFKES. 215
29 6.000e-52UniRef50_A0A1M5CY70 Uncharacterized protein n=4 Tax=Dysgonomonas TaxID=156973 RepID=A0A1M5CY70_9BACT  ali  22  1...............................................MKKILVALLIFSLFPVLKAQNIASAVVSMPDNMLIGVTLDQKKELAVELPDSLNKEVY--IINAVGDSVRLDYSDDYIALKTSDAGILQIKLLPLVNNSSIIGVITTVCGQICDSRIDFYTTSWEPLDRDSLFPKVGRDWFFKKDIDQTSQDYLNAAAVVDMTPIKMAFSAKDKNVTAEYQLQSYLAQDDYKAVEPYLLDKPKVFEWNKFVYKEK. 214
30 7.000e-52UniRef50_D1PUI3 Uncharacterized protein n=2 Tax=Prevotella bergensis TaxID=242750 RepID=D1PUI3_9BACT  ali  18  1....................................................................MTELWQSIPDSIIPYIERSQRQEMTD----FIAMGAEAKVRHALQGESKMTITSDYIHLTLNESMQMELKRLPHEGGDSILCLVKTWGGPCQESEVYFYSQDWQPLAIANPLAKYRENPLLSRPDTMSPEKFEELSHKVGFVLAAASLSPTDNSLSVYQSVPLLSAEDNQKIKTML---TPVSLKWNGQGFKL.. 187
31 2.000e-51UniRef50_R6YFY4 Glycosyltransferase WecB/TagA/CpsF family n=1 Tax=Prevotella sp. CAG:732 TaxID=1262934 RepID=R6YFY4_9BACT  ali  19  239........................................NMLKESCGKNVLLLLMLLTFATNMSAKSLNELWVSMPDSLMPMVNKSQRIEFLD----LKNLGVKAEVDNLLGESCQLDSTSDYLKLTTSPSSLYEMRLLPQTSGDSLLCIVRTFSAPEKESELKFYDQEWKELEGTSLLPSNLSDVSLAKPDTMSLERYHELQAMIEPKMFHLTWSEDGNELVSQLSLPLLGKEEKAQMLALLMQRK---FKWDGRKFKE.. 456
32 2.000e-51UniRef50_A0A1G7KT79 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1G7KT79_9BACT  ali  20  1...............................................MKKNIIMALLCLMVQTGYAQKMRDVFVAMPDSVMPYLTKVNKADCID----FIDSKMRAIVKNRLDNQCEMTLTDDYTQMKLSKGYTLEMKLLPVNDSTKIICMIRTLGDSLKQSNIHFFTSDWQELKRDKYITLPKLSEYMQRPDTISEEKYDRLTEKIDIFLQSAAFDNDGN-LAFTLNIGE-MNRDDRNEVSPFVKN-PLTYNWRNNAFLKK. 212
33 3.000e-51UniRef50_A0A133YT30 Uncharacterized protein n=1 Tax=Bacteroidales bacterium KA00344 TaxID=1497954 RepID=A0A133YT30_9BACT  ali  20  1...............................................MKKVILSVSLFFLSLNISAKSMVEIWESLPDTLLPYIDRNHRLEM----TEFLNMRLKGEVEHSLRGQSVMTITSNYIHLTLNEAVDMHIKRLAYHDGDSVLCVVKTWSAPEKESDVYFYTQDWQRLNIPNPLELYRKELRISRPDSMSVDEWDALASKVSFVLTGAALSASHDNLQVFQSAP-LLSIEDRDKIRPLL--MSVSLKWNGRAFE... 207
34 7.000e-51UniRef50_UPI000C78C9FF DUF3256 family protein n=1 Tax=Dysgonomonas sp. Marseille-P4356 TaxID=2040292 RepID=UPI000C78C9FF  ali  24  1...............................................MKRIILTILLVIFLLNSYGQTLSEVVKSMPDNIIWGLTTEQKEEIL---AQNTDSIVTVTGNSLYNKYTRNNISDTFISIQTSDAGNVQIKLLPLINNTNIICVVKTVCKDFCDSNISFYTQDWTEIKDKSLFPTPELSWFIKSNIDKHSDEYKNAIAVVDILPIKLSLSPNSNSIQIELNIEKYLDEKNYTTLTAFLQDSPKELKWDKTKFE... 211
35 3.000e-50UniRef50_C9Q081 Uncharacterized protein n=7 Tax=Prevotella TaxID=838 RepID=C9Q081_9BACT  ali  22  1...........................................MYNTMKRFLFGLCLAAMPVTMMAQQVRKMWVNMPTSIVGSLEKSTRQELLD----LKEMKKKAVISGPLGEESIDTLTADYLSARLSDVSTLQMKMLPTSSGDSLLCLVHTYAGPLPESSISFYTPDWKALP----MPSMHLDVDLQRPDTMTQDDFSKLQALFDPKLISFTLSPSNKELVVALSPVIISEEEKAPLKALILQRK---LNWNGKTF.... 206
36 5.000e-50UniRef50_R5P6B8 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1092 TaxID=1262919 RepID=R5P6B8_9BACT  ali  19  3...............................................LKTNILALMLIALSATAQAREIRSVWKSMPDSVVVAIDKVRRLEMLD----LVDYKVKAEVNNRLGSHSVMTITANYLHIMVTKASELSMRLLPTAEGDTLVCMVYTYKAPKPESKISFYSLDWQLLDASKYLPFTSIADLYTKPDSISQERYAELRNDVVVALVSAQQSIENDDICLSLSLPMAAKDNKASMTAIADKRK---LVWTGKKYVYS. 215
37 6.000e-50UniRef50_F3ZT29 Uncharacterized protein n=2 Tax=Bacteroides coprosuis TaxID=151276 RepID=F3ZT29_9BACE  ali  25  1...............................................MKKISLLLFILCCGQWGMAQNIRSLFLDMPETFTPLLTSVNKADFID----FIDSKMKAKIMNKFNKTSEMKLSDSYILIQMSENTTWQMKVLPTSN-SFVIAIIKTVKGPAADSSISFYSSDWKELSVSSFYEQPSIASFLK--DEKASFKLNNDLQALDMSLIRLDFNADNNELIASLSTIDYLNKETREKVEPYFNKE-LVLSWEGGKYLMK. 208
38 1.000e-49UniRef50_A0A2U1FPA9 Uncharacterized protein DUF3256 n=1 Tax=Porphyromonas loveana TaxID=1884669 RepID=A0A2U1FPA9_9PORP  ali  43  1............................MKRNTIARFVRSFCLAGVLIGGYVFGGITPASAQQIGDDKLGRCFVAMPDSLMPLLSTSEREELCAPRGIYSNDNRIEFVTTRLG-QLRYERSNHTITLQSSSASVITIRHLQLPDSTFILCMVTTALLPVEDSQIAFFSDKWEPLPTDRFIQMPQMDDFVLPCTDKESYTYQATYKHLRPFYMRIDISGAPAILTARQTVIETLAVEEKPLAAQFLLKESLAYMWKDGRFV... 231
39 1.000e-49UniRef50_W0EST3 Uncharacterized protein n=6 Tax=Bacteroidales TaxID=171549 RepID=W0EST3_9BACT  ali  22  1...............................................MKLRNLLSIFFLASAGLSAEPAAQFFVAMPDSLVPSIEVNRRKDLID----LFHAGQKAQVDNKLGGTTAMTLQDNSLTVDLSQQSQMALHLYPTDRGDTLIALVNTVYGPAADSRIRFFDSSWRELPASKHMRALSTADFFAFPDSLTNTQKKEILQTTGIYLVEYTFEPDG-SLCARPSWEKYLDPETFKKIEPYLR-KSITLRWNGNK..... 208
40 2.000e-49UniRef50_E7RS58 Uncharacterized protein n=5 Tax=Prevotella TaxID=838 RepID=E7RS58_9BACT  ali  19  1....................................................................MREIWLSMPDSMVRYLNKSKRIEFLDYV----DMKVKTDVKNLLQGSSVMTITSDYLSVKLNEASTIQMKLLPVRGSDSLLCVVRTYSAPATESTVNFFTQDWQPLGDMSF----DGGQFIVKPDTMSEQCFAELKAMIEPVMVRAELSADRDELFLQLSTPLLNSEDKKAVGSIISQRK---LKWNGEIFK... 182
41 4.000e-49UniRef50_A0A2N8NLQ2 Uncharacterized protein n=3 Tax=Tannerella sp. oral taxon 808 TaxID=712711 RepID=A0A2N8NLQ2_9BACT  ali  29  19.......................................................................LFVNMPEVHLAELDADARRELVKLYDPKSKEEVKAKVPNALRGEARITLTPDYISLYTSQRSRMELRRLPLVNHTYVICLITTVEGPAMDSRVEFFTTDWQPLVASELYRPARMEDFLREGVDTTEADYGDIKAAADMELFRYSLSAEKPVLTVTYTTPDYFNEAMRKKAERYFDKMPRLYKWNNGRF.... 209
42 6.000e-49UniRef50_D8DWW5 Uncharacterized protein n=3 Tax=Prevotella bryantii TaxID=77095 RepID=D8DWW5_PREBR  ali  20  3...............................................MKKLFVLLYVLMNTLFVSAQSIRGFWLNMPDNQMPHFNKNLRQEFLD----FKDMKLKASVDNLFHGESHMDLTSDYLLLQVDTSTTVEMKVLPYQ-SDSILCMVTTYSGPAQDSKVEFYDYSWNRISLEKPFGGYDLQELFSKPDTMSQSTYSELTKKIEPLMCYAKLSPSDYTISFSLSLPMMKQEDKKGLEAIILQRK---FKWTGKMF.... 211
43 8.000e-49UniRef50_UPI00046B01DE DUF3256 family protein n=1 Tax=Prevotella albensis TaxID=77768 RepID=UPI00046B01DE  ali  19  1...............................................................MSAQSVREMWLNMPDSIIPYLNKSLRQECID----FVDMNVKASVKNLFQGESIMTLATDYAHIQLNESSIMEMKMFPSNTGDSILCVVRTFVGPARESEVAFYNKEWNKIGEGLNFKK---ADFMSKPDTMDVKRYDELLSMVQPFMYWAKLSPQQNSITYSMSIPLASKQDKKDVEAISKQIK............... 179
44 1.000e-48UniRef50_R5M5D8 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=R5M5D8_9BACT  ali  21  1...............................................MKLLAFIIFLFCGSVSAMAQTIKEIIGNMPESVIPYINDDQRAEL----QKFTGEKDTVKIKNVFNGTSIDTISSNYAKISMSKVADMQLILLPTSDSTQIICAIKTVNSPIKDSSIRFYSTDWQPINSTFGLPENPDTDFVQKPDTITEENFTKLRNYIEPVIVYADFKSQNNIITFNLSLPFIPKDKINELKAI---TKKISFKWNGQFFKK.. 214
45 7.000e-48UniRef50_UPI0006891A52 DUF3256 family protein n=1 Tax=Bacteroides paurosaccharolyticus TaxID=732242 RepID=UPI0006891A52  ali  24  1.............................................YMMKKYIF-LLLIMLSNSIASQNLKSYFISMPDSIIPLLTKVNREDCVD----FLDSKMKAEVKNKFGNISELKLTDNYLLLQTTSNSYIEMKLLSVNDSTKIIGVSRSYKAKAVDSSLSFYSTDWQRLDNMKFINLPAREKSALNDSSFKDLTSQEINDIMDIPLMKISFQETNNDLIFENTSPYTLDKEQLMELKLDRQNKTIRYIWKDGRYVLE. 214
46 2.000e-47UniRef50_A0A2N4S615 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2N4S615_9BACT  ali  22  1...............................................MIKRFIPLGLLLITLTCSAQKMGELFKTMPQYVLPGFSEADKIMLLVD-------TALTSIPYPLGNIERINYTDDFLKIKTSNKGTLQIKLLPLINNTKIVCVVKTVCGQACDSQIQFYSTEWNPIESEPLLPHLSAEMFFDR-SQKNNIDFEKALRLIDMEPIKAEFKGGSDDLTLILDYESYVSAENVELIKSFIKQDSITLRWNKTSFQ... 205
47 3.000e-47UniRef50_F9CZQ9 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=F9CZQ9_PREDD  ali  19  1...............................................MKKKILLLLSLAAALQLQAKSMVELWNAMPDSVIPYIDRNHRLEM----TEFIGMGLSGDVDNGLQGKSKMTITADYIRLTLNESMVMQLKRLPSVTGDSLLCVVKTWLAPEPESELTLYTQDWQPLEQPQLVGDRPWADWWTRPDTMAVADFDALRTATGLVLVAATLAPQTATITLQGTAPVALAADKPRLKAAL---PPRTFTWDGRAFR... 211
48 4.000e-47UniRef50_UPI0004682642 DUF3256 family protein n=1 Tax=Prevotella dentasini TaxID=589537 RepID=UPI0004682642  ali  19  1...............................................MKRLYLLIVCLTIVFGASAQTMGELWASMPDSVVPYLNQTLREQMV----QEKEAGGWMPVENLSGDTSVVSLTSNYMKVKLSNSSVIELKLL----DEKTIAMVQTWFGPEPESRLTLYSVAWQSMPSTF-----SPVCLTEKPDTMSTDEYEHLLALLEPQLIWLQLSEKDNSLSVQYAQIMLTSSERQEVSAIVKQTK---YNWDGSRFK... 198
49 8.000e-47UniRef50_A0A1V5H9K6 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5H9K6_9BACT  ali  21  1...............................................MKKIFIAFFIFISTL-AFSQKIDDVFKTMPNNIVPGLSDGNRTMLLVDTG-------KTIIPYPLGEIEKLAYSPDFLKIKTSEIGTTQIKLLPLINDTQIICVVKTVCGNACDSHIKFYSTDWKELDANLLLPDISAESFL-DSSKKDTDNYKFAVSLPDIYPISAEFENGSNTLKLKLDLTKYLSNEQLAEIKPFIKSETITLTWNNTSFR... 204
50 9.000e-47UniRef50_A0A0S2KNM0 Uncharacterized protein n=2 Tax=Prevotella enoeca TaxID=76123 RepID=A0A0S2KNM0_9BACT  ali  21  1....................................................................MRKIWLSMPDSIIPYLNKNQRLELVDYV----DLKVKPEVKNQLRETSVITLTTNYVSITLNKASKMQLRLLPTTNEDSILCMVRTFNGPLPESSITFYTPHWQRLESPSIDLQQFAPSLIVRPDTMSQARFDELKGKIEVITVEASLTAENDNLMLRTAVPLLSHQEKESIRLIFLQRK---LNWNGITY.... 185
51 3.000e-46UniRef50_UPI000373B7D4 DUF3256 family protein n=1 Tax=Porphyromonas levii TaxID=28114 RepID=UPI000373B7D4  ali  22  1...............................................MRRILLYITALGLSLVAMAQNMRQLFLGMPQQVVPVLTKEARAQLVDNFDKRQKGEAPAEVRNSFNGYSAITLSDDFAEVKLDTQTSLQMRRLYLDRKSYLIGLIFTSKVVPEQSVLALYDQEWKRMPEEKYFQHPEVADFFSDPAQIQLNSTKKILSTIGALSYRYSWVEGSDVLKIEVSFEEPMTQSLYPEATKWFKASGVLYQWQRGQLRKE. 219
52 3.000e-46UniRef50_UPI00036821BB DUF3256 family protein n=1 Tax=Bacteroides propionicifaciens TaxID=392838 RepID=UPI00036821BB  ali  27  1...............................................MKKVGFLLSLLFLCSTLGAQHMKDVFLNMPDSITPLLSAVNKADFID----FLDSKMKAEVKNSLGGDSEMVLSDDYTRIQMTKNSSWQMKILPFKEA-YILGVIQTVKGPVENSCITFYDSEWKPLDVADFVASPRASDFLAEFESSTSDTKYIDLKGLDMSLIRFDFAVDQPILVATYTTPEYLDEPMQKQVKPFLKP-TLSYLWNG....... 206
53 2.000e-45UniRef50_U2IFH2 Uncharacterized protein n=36 Tax=Prevotella TaxID=838 RepID=U2IFH2_9BACT  ali  18  1...............................................MKKYFILLFAILGIIQADAQNMREIWINMPDSIIPYINKSQRTELADYV----NMSMKAEVQNKLSDTTRIELTDNYILVHLNNVSRLEIKLL----DNSHIAMVQTWNAPVAESKLSLFSKNWESKTLN-----LNTNAIFEKPDSMSQKRYGEILELTKDIMCEMKLSAADNNLMLIYSAPLLSNAEKKDLTAIIKQRK---LKWNGIDF.... 197
54 9.000e-45UniRef50_L1N896 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=L1N896_9BACT  ali  19  1..............................................MIKKLIISLLLISFFEVLYAKDIRTVWMSIPSSVIPYLDKNQRQELLD----LIDMKTKAAVTNLFGDTCKITLTNTYLSATLSHSSTLQLKLLPRETGDTIFCMIRSFSGPSIDSQLSFYTLDWAQLA----IPQLDYHTLIVKPDTMSTADFEVYKEALRSSLVSLSLSSNQHELDLKITPILLDKDENKNINVQLLQRK---LKWNGLTF.... 203
55 9.000e-45UniRef50_H1Q3I9 Uncharacterized protein n=1 Tax=Prevotella micans F0438 TaxID=883158 RepID=H1Q3I9_9BACT  ali  16  1...............................................MKKLFIIAYSLLVASFASAQNMREIWLSMPDSLVPYLNNSLRTEVADYVDM---KDMKPEVNNLLDDTTRIKLTNDYMLVRLTNSSVLEMRKLN----DNRIATVWTWFGPAPESTLRMFDSEWNELPVSSTFEPT-----IVRPDSMTVERFEELKSLLEPRLIELRLSPEDNSVTASYSLSLLSREEKKAVASILRQRK............... 190
56 1.000e-44UniRef50_D9RVF3 Uncharacterized protein n=25 Tax=Prevotella TaxID=838 RepID=D9RVF3_PREMB  ali  17  26......................IIILKTEKKEFLD------------MKKILIIICFLTCWLGVSAQSLREVWIEMPDSILPYLSKSQRTELADYV----EMKAEPAVLSTFGDSVRIEMTNNYLLLKANEATRLEIKLL----DNNTLALVQTWMAPAAESKLSLFNLQWQPKE-----VVVDYKANIVKPESMSDEDFADLKTLMFPRLKEYRLSADNNSLSVSWNYPLLSKKDVKRVTELL---KPQVLNWTGKDFR... 236
57 2.000e-44UniRef50_A0A1I2P6U3 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=A0A1I2P6U3_9BACT  ali  20  1.......................................................................MWLSMPDSIIPYLNNNQRIELVD----FVNLNVKSEVNNLLGDSTVLTLSIDYLHLTVNPSVRIELKMLPFTNADSILCMIKTLNGPEFESIIDFYDKDWKRLPSDAMFDGVGLDNFAFIPDTLSKKRQAGFEGVLDPVLMYASLNPTTNEIIFSLSLPLMSEREKQSIREIFL---PKKFKWTGKVFK... 187
58 3.000e-44UniRef50_A0A133PWF3 Uncharacterized protein n=2 Tax=Prevotella corporis TaxID=28128 RepID=A0A133PWF3_9BACT  ali  17  1...............................................MKKILLLFLLGITSLNIQAQNIKELWIAMPDSIIPYLNNSLRTELTDY----IDMHIKSEVRNLFNDTTKIDLSDNYMSVILSKSSKMELKIL----DNNTIGVLQTWFGPSAESKLSLYNKNWELIKENINLQPV-----IELPDSLSNDAVSQLYSLLEPKMIKMKFLPNENSVLVDYSLSLLANDDKTKIKTIIKQRK---YKWNGETFK... 199
59 5.000e-44UniRef50_A0A2T4T1P3 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 820 TaxID=2081962 RepID=A0A2T4T1P3_9BACT  ali  22  1...........................................MRLIKQLFIFILLFIAINNTLYAKSMKDLWLTMPDSIIPYLNANDRLQFIDYN----DLHVQATVTNKLQGECKMTLTSNYVHVSLTPCSSIEMRLLPYANNDSILCVVKTYGDENKESQIYFYDQNWTLLP----INVAQISSPSVTESKLTSFTNDSTY-ISDPVMIWMSLDINDDILVIHRSVTMVTNTEKKDINTNLLQT---TIKWNGKTF.... 205
60 5.000e-44UniRef50_W2CJ04 Uncharacterized protein n=6 Tax=Tannerella sp. oral taxon HOT-286 TaxID=712710 RepID=W2CJ04_9BACT  ali  23  1............................................MTMRKRWIAMVLAAAMSAAAQAQDVAELFLKMPDTQLVLLNEASRKTLVD----MHRAGEKAIVNNEMGGMAEIKMTDDYLWLETSMGNFIQIRRLPLVNHTYVICLITSVGIVGQDSRVEFFTMDWTPLPTEGMYRPATMRDFLRADADTTSEDFKEICAAADIDLFHYKLSPDDLTMSVRYNTPKYFDQALQEKANRFFIDGWKVYTWRNGRFEES. 217
61 2.000e-43UniRef50_J9GP64 Uncharacterized protein n=1 Tax=gut metagenome TaxID=749906 RepID=J9GP64_9ZZZZ  ali  26  74...............................................RKRWILLSNFFCVASCLSAQGIDSLFAKVPQQILPLLNRTSKLDLLD----LYNSGLPAKAENLYGGQSEMTMTADFLSLKTTESGEWQMKMLPYEDDSMLVCVY-SHKAVGTSSVITAYRCNWTKLKLA--FPRPSLSDFWLPVNPLSQMESQMLHATLQEVPIEVSLCDSAALLTYRVSL-EGLSKENREQAVSCVK--PLTYAWDAGR..... 275
62 4.000e-43UniRef50_A0A2L2WNX3 Uncharacterized protein n=1 Tax=Prevotella sp. MGM1 TaxID=2033405 RepID=A0A2L2WNX3_9BACT  ali  22  1..............................................MNIKTIITLLLFPMSIQLFAQSMRTIFVNMPDTLLPYMSSGNKLDLID----FAESGMEAQVNDNLGDSVTLTLTHDYLYLRLSPSSSVELKILPYHGDSLIICMVSSVGSDIKESSVQFYTTGWKSMKSLVPIKF-EISNFMIEDHTVSDERLRILTDKLCPFMVSANLSPETTDLILKLSIPLLTEEDKGEIGSLFI---PKTLKWDGNIFK... 213
63 5.000e-43UniRef50_A0A098BY87 Putative secreted protein n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A098BY87_9PORP  ali  23  4................................................KQGLMILACLLLTVSIQAQNLAEIFKSMPEELMPGISEGNKTMLLVDSTETTIPYMLGEIKKVEHGT-------DYIKIETSGIGNTQIKLLPVTNDSVIVCVIKTVCGDVCDSNISFYTDKWEKLNSDSFISDITAEIFF-DSFQKESENYKYALSLPDISPISAVLNKYNSDLLLIFNFKNHLPENHISEITPFLKSDTITLKWENSSFR... 211
64 9.000e-43UniRef50_E0NR24 Uncharacterized protein n=1 Tax=Prevotella marshii DSM 16973 = JCM 13450 TaxID=862515 RepID=E0NR24_9BACT  ali  19  1...............................................MKKIIIIYIYICAVTVVSAKSMKELWVSMPDSILPYLNAEKRMALTVSASE----KIKTRIDNLLEGHSTMTLTADYLRIRLNESTEIQLKRLPVEGADSIICMVKTCFAPEAESEVAFYSQSWKYIGDMPL----TTTGLIIQPDTMTTSRFEELKGMIDPQMVKAELSTSTNTLVLNLSLPLLTSADKSN-LRPILQQRTV--KWNGKTF.... 202
65 2.000e-42UniRef50_R5CQR5 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1058 TaxID=1262918 RepID=R5CQR5_9BACT  ali  20  1...............................................MKALITTIISLSMCLTALAQNAVEALNTMPKELLPYISDSQLQEM----GKFTIDNDTVKVKNELNGTSVTTINDDFAKLDLSNSALMLIKLLPLNDSTQIICLVRTIKIPLPESSVSFYTTDWKRIRSRFGLPDTRNADMTQKPDTMSVDRFNELRDYLDPVTISADIPEGGDIITFKINVPFTTKEEKSKVEAIIRQK---SFKWDGKSFK... 214
66 4.000e-42UniRef50_G5G9W8 Uncharacterized protein n=2 Tax=Alloprevotella rava TaxID=671218 RepID=G5G9W8_9BACT  ali  20  14.................................LANLAKENLYLRLEMRQLIFIFSLIWVC-GLQAQSIDSVFVSVPKKYLPLLEENERLNLLD----LYNYKMKAETENSFGGRTLMVEKDSYVELQLTEVSSWELKRLPDAEGDPFYAVTHTITAGYKSSRIYFFDTEWRQI--YPPFPLVRLDNFWVDNKELSIGRLDELKRILHTPSVYLHWDAKMSVLTYSVSL-EALPLDDAKDAATCLH--PIRYEWTGQSFVE.. 241
67 1.000e-41UniRef50_B6YQE5 Uncharacterized protein n=2 Tax=Candidatus Azobacteroides TaxID=511434 RepID=B6YQE5_AZOPC  ali  22  1..........................................MKKKYIRKILLGIISLLTTVSLHSETVKDVFLSMPESMLLSLNSSNRKDLVD----LYDAHTQSVILNAFKDTVILELTKNYLLLKMNNYS-LQLIVLPMINDSKLYCIIHTICNSVCDSRIEFYSISWKQLQASLFITPVAEPYFIDRNSD---------NITLDISFIQFTYDPETLLLQQFYNTPECMSVENRQKIQPFIRKKVKTYKWNGIRFE... 205
68 3.000e-41UniRef50_A0A095Y5E7 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A095Y5E7_9BACT  ali  18  1...............................................MKKTALLLGTFMISLPTFSKSMVDLWLSMPIKMIPYIGHDSRLEMTKCVSTSTKN----EVRHDLEGTSKITITADYLHITLNNAVELDIKRLPYQGNDSIICVVQTWSAPQKESKVCFYNQEWHPIHLTNPLSDKTKFCQLVKPDTMTQEDFTNISQKLNVILVSASLSVSSQTMVVHRSVPIFSSEENDKIKNML---PTITMKWNGLKFE... 208
69 1.000e-40UniRef50_A0A1V5F287 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA395 TaxID=1852820 RepID=A0A1V5F287_9BACT  ali  18  1...............................................MKLIFFTVIFFFLCAKISAQGIDKLYVGMPDALHPTLTSQQRLELIEYAKAGQNDTTLNRYKKPVFLLKLDTL-HQHLMMKNSGSTSFEMKVLDANSNEPMIAIIRTVCAPICHSLIEFYDFKWNRLPVT--FHYPQATDWLLEKAQKTEEGVETFQKILKYTFVSLSFQEEGQIVMAFNNSIDFLSDEDKKLVFPCMNTAPLLFQWSDLKWIRE. 215
70 1.000e-40UniRef50_R7LCH4 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:891 TaxID=1262937 RepID=R7LCH4_9BACT  ali  25  1...............................................MKKFLKVLSLLLVGLSAKAQSLDTLFVDAPTTLFPVVDKAARLDLID----LYNHGIEAKVENIFGGQSELTKTPNFLSLRTTDVSTWEMHLLPCA-KDTLILSLHTLVAGSQSTDVQLYTLHWTPVKDK--LPHPQFEQFVRPDSPLYAYDKQYLTTVLTEQPLAVTLSPQTSELTYRIST-EGLSTEDKEKAKQYIQ--PLVYEWKEAHFVPK. 212
71 2.000e-40UniRef50_UPI0009FDB531 DUF3256 family protein n=1 Tax=Prevotella ihumii TaxID=1917878 RepID=UPI0009FDB531  ali  16  1..........................................MRKINMKKTFXXXXXXXXXXXXQAQTMRELWTSMPDSIVPYLNNSLRTELADY----KEMKVTAAVKNLLGDTTTIEMTAHYMSVKLNSTSELELRKL----DNNTFAMVRTLYTPEAESELTLYNTDWTTKP-----CTIDYNVVWAKPDTMSQAEYDELYSKVGLKLYKLKLSDKDNAITLSVSTPLAEKTDKEKIKTI---TREKQLVWNGNTFK... 203
72 6.000e-40UniRef50_E4T8I9 Uncharacterized protein n=1 Tax=Paludibacter propionicigenes (strain DSM 17365 / JCM 13257 / WB4) TaxID=694427 RepID=E4T8I9_PALPW  ali  16  1...............................................MKKQFLIFICLMIAQSSFSQTIEDCYVDMPDILNPTLSRQNRLELVGY----HKAKQSDSVVNRFGNQAYLVSLDSRIVVRNSSSSTFEMKLLSLENNVKVISIIRTVCAPVCLSSVEFYDTAWNAIPLQ--FTMPKAIDWVNESAPKDQVDVQWIKNNLDIGFVSLTFTNQGQMIQATNNTLDFFSEADRKLISPFMNNSPILFKLSGRVWVR.. 218
73 9.000e-40UniRef50_A0A0U1CMS2 Protein of uncharacterized function (DUF3256) n=4 Tax=Bacteria TaxID=2 RepID=A0A0U1CMS2_CHLTH  ali  17  1..............................................MMRRLILSLLTCWIALSATAQDIRQLFLSMPSSVMPSLSKEWKEELLNKYDAQKEGRTYKEIPYSPTSTSADMITKDYLELKLDESTSFQLKVLPKGWWGYRISIVLTSEIVPWQSVLLFYDQQWQRLETSHYFTFPTLTQFFTDSELLSRNETKRVLSEIGTLAYSHHWSPTEPLLTTKITTDLPLYQKEYPESKQWLKVDGVTYQWRRGQ..... 219
74 2.000e-39UniRef50_UPI0009DBD275 DUF3256 family protein n=1 Tax=Prevotella sp. AGR2160 TaxID=1280674 RepID=UPI0009DBD275  ali  17  11...............................................MRKYTLSLLLLLAALSVSARSVRQAWVSLPDSIFPYLDKNLRLECLD----LYDMKVKADVKNLLGEHSVLDLTNDYLHVTLSPSSEFAMKSLP-SGKDSVIYSILTIAGPAKESVIT------------PAVVAPSWDCFLQRPDTMSEERYAELRKMIEPRMVWAEFSVSSPELIFHVSLPM-MNQADREALNVILRPQK--LIWDGKSFK... 205
75 3.000e-39UniRef50_C9LJ68 Uncharacterized protein n=1 Tax=Alloprevotella tannerae ATCC 51259 TaxID=626522 RepID=C9LJ68_9BACT  ali  20  1..............................................MIKKLFATCCIAFCFAQIFASPIDSVFVHVPSDILSVLDMGARLDMID----LYNYNMKAEAYNIYGGKSVMTKTDSMFSISLTESSRWDLALLP-QSADTIFAVIYTILSPAESSRIVLYDADWQPLAYQ--FQLPEIEKFFREPYPFSPERMEILKQDLKMCSVSLSFSPQTRALIAKVSTTNAPEDDLADLKHLLF---PLRYAWTGDAFQLS. 208
76 4.000e-39UniRef50_R5AIM4 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1031 TaxID=1262917 RepID=R5AIM4_9BACT  ali  22  1...............................................MKRYFITLSLLAVAMAAMAQTARTAFAEAPSSVFPLLDKLTRLDMIDYF----EAGSKVESVNALEGASAVTLSDESLTVHLTDASDVQIFVVPTAKSDTIIGVITTVATPGHDSSLALYSGRWKRL--DGLFTAPKLADWLTDP-----RHSAEVEIVVPFMLTSYVYNPADKTLSLTNNLKGFLSDDIYSMVDGLVRP-SLVYRWDGNRFVRQ. 205
77 8.000e-39UniRef50_A0A0A2EWI5 Uncharacterized protein n=6 Tax=Porphyromonas cangingivalis TaxID=36874 RepID=A0A0A2EWI5_PORCN  ali  19  1...................................................MLFTLTLGGESRAYAQEMRDIFVDLPKHILPILPKSSRAKLIENHLTQREKQSLPLTENALGAPSFITLTPSYIHVVLDKSTDVQYKRLYTEEGTVVMGMIVTSKIAPKQSIMKFYDSTWKELPTELIIARPEASDFLQNPKDSTLLVFKNAMVERGHIDTYAVFLPDEDGVIMRLSTDDQVAQKLHPKLMALLAPEGIRYTWEMGQFKK.. 214
78 6.000e-38UniRef50_A0A0A2G9B0 Uncharacterized protein n=2 Tax=Porphyromonas gingivicanis TaxID=266762 RepID=A0A0A2G9B0_9PORP  ali  19  1.......................................MRFLNSKVVCTFLIGLCFFFGGEAALAQSIEKRVIPISEELFPLLSKEDCSDFIK------NAQQGKEIKDFLGATLKIEMTNQYLRILSDSGIVDELILLPHRKGE-VLCHIRTLEVSSPISFISFYNDRGEQLSQEEFLPSIDGFHFLSPSVDRSSLSFKMIEQLLPYLPMYGTFVEADMSLTLYPSYVSIATEEQKMILQQLLRSEPITLKWKKKGFVLE. 217
79 5.000e-37UniRef50_R5KG36 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:1124 TaxID=1262920 RepID=R5KG36_9BACT  ali  19  1...............................................MRKIFFITTLLLSLSSSMAQTIKDILKTIPQEILPYVNDDQRKEI----NEFVGQKDTIEIKNALNGTTRITSGDNFAQFDLNETTKLQIKLLPVNDSTKIICIAKTVMRPISDSSISFFSTDWAPIHSNFNLPETLLSMFTQRPDTMTTARYNELIKCIEPVIISANISNNDYTITFSLDVPFVQKSEIDKYKAI---TRQKTFKWDGRSFK... 213
80 5.000e-37UniRef50_A0A0D0HBY1 Contig61, whole genome shotgun sequence n=5 Tax=Prevotella TaxID=838 RepID=A0A0D0HBY1_9BACT  ali  23  5.................................................KIIATSLIILSGQGIYAQTMKDVWKEMPDSILPIMNSSIRSDIVDNDNVDEN---KEGIKNLLGGELKLSLNDKFIDVRLSEKSGVQLLLLKKDTGTDLICMNRYYGNPAAESDVDFYTIDWTPVDTEKNVVISARDDFYSQVDSLKKETGKKEPAVLDPIMIVVSLSDKENELTFNTYVPLKISTDVD---LPDFKMQ-RCLKWDGRYFK... 212
81 1.000e-36UniRef50_R6A0S8 Uncharacterized protein n=2 Tax=Prevotellaceae TaxID=171552 RepID=R6A0S8_9BACT  ali  25  18...............................................................CMAQTLDIYFVNAPKSVLPLLDRTARLDLMD----LYASGLPAKAENLYGGQSELKKTSDYLMLKTSDAGTWQLKVLTAGHDTLLVC-IQSVEADGVSSRISVYQNDWKMVKRD--MPHLTNEKFVKNSTEVTDFDRQRLMPTLLHLPIQATWHADEPVITFCLSLDS-LPKEYINLAKEL--TKNISYKWQSGKFVAQ. 207
82 3.000e-36UniRef50_R7PA94 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:617 TaxID=1262933 RepID=R7PA94_9BACT  ali  20  4................................................KSLLLTICYLSCHSWATAQNVDSLFAHVPESVCPILVQSNRLDLLD----LYNSRMKAVTPNLYGGQTILEKSENFLKLQQTESTDWCMKLYKAPQQAYIL-VCQTFRAPYAESVLSWYDTQWKATTPPAGFTLPAPTDFA------DSDSLKDVVNAWPAHYINASLTANSDSIHFTIT-PMNSSSALNELTRKDLNT--ITLKWDRQKYQ... 202
83 4.000e-36UniRef50_I4ZBY6 Uncharacterized protein n=12 Tax=Prevotella TaxID=838 RepID=I4ZBY6_9BACT  ali  16  1...............................................MKTLFIAFMLTMGCSFVSAQSMRDIWINMPDKLLPYLNKSLRTELADYVAI----KANPSIQNLLGDTTSIELTDDYLKVNLNECTTLQVKKL----DNNTIAVVKSWNNASSDSDLKLYSIDWSTRKENNADVALEIE----KPDTMLASTYSDLKWLISPYFIILTLSEKENSMKVDYAFP-LLGRKDDERVRPIVKTKF--LRWVDNKFQ... 199
84 8.000e-36UniRef50_A0A2V1IUG0 DUF3256 domain-containing protein n=2 Tax=unclassified Muribaculaceae TaxID=2006847 RepID=A0A2V1IUG0_9BACT  ali  17  27...................................................................TASKVFVEAPRQVFPLLDRNARLDMIDYF----ENGMTNTTANAMQGQSAVTISPLSLSVKMTDSSSYELDLLPTAKGDTLVMLISTVATPAPDSKISIRSSDWRTDMTASAFTRPTLDQWL---TDKGRDNKVEVEAFVPFLLISYSYDPSSAVLKLTNNTRQFLSSDIYETVAPYLLGE-KSYRWNGKKFTP.. 213
85 1.000e-35UniRef50_R5BC36 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:927 TaxID=1262753 RepID=R5BC36_9BACE  ali  19  1...............................................MNKSILTAVILIGYGSAFAQTASQAFVEAPRSVLPLLDRNARLDMLDYF----NGGLTTKTSNKLNGSSAVTVSPEQIAVQMTDASTCNMAVIPAAN-DTLVAVITTIATPAPDSKMTVYSSDFARDLTSSVFSKPTLRDWVTDGSSLATVE-----SMVPFLLISYSYNPATLTLTLTNNTRSFLSEDVYSIVEPYLKKE-ILYKWNGKKFARQ. 208
86 2.000e-35UniRef50_A0A1T4MU42 Uncharacterized protein n=2 Tax=Porphyromonas circumdentaria TaxID=29524 RepID=A0A1T4MU42_9PORP  ali  23  1...............................................................MYAQSMEKRIALIAEEVFPLLPKE------DCVGFIKSAEKGKEIKNLLGTTLKIDSSSQYVRISSDSTIVDELILLPYRRGD-VLCHIRTLRTPELLSFISFYDERGKSLPKEHFILPISGVDFLLPSVDRSSVMFQQIEKILPFLPIHYTFSWGDKSITLYPSYSSIATEEQKVILRQLLQPQPITLKWKKKRFLPE. 193
87 3.000e-35UniRef50_UPI0009F69A5A DUF3256 family protein n=1 Tax=Porphyromonadaceae bacterium FC4 TaxID=1720317 RepID=UPI0009F69A5A  ali  19  3...............................................LRRQTLFAILLLCALPMLAQKMALLFSNTPADLIPALSQDLKVELVK---QYYTQEPTEKIRNVYGGPCRITITDTYLRLELDSTMVVELKEFRSLLRPTRLAMGVTSTIRPAISVLTFYDSEWTPISGSSLVELPQPEQFLINSADSTRLDYKKALVERGSWDYAASFDADSPTLTFRITTDEEMAAKQHPIVTSLLKDK-ITYRWKNNRFVPQ. 218
88 7.000e-35UniRef50_A0A1K1NIR5 Uncharacterized protein n=3 Tax=unclassified Prevotellaceae TaxID=224765 RepID=A0A1K1NIR5_9BACT  ali  19  1...............................................MKKQLLIALSVFLANTLSAQSMSDALKIMPSSMVPYLTENNRLDCID----FYEAGMKAEVRNALDGKSELLLTDHYATFRLNEAVEMELALLNAND-RQLICMISTYGKDIRESDITFFDTTWKQLSTSDYIDLP-------------------------HQMFTSKFNPEDSSLTIRTTLDRPANEEQEEIKEVQMN-----LKWNGEMLK... 182
89 2.000e-34UniRef50_A0A161LI16 Uncharacterized protein n=1 Tax=Paludibacter jiangxiensis TaxID=681398 RepID=A0A161LI16_9BACT  ali  21  1..............................................MHRQIILLIFSMISLFSVSGQSVEKLFQTMPADLLW-LDQSQRTELFAYF----KDKKVDSIQNSLNGYCKLIDYNEHLLLKTSQKGSMEMQVL-GAESSPFIAVIFTTCAPACQSHINFYSLEWKPFTMD--FPTLSASDFIARG--LSEYDLSIANRLLTPLFISYTFTEPGKTITASCNARQFLADDDWKELKPLLKSEQLSIKFEDGVWKIK. 210
90 2.000e-34UniRef50_A0A1B1S6D9 Uncharacterized protein n=2 Tax=Muribaculaceae TaxID=2005473 RepID=A0A1B1S6D9_9BACT  ali  21  1...............................................MRRLIIFIAAMASFAMAYPQTATEAFSSAPASVLPLIDYITRLDMIDY----YNSGSATASKNVMQGQSRITLSPMSVSVSVTSGSECQIALLPMRGDTAIVC-IETVMTPTPDSRVSVYDRDWKPLSGSS-FAMPAVSAWLTPEGKKQADVVE---SQVPFMLASAQYSPETDTLVLTNRLSDFLSDDVYGLVKPYLLP-SITYKWNSSRFVP.. 206
91 1.000e-33UniRef50_R7ETX3 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:485 TaxID=1262927 RepID=R7ETX3_9BACT  ali  23  77........................................................................FAALPDSVLPLLAQNTRLDMLDYAKECIHN----EIKNMLNGYSRLDLSANYLHVAVTDVSNISIGCYNGKGKPGNVVALSYTITPASDSQIMFFTPDMKPIATRKLLKVPGSEDFLLVPKGSAMTLKEAATAIIFP-TVVYTLQPDKGLLTATLTVDKAMTIENFESLKTYLHP-VITYRWTGKRFEK.. 263
92 2.000e-33UniRef50_A0A1Q6EJ48 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 52_46 TaxID=1897040 RepID=A0A1Q6EJ48_9BACT  ali  18  1...............................................MSRFILSIMALLGAITVPAQTPRSVLTTAPEKVLLTIDASTLLDMLDY----YENGVVRTVKNKAGEDAVITMTESTITLNTGAAHSITFAILPYGKSSVIMAVDR-VDSPSTDAAVTFYDSRWNPLDSRKLLRFPTLADWTGK---LSPDKMEEIENALPFLMVDARYNPATSTLTFTPQIGDYVSVENAGKVKDALAPQ-LDYVWSGKSFKP.. 207
93 4.000e-33UniRef50_U2J1G7 Uncharacterized protein n=1 Tax=Prevotella sp. F0091 TaxID=1227276 RepID=U2J1G7_9BACT  ali  19  1...........................................................................MPDSVLPYLSKSQRTELVDYV----DMKADPAVLNVFGDSVRIEMTNNYLLVKASKVTRLEIKLL----DNNTLALVQTWKAPVAESKLSLFNLQWQPKEAVVVY-----NENIVKPDSMSEEEFADLKSLMYPRMREYRLSAENNSLSVSWNYP-LLSKKDVKRVADLLKMQVV--NWTGKDFR... 170
94 7.000e-33UniRef50_A0A255SNW0 Uncharacterized protein n=1 Tax=Prevotella sp. P5-92 TaxID=2024222 RepID=A0A255SNW0_9BACT  ali  18  1.................................MTRILYMRNIKSRIFSLCVLI---ATSVAAMHAQTIDSLFAEMPDSVLPYLSRNNRLDLID----FSKASMKAVVTNSFDEDCEMELADNYLRIRLNGCSIVEMKLLLPDSSEYMLYMLKTVGCETKHSVLYRYTSRWNSLGEEQ-IQISNPQELMERKMPVTDEEQDILTNISRTMTIVGHLDGETDWMTVEPCLSGCTTDEKRVEEKITLKTFKINLK.......... 223
95 3.000e-32UniRef50_A0A0A2DVT1 Uncharacterized protein n=3 Tax=Porphyromonas TaxID=836 RepID=A0A0A2DVT1_9PORP  ali  17  6.............................................KYIVFLWGILVLIFCCGSLSAQTVAEVFIDAPESAFPVLSXXXXXXXXXXXXXXXXXXXXXEVENEFNGKSKLLYLSNTMVVVLDKHSKIELCMLPVKGKDPLIAVIRTSLISPEHSVLSFYDVSWKKKDKTFHEPSYSFETFMKNSSSKAMTQGKLVMSQLVSITNLLTFIEGDRGLSVHLTGIDGTPLESEESMKSLLKNEKIIFWWNNKKF.... 225
96 4.000e-32UniRef50_UPI0009EEBA6A DUF3256 family protein n=1 Tax=Porphyromonadaceae bacterium H1 TaxID=1658779 RepID=UPI0009EEBA6A  ali  21  29....................................................................LEKAFIEMPGALFPSLNKQQRLELLEY----YKAGQGDSIKNRFGSQTRIEASNSYLKIKTSRISTWEMLIFPGENRSPIIGIIRSVCAPVCSSSIDFFDNGWQHLKPD--FKIPDVSYWLKEEKLKQSPDSNSLSAVRSMNFLSYRFDALKRKVIVQNNNLDYLTEEDKRQLSPYVKTDSLVLN.......... 213
97 5.000e-32UniRef50_A0A2L2WU96 DUF3256 domain-containing protein n=1 Tax=Prevotella sp. MGM2 TaxID=2033406 RepID=A0A2L2WU96_9BACT  ali  22  1.........................................MLKIKTLSPILFSLILLLKFQNATAQTIDSTFLKVPMSELPLLEHNPRLDMID----LYNYKMIAKGENIFGGTSVLTKTQNSLSIDLTESSHWELIQVPQKTDTIYICL-HTTKTPAEETTIRFYNKNW---DTDSVISPPSLDDFWHNNDSIPIEQQNILKKKLSPLYVKACCENTEPRLTFSVSITLLDSESQKNVSK-CLKPKYWIY........... 209
98 1.000e-31UniRef50_J9G2C1 Uncharacterized protein (Fragment) n=1 Tax=gut metagenome TaxID=749906 RepID=J9G2C1_9ZZZZ  ali  20  1...............................................................................LFPYLDRSSRTIMADGVGEDMPTG------NRFSGQSRITLTSDYLKATLTEASRVEMKQFANSHGDSVLAVVTTFLGPEPESKLDFYDLSWLPLRTD-----VQAEAATARPDTMSEEQYALLQQKIEPTIRFYLLSPSNTLLRASYSLPMLSEADKRQVIAILQEKK............... 159
99 1.000e-31UniRef50_A0A1V5N332 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin416 TaxID=1852814 RepID=A0A1V5N332_9BACT  ali  19  7....................................................ILVLFNLLSLSVQALTMKDVLLSMPTDLLPTLPLSARQDLVDFYTNNRTAAMPAAFNNQMILKV---FTEDYLLLQTSPVSTLQVKRLSVDDTMTVLALIHTTQGPLEDSRLVFFSPDWKPIPQGGQ-PLLKPSSFLRTQDEELARRFDADCARL---FVRMAWLPASTDLITTHSLKVDVPFETL-LPYQELLVDTLRLVWSGKGYRP.. 207
100 1.000e-30UniRef50_A0A1H3ZUT5 Uncharacterized protein n=1 Tax=Prevotella sp. tc2-28 TaxID=1761888 RepID=A0A1H3ZUT5_9BACT  ali  21  1...............................................MRRLFI-ALSLLLTLGSSAQTMSQVFKQMPVNIVPYLSENNRLDMID----FIDSKMKAEVRNLYEGKSEMLMSDDYARLALSEGSLMEMRLLPVDSMKKILCVVRTYGAVFKDSQVEFYSLKWRKLNTKQYVTLPDW-------------------------MFTASLDEHEPTLTSSSLLDKPASEEQKEVDKKLM-----MLKWENYRFK... 185
101 2.000e-30UniRef50_R7HTZ7 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:279 TaxID=1262924 RepID=R7HTZ7_9BACT  ali  19  41...........................................................SAAEVSIESVSDFFLFADE--FNTIEQSVRMDMLDY----YASGMRKHMPTRLGGQAVIDSGDHYMKVSTSSVSETEVQMYVNNHGDKLFGVINRVKMPATDSHISFSQTYALGSPSVSLIEEPKVRDFLTAKDKK---ALREIESKIAFPLIDYRFLPNGD-VEARLTVGEFLSREDSAAVMPFVN-SGITYHWDGKRFKIK. 234
102 2.000e-30UniRef50_A0A255S2Q8 Uncharacterized protein n=3 Tax=Prevotellaceae TaxID=171552 RepID=A0A255S2Q8_9BACT  ali  22  1...............................................MRKIIILGILILTTFAAEAQTMKDVFLSMPKSLTPELTENNRLDMVD----FIESKMKARVDNLLDGHSELLMLNDAFSLQISETLRYDVRLL-LADGDSIICLVATYGKDAPESNVTFYKASWEPIPSSQLITLPQ-------------------------QMYVASFSPDNSDLQIIYSLNPVAMEGQKNEKEI-----AVMLKWNGKRFNKS. 185
103 3.000e-30UniRef50_UPI0003658974 DUF3256 family protein n=1 Tax=Prevotella paludivivens TaxID=185294 RepID=UPI0003658974  ali  21  2..............................................IRKTTICLLLMLSIFDNINAQSMRSLWINMPDSVIGYMDKNSRIESLDYL----EMKVKSDVKNMLGETSVDTITNDFISATLSSAMKLTIKKLPVDDNDSLICMVRTYAGNEKESSICFFNSKWEPIKIDVDLPIQNNNKNIVLQQQISS----------------------SDILVIQLQPKVFIEENDDKNAAKSL----TTLKWNTKS..... 185
104 4.000e-30UniRef50_A0A0A2E3K5 Uncharacterized protein n=4 Tax=Porphyromonas macacae TaxID=28115 RepID=A0A0A2E3K5_9PORP  ali  22  26.................................................................GKDIRYYFLQMPAAHVPMLTNEDRVALLD---AFGKDNAPSAVRGALVGNVRLELTDTYLRLRTSKVGTLELLLLPLINGTPVISQISTVEQPIPDATIAFFTPEWQPIKQSLIASELSMDDFMPENVNPDTPEGAKLKQLLTPLHVIYKIDPNRNELRAIAKLRCDASLET--ELVHLIKAMPVVFYWSRGMWAKK. 219
105 4.000e-30UniRef50_C3J7P8 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=C3J7P8_POREA  ali  22  4........................................RNFVHPLFVGLFTFLWIALPHSSLRAQSLEELIVALPEGTIPFLDVEARESLLKA-----EPTQEVEVQ-ALGALLVLDRTKRFLSF-GTGVLSFEMVALPHSGGD-ILCCIATIKEPFVYSSISFFNKRGETLPPESFLPSCPITDLLLP------EASDQDRAKVFGLSRYIFFSSSEEILNVSLVPESAPTEEKKEHWRTLLRPEPLRLKWRRKAFQLK. 214
106 5.000e-30UniRef50_A0A1F1E123 Uncharacterized protein n=1 Tax=Porphyromonas sp. HMSC065F10 TaxID=1739394 RepID=A0A1F1E123_9PORP  ali  17  1..........................................MRRYTFLTLLGLLAHISLAVGLQAQSVDEVFRRMPDELIPLLPDSTRAELLESPE-------GVSVVNRFGGESVMSRSEQGLRLSLDRLTELEVGLLPH-GKSYYICLIATSTIVPAQSVVTLFDADWNRL-QEIPFTLPSPEHFITGP---LSTRIKRSLAELGHLHWRATMDPEPQLLTVRINLDEETSQSLYPE--MYKKLQPVSMKWRENHF.... 207
107 2.000e-29UniRef50_A0A0H3U8P8 Uncharacterized protein n=1 Tax=uncultured bacterium fosmid pJB154B8_contig II TaxID=1478053 RepID=A0A0H3U8P8_9BACT  ali  18  1...............................................MKKLFLLIIYIMCA-NAQAQNLALYFELIPEELVTFIKPEMRRSRID------------------------TISDNFLSMHTSKISTLDIKMIPIESDTTILTVIQSVETVGTDSSIKFYTNTWSRLPLEKYFSTPTYEDFYQANDSVSLEEFSKFCI---PFLVSYKF--EGENIVASIDPEKYLPVEQYKKISPAFTKKPVTYIWSKE...... 182
108 4.000e-29UniRef50_A0A1I5MFG5 Uncharacterized protein n=2 Tax=Prevotella sp. tf2-5 TaxID=1761889 RepID=A0A1I5MFG5_9BACT  ali  25  1....................................................MAVLMVTAFPCAAQQKMRDVFLRMPDELLPYLTENNRLDFID----FMDSGMKAVVNNELGGKSEMSLSDESLTIQVSPAMRMSMRLFPVSEAVDVVCVITTYGTDAPESRVESYSLAWNPVDVSKHLSEPYIADFMEVP....................................................................... 144
109 1.000e-27UniRef50_UPI0003600FEE DUF3256 family protein n=1 Tax=Porphyromonas bennonis TaxID=501496 RepID=UPI0003600FEE  ali  24  16.........................................................IGVVSGTRAQSVGDLFVSMPDSLIPILPDSTRADLLKSPGET--------LTNPFGGEVVLSETEGTLRLALDSSTELELGLLSYK-KRNYICLIATSTIVPAQSVVAFYDTEWHRM-QEPLLEMPDAELFL---TDRESNGVKSGLAEQGHLHWVASFNKDNPELTLRISYDDQTAHSLRPEIREKLH--PVQMRWKRGRYVL.. 208
110 5.000e-26UniRef50_A0A133Y2M4 Uncharacterized protein n=1 Tax=Bacteroidales bacterium KA00251 TaxID=1497953 RepID=A0A133Y2M4_9BACT  ali  16  6...........................................KFICRKGLFLVIPFLLFPQLSVAQSLRDLFLTLPEGVTTFLQKPYREALKKNKDEDYRNRLSASNQNMDSDFQVTFRNKEMLSIAWQDGTSISAVRLKAPGRGYILMLLQSCTTPFPVSAISFYDQRGDLLSSSDFMPSLSAVDLLTKDLSLQE------KTILSTLPLSYRYDIKKKSLEVSSSSSPFLSLEDEAKIGDLLKGRSLLLKWRKGAF.... 229
111 6.000e-26UniRef50_W4UN57 Uncharacterized protein n=1 Tax=Bacteroides reticulotermitis JCM 10512 TaxID=1445607 RepID=W4UN57_9BACE  ali  31  1........................................................................................................................................MKVLALSDTTKIVCAISTACAPACDSRFSFYTTDWKRLPASRYISLPALGDFLTTPDSTTIYAFEEVRNSVDLLLMKADFNKESSELTIALTTMDYLSDEVAGKLKEFYRG-PVVYK.......... 116
112 1.000e-25UniRef50_A0A1D3UWJ2 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=A0A1D3UWJ2_TANFO  ali  14  1...............................................MKQILCILLCFLSVVGMAAQNIKDIFLMLPDNAFPDFTLEKRKEMLKTIGQQPNIN----VENYDGTYAYIELCDGYLSAFYYEGYKYEICYWNLKDGRKLVAVNK----DEGHGDVNFYLYENGNLSEDLYYCPVQLDDFFETSH-LDEKEKGILQDLFENRIVFQHLLPKGTSIEMRISIPFDMSFEEAGLKDEKIIFKHLIFKWLNEKWVKEV 233
113 4.000e-25UniRef50_R7J092 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:873 TaxID=1262936 RepID=R7J092_9BACT  ali  18  1...............................................MLRYTIALIVAIAALTVQARTAADFFMAEADTAFDAISATTRLDMLDYA----HSGLTTPSNNRQGGVARIISVSD-KSIKLTPATSVEASLILTAGKDTVLMVIETLPLPQKDSRISFYDTQWRPLK-KIPLDTPKISDWIATKDKAT---LEQARQQLPFILSTAEYDHETRTLTLTSSMDRYYVSEDTPAALAQMHKR............... 194
114 4.000e-25UniRef50_C3J940 Uncharacterized protein n=3 Tax=Porphyromonas TaxID=836 RepID=C3J940_POREA  ali  15  1...............................................MRRLILIMLCSLSLFSLEAQNIRDIFLMLPEKAV-----DNRWSVEERKKLLTHVGVPAEGQEWIEPYVEVDERNGYLRAYLSPDPTLEVCYWNLKDGRKLVGVNNAFG----YSDLKFYIYDRGRLREDRSLSEVKVEDFYET-SQLSPKQRANLTDAFKHRLVFLKLPQKGTSIEMYVGAREQDAEYDTMFLGDLVDTKYVVFRWVNERWVKEV 226
115 9.000e-25UniRef50_A0A255TQ67 Uncharacterized protein n=1 Tax=Prevotella sp. P2-180 TaxID=2024224 RepID=A0A255TQ67_9BACT  ali  17  5.......................................SVCLKFSITRAILVLLTCVPSCANANGMDIRDVFAAMPDSVIPYLSKNNCLDMID----FAEMNMKAEVTNKFDEKCEMSLTNKHLKIKLADDVVVEMRILP-DSSSYVVDVLTTYGHAPQLSMLSMYSSSWNVIKKPHLLNGY-VKQLVGKNQYTTDKEWRIIEDAKNRIFVVGNLVEDENAILLQPSINGLTKEEKQMI....................... 214
116 2.000e-24UniRef50_A0A2N2XNZ8 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-21 TaxID=2013690 RepID=A0A2N2XNZ8_9BACT  ali  13  1...............................................MKHIFLFLVSSFLIHSLPAQTITELFVALPDSSVLGISKAEREKIIKYSLDNKNAENAYENYNLQYALEIIDIKNGYLKLVGAIEGKWDMCYWNLGNGAKLVVAYEEGCGPVCIEQFDFYRFEFTPLSTNTIIPEI-YNDFFVGN-------VEQQKKLLDKNDITATLPRTGKNIVARW.................................... 183
117 3.000e-24UniRef50_UPI0004804283 hypothetical protein n=3 Tax=Bacteroidetes TaxID=976 RepID=UPI0004804283  ali  13  1..............................................MRRVTLIILITFSLTNLSFGQTIQEIFKALPLNYTGELTTEAKDSLIEQETYTIPGGDSDETE-----KVDYSAGKDYIRLDYSGFIVIELRRFQKADGSFVVVYSKYGGAEDQDSLLTF-DYENGTLKQNENLGLPKTRAFLKDNLPDSLKEEKITLST------SYNLKPKET------NGVEYEVDPQSDQFIKWIKTERILFTWNGKRFEKR. 210
118 1.000e-23UniRef50_UPI0005569227 hypothetical protein n=1 Tax=Algoriphagus marincola TaxID=264027 RepID=UPI0005569227  ali  13  60..............................................MIKVLFILLLTVCLSYGALGQTIQEIFKALPLSYTLELSNETKNLLMEEGNCTMPNGDSLETM-----SVDYLTEKDYIKLQYSGFIVIELKKFQKIDGAPIVVYSKFGGTPEQHSLVTFDYKNGTLLANKNLLPETLETAAFLKDNLPDSLKEEKIS-----ISTNYNLNPEKS------NQVEYEISHQNDQFDPWIETKKLTFEWNGHRFQK.. 268
119 2.000e-23UniRef50_A0A1J5H9D5 Uncharacterized protein n=1 Tax=Porphyromonadaceae bacterium CG2_30_38_12 TaxID=1805325 RepID=A0A1J5H9D5_9PORP  ali  20  1......................................................MLFLFLSLGLYASLLDSIFMRMPDKLIPTLTRQQRFELAEYF----KAQRKDSTQNRFGKSSILIQYDNHLLVKTSASSTTEIRQFQKPSGETYLGVICTVSMPVTNSSLSFYNSDWSLSPISVSIP----------------------QSKTFVSYVQLRFHETEHTLMATYQSILTTEDEK.......................... 160
120 2.000e-23UniRef50_D5ERY7 Uncharacterized protein n=15 Tax=Prevotellaceae TaxID=171552 RepID=D5ERY7_PRER2  ali  22  1...............................................MKKFMMALLLATTLNQASAQSIRDVFRQMPDSLMPYLSKNNRLDFID----FLDSGMKAEVKNQLGGTSQMILGDDSLTIRMNPSLRTDMLLM---DSTVVMIETFTVDSIYGQSRVHYFTTAWQPIAAPQF.................................................................................... 128
121 2.000e-23UniRef50_A0A1H0J6G7 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A1H0J6G7_9BACT  ali  16  1...............................................MKKLLIFALLFCSQLSLQAQTIREVFKLMPDSLLPYLTQNNRLDMID----FMDAKMKAAVDNQLGGESEMTLSDDSLCIKMNESMTLELKM-SRDEKEPIVFMKRTYQITERQKEILIYSSSWRPISDVSV.................................................................................... 134
122 5.000e-23UniRef50_A0A0A2DRQ6 Uncharacterized protein n=1 Tax=Porphyromonas sp. COT-239 OH1446 TaxID=1515613 RepID=A0A0A2DRQ6_9PORP  ali  22  39................................................................................CPLIDVEARGQIVEAMRSLEAKGSSSEV----------------FTLQANEVSNLSITLMPMPNGTPVICVIETLSRPRRDSYLRCFSPQWQELDARAFIPEPRREELLAALSLAPESIRERLRQMLTPLYWGLEW-GDGATLRFTPQPIPLPAGSTEDELNEWLSKLPILYRWRGVRFERQ. 205
123 1.000e-22UniRef50_UPI0009DDF877 DUF3256 family protein n=2 Tax=Prevotella brevis TaxID=83231 RepID=UPI0009DDF877  ali  17  1...............................................MKRILNLCLFLFAMVSVFADTIGELFKLMPDSLMPYLTKNNRLDMID----FREAGMKAEVNNLLEGISTMTLSDDSLCVKMSDALRIDMKLI-VKGDNLLVRVQKTYIYNKCQTEVSLYTPEWQLVDT....................................................................................... 129
124 2.000e-21UniRef50_A0A0A2F1Z7 Uncharacterized protein n=2 Tax=Porphyromonas TaxID=836 RepID=A0A0A2F1Z7_9PORP  ali  19  1...............................................MKRILSLVCALGLSSLATAQTLSSYIKS-----CPLITDAQRTQALQDLEQR-----------ELLPKGVTSYT-----IATSDLSRLSIKLFPMLNGTPLVLVIESVDAPIKDSSLRSYSPSWQELPQVKLFDREPLRPLILERWGMRAGQYQRLGQLLYPLHLEMSWVEGEDLLSVRPILPLTLSDEHEELVSVAEQRPELLYRWNGSQMVLQ. 202
125 3.000e-21UniRef50_A0A1Y1T6E3 Uncharacterized protein n=4 Tax=Zunongwangia TaxID=417127 RepID=A0A1Y1T6E3_9FLAO  ali  13  1..............................................MKKLMILTFLFCFGINYCFGQSIQEIFKSFPSTYIPEMTNEAKDSLSENGTYFPKAEDYMETMKADYWT-----ENNYIRLQYSGFFIIELKKFQKNDGTPIVVYSKFGGSPKADQHISYENNSLEPIENLGLPKTIETKEFLKEKILDSLDGKKLNMNT------SYSLKTNDNN-CVEYNI--------YPEIAPWVKTEKFSYIWNGERFEPK. 211
126 1.000e-20UniRef50_L1NF88 Uncharacterized protein n=2 Tax=Porphyromonas catoniae TaxID=41976 RepID=L1NF88_9PORP  ali  22  1.......................................MRSYLKGILALVLLGAPLLTLHAQLVSEYLIKAFLRM--------DILTEQSQLVIASSLRDSTLLLPLD--LGEGIRLTRANETLTIETSEVGRSDLRLLQRKDGSYIVGLIEIIRGETTDSRLSFYSTEGEKLSYPS-ISTPSRAEFLSGLDIPKTSAGYRFLELLTPLPLALSWHNEGTNLYAELLPPLRDEDETDKALESLLQMLPFVSHWNSSTFTP.. 215
127 2.000e-20UniRef50_J4VTQ1 Uncharacterized protein n=5 Tax=Porphyromonadaceae TaxID=171551 RepID=J4VTQ1_9PORP  ali  22  39..................................................................................LLDEDRRTQLATLLAQDSALSLPMELD---LGAKLLAISEHSLRLQTSPVGTAELRLLPLTSGGPLTTLIETVSSPQVDARISFLSASGEVLPSTTLLRLPSSEDFLRGLQLPMSTASDRLRELLYPLHYELSWAQGTSAPTLIVRPTLLLSEEDKELKALIAQLPALTTTWGGQSFAP.. 218
128 8.000e-20UniRef50_UPI000478F083 hypothetical protein n=1 Tax=Algoriphagus terrigena TaxID=344884 RepID=UPI000478F083  ali  12  1...............................................MKRLFILLFLVLLSEYSVGQSMEEVFKSIPINYTPELSSGGKDSLIHFGVYTIPGGDTLSTM----EIAVTESKPDFIQFNLYFSSITEIRTFKKKDGSTIVVFAKSGGAFDQYSLLTFEYSDGDVLSRELGLPEIAWNEFLKSNLPDSLKLQEMTLST------SYDLYPQTS------NAIAYLLNPQTQQFNDWIGEVEFLYVWNGNKFERKV 212
129 8.000e-19UniRef50_A0A0X8JRA1 Uncharacterized protein n=1 Tax=Desulfomicrobium orale DSM 12838 TaxID=888061 RepID=A0A0X8JRA1_9DELT  ali  15  48...................................................................NITVFFELLPEECFPAPTAGQRKELLDGKTV---NGLRIGVR---------DIRNGYMNLTGPFEGVWEMCFWNTADKGKLVAVNARSCGPVCRARLFFYRLDADGVLQSDPEVWSALERQFEPGDRLGPRELEALKNLA--KTVVYDLPRLGRDIVAR---RDKNAPPEKGVPEMLMRSDPVVFVWDGMSFTKK. 233
130 2.000e-18UniRef50_UPI000DEAB673 hypothetical protein n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DEAB673  ali  18  10.....................................................VLVLATFTVPALALDVKDVFVKLPASCFPGEDNSAIKDPAKRKVLINSPEDKVEGRPMLVWKVEADTKNGFIKIDSSEGAVFTMALWNCKDGTKLAGVIEQWTNVANDTHISFWKVDGDKLTTKDILPDLNLSSFY--SDKRQELVKKAAKDNFR---WWWHLPQKGTTIDVS-APAIELIEEYEPLANPDHAYEG---RWDGKKFT... 219
131 5.000e-18UniRef50_UPI00094BA321 hypothetical protein n=1 Tax=Tenacibaculum agarivorans TaxID=1908389 RepID=UPI00094BA321  ali  12  1....................................MRSLYSIKKIDMRKTLLLFFTLFTASYGFGQNIIDIFYKLPSEIILNKTIDQRKKLVDYYTKTIKVPESKRIPSSPQEFIKIDKANGFMEIYDGNEGAIQICYWNQNNNEKLIAINYVTSATFKETQVTFYTPENQTLEKDNVIPYSKIHNRLLKSGLSQSDNHNNTSGILSKQNIIFDLPRFGKKIKAKFGWNEIDDKER------YIARKECALIWKN....... 222
132 1.000e-17UniRef50_A0A1A9LIP6 Uncharacterized protein n=1 Tax=Aequorivita soesokkakensis TaxID=1385699 RepID=A0A1A9LIP6_9FLAO  ali  13  2.................................................KAFSVFALLFFGQIGFSQNSIEFFQMLPDSIVLNLGPSERSQIVAHSKNNKSFEEAYKVMNSTQDKYAFEVNKTYLKLIGSLEGQFQMKLWKLPKPYVLVGVYKESCGPVCVAQLVFYNTGFEELNLKNVFPLQKMKEFIFPKIPKNSFEEDW------MDFLLYQFAEKGKSIQVTWN................................... 181
133 3.000e-17UniRef50_A0A086AH85 Uncharacterized protein n=14 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A086AH85_FLAHY  ali  12  1...............................................MKKVFYLSILFLSIQNLCAQNIVDFFYSIPAQYLDSLSYVERKSLIKN-KRLEKYDMLYTVEY--------DIKNGYLRLEQSGYGIYEIVYWNVKNK-KLIAVSSVLGGGFHQNNFKFFEYKDENLSENGYLKSYTSNFEVFINNLVGEFTKKNTSQSVKGDLFTIALPRKGKNIAVSFK-ENNMSDPTYKNYARYLNFREKVYKWN........ 213
134 5.000e-17UniRef50_A0A2N0JA99 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2N0JA99_9FLAO  ali  13  4................................................RRLNILTLFLLCSFCSYSQNIVDLFYMLPEEYT-IIGKQERKSLVKN---------KKISDGEMNQNIFIDKKNGYLSIKTSFDSRFEMCYWNFENKKLI--AISTYGGNTRQSDFKFFIYDNDKISDKPIFKEYYPNDFYSKMTRKQILEYESLHPSLTF-----SLPRKGKNIEIK-----YENQKSESDSGPFFDTPTKILKWNG....... 211
135 7.000e-17UniRef50_UPI00094BA571 hypothetical protein n=1 Tax=Algoriphagus marinus TaxID=1925762 RepID=UPI00094BA571  ali  12  18...............................................................AFGQTIEDVFRAIPLEYTIDLNLEAKDSLIQNGTYAIPGGDERE-----SLKCDYTSEKDFIQLIYSYPSIIEIRKFQKIDGSLAVVYAKFGGTRSAQHTLLTFDYQDRSLTLNENLGLP-----------KTIEAFQFLKDNLPVKTPSRNLNTSYNLVPAEASSIEYLVNPFTNQAEGWIKTDRFLFTWNGEQFEKS. 210
136 5.000e-16UniRef50_A0A0M9DS29 Uncharacterized protein n=1 Tax=bacterium 336/3 TaxID=1664068 RepID=A0A0M9DS29_9BACT  ali  13  1...............................................MKRLVFLSIFCLTVWVCTAQNISDLFKQ-----FPYKQPGTQKDLPNNRLYASNNDAFINIENI----SDMTTEQSFIAFTKADGSKIYGYRYYENGGREYESVYST----------RFYNEQWTELPQ--ILLLLGYDTFWGSTKPLPPKEY------LQKFAIDYVLPRNGNVIVVRLRPQPIFPEDNLDKVKLQFRYAQIQLIWNKGVFEL.. 198
137 3.000e-15UniRef50_UPI000278379A hypothetical protein n=2 Tax=Leptospira interrogans TaxID=173 RepID=UPI000278379A  ali  12  59...............................................................................LLPYIFSESLKSKEQRAAAFGRSGEYDPNTGVDWGVAVTDRQNGYLMLQLNESSRIEIAQWKLKSGTDLIGINYAHGGMEGLHTISLSSGKWIDV-TETVFPKIKTAYFKPKPVEEGQE---------VPKNFICGLPRKSLNISCEISMTGFEGEE-------YYNQPKITYYWKNEKFSLKL 233
138 4.000e-15UniRef50_W4UMK5 Uncharacterized protein n=1 Tax=Bacteroides reticulotermitis JCM 10512 TaxID=1445607 RepID=W4UMK5_9BACE  ali  24  10..................................................TLFVAISIFASGSLYAQEAKKLFVSMPDSLCPLLTSVNRADCID----FLESKMKAEVDNRFGKKSEMTLSKDYIRMQMS..................................................................................................................................... 86
139 2.000e-14UniRef50_S3W5E7 Putative lipoprotein n=3 Tax=Leptospira TaxID=171 RepID=S3W5E7_9LEPT  ali  13  1..............................................MIKYIAIFIQFVNLLSSCSGKTVADYFFRLPRDLFGLKTDEQRIAALLSSKSPYDTKGIEK-------YSLIESSANYLQLRLEGTSDIILASWKNTEHSDIIGIIRTYSDTDSSNTVSFYTNEWKEI-TEQIFPGIRTEYF--EPINVKSFPKEST-----PAHIHCSIIRNYNDIACRFSLVGENPED-------YYKRPSIVYHWEKNRFVL.. 217
140 8.000e-13UniRef50_L1MCI2 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 473 str. F0040 TaxID=1035197 RepID=L1MCI2_9BACT  ali  22  1...........................................................MFNSSTSTYLESLFYAVPLAILPLLNSGARLDLWD----LHRAEQYAAVSNNLNGETSLEKVDNSLTLRYTPASTWKMELLP----DSTIRITRTFFARDTSQITELYNKRWQRIK........................................................................................ 109
141 2.000e-12UniRef50_A0A0E0T1N1 Uncharacterized protein n=3 Tax=Desulfovibrio vulgaris TaxID=881 RepID=A0A0E0T1N1_DESVR  ali  15  1...........................................MSRLMR-LYGFLLLVFASTTAYAETTRDVFRQMPATIFEGLTEDEKLQLTEQGESHYWA--------------IVTDTPDRLVVASLPESRVAVHLF-LNDGNTGVAVVGTNSGAAC--TIEVWRLEGGRLVPAAGPDEPPASDFFVQGNSLPEG--------IDPSIM---LCLGDANLEAR---PLFWTETGLADIKP---DNTVDFIWNGRTFEKRI 196
142 6.000e-12UniRef50_UPI0009F3DB60 DUF3256 family protein n=1 Tax=Prevotellaceae bacterium Marseille-P2826 TaxID=1852368 RepID=UPI0009F3DB60  ali  27  10....................................................................LESIFYAVPLSLLPLLNTTARMDLID----FYKEQQSAAVVNSIGGETTLELEEKCITLRYTPASIWKMELL----ADSTIRVTRTFYARDTTHLVRVYNKKWQVL......................................................................................... 108
143 8.000e-10UniRef50_A0A174V8V8 Uncharacterized protein n=1 Tax=Prevotella copri TaxID=165179 RepID=A0A174V8V8_9BACT  ali  13  8...........................................................................................................................................................................................LVAKPDTMSEAKFEELKGKIELKIVSALLLQHENSLVVRLALPFVSADDKKAINAIKVQRK---YNWNGKTFKES. 79
144 5.000e-09UniRef50_H2CLA7 Uncharacterized protein n=2 Tax=Spirochaetes TaxID=203691 RepID=H2CLA7_9LEPT  ali  16  47...................................................................TIEDYFRLLPYKAIASADSVEREAILSSQKVQRKATGPCA-----NELEQVDTTIAYLRYRGDKKTDVEIAAWKRGSAPDLIGVNESIIGTGMSSTVKFYDGNWTEI-TASVFPALSAADFGGEGTTS--------------IPLYVQFSQFDRNIVVKPTMPLPAGSEKIMGAR-------RTLKWSDGRFVKE. 221
145 7.000e-09UniRef50_A0A0E9FG17 Uncharacterized protein n=1 Tax=Chlamydia trachomatis TaxID=813 RepID=A0A0E9FG17_CHLTH  ali  16  1......................................................................................................................................................MVKSWNNASSDSDLKLYSIDWSTRKENNADVALEIE----KPDTMLASTYSDLKWLISPYFIILTLSEKENSMKVDYAFP-LLGRKDDERVRPIVKTKC--LRWVDNKFQ... 103
146 2.000e-05UniRef50_UPI00056DB3CF hypothetical protein n=3 Tax=Verrucomicrobium TaxID=2735 RepID=UPI00056DB3CF  ali  16  4........................................RSSLSSLFAITLLFLAAVAAPATSHGQTVVDFFHLLPDETFGELTPARRKALLEDAAAVAKAKEETHVR-----EIKVDTKNGYLDFTSGEGMNVHMTYWKKKDGACLIAVVIDGWSVASHSTIKFY--RWDPAAPKKLIPALHAENFFKTTKEIGAEAEAAGLK------WWWVLPQKGTSIRIQ------GAEIGEDQLGDKLGPPQYVYIWNGIDFSMK. 231
147 8.000e-05UniRef50_R5PE83 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=R5PE83_9BACT  ali  22  1..............................................................................................................................................................................................................MDPYLITANMSPDSEEISVSASVANVTDEEQDKINAILVQRK---FKWNGNSF.... 50
148 1.000e-04UniRef50_T0FRR7 Uncharacterized protein n=1 Tax=Leptospira alstonii serovar Pingchang str. 80-412 TaxID=1218564 RepID=T0FRR7_9LEPT  ali  16  16................................................................................................................WGNHTINKTNGFLSIMMGSDYKVEFAVWRKPGNSSIVGINSTY-GFQRNSLLSFYENEWSDV-TNQIFPGLQQSEFYKLNRSGLE---QESIKKIKEILYYCELPEKGFTITCAL-YGDYL--EHLGDSQIY----NISFDWKNEKFEKRL 161
149 1.000e-04UniRef50_A0A117DPY9 Transcriptional activator domain-containing protein n=1 Tax=Deinococcus grandis TaxID=57498 RepID=A0A117DPY9_9DEIO  ali  1...............................................MKNFTVILLISTQYSISNAASIDSVWQYLPLYALPTLKYDPEIKKLQTLTPLSRAKLLNS------PNSIVDHKNQYAILDLTEGGYLEFTVWNGKGGLGAVGLNR-YRGDEDVQALYLFDSAFKNITNMLRVSPIDAGTFYKKITGVSPKGPVRTAVNLPRFSIVISLKPDDSRLLAKCTVNDYTCGDRLDVLK---------LVWTGSGFKR.. 205
150 4.000e-04UniRef50_M6CI97 Uncharacterized protein n=8 Tax=Leptospira TaxID=171 RepID=M6CI97_9LEPT  ali  13  39...................................................................DIVELYQVLPFEVFHEIPLEQKELILSRKANFDEMSIE-----QTWGNHTINKTNGFLSIMMGSDYKVEFAVWRKPGNSSIVGINSTY-GFQRNSLLSFYEFKFNEWSTNQIFPGLQQSEFYKLNRSGLE---QESIKKIKEILYYCELPEKGFTITCAL-YGDYL--EHLGDSQIY----NISFDWKNEKFEKRL 226
151 6.000e-04UniRef50_A0A2E6LYA9 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6LYA9_9GAMM  ali  14  1...............................................MKEFLFIFLLVFGQNSLADKNVKDYFLSIPSQMLPLVSKQAREAAID----------------------TLDVKNDFMVLQGDTISKYEIALFRSAEKKPVVLV--TADGVSVQNVYAFFGDKWHYVSGSIFPKETLIADLYLSAGIMINGKYEKDLAMVSHTLVRYKLPRMGESIQAYASHPDILN............................. 183
152 6.000e-04UniRef50_UPI0007745BD8 hypothetical protein n=1 Tax=Leptospira borgpetersenii TaxID=174 RepID=UPI0007745BD8  ali  16  39...................................................................DIVELYRILPYEVFHIIPLELKEQIL-----TREANLDETVRTQIWGYHTINKENGFLSIGIPDYYKVEFAVWRKTDKSSIVG-INSMEGFQRNPLISFYSNEWFNV-TNQIFPGLQQSDFYLNPNGLEPESIQKIKEIL----YYCELPEKGLTITCNLYGDYLEHLGDSQIYNIL-------FDWKNEKFEKRL 224
153 0.002UniRef50_E6X7R5 Uncharacterized protein n=1 Tax=Cellulophaga algicola (strain DSM 14237 / IC166 / ACAM 630) TaxID=688270 RepID=E6X7R5_CELAD  ali  13  1...............................................MRKLIFLVLIGIFSATGYSQTIKSLFRWSPLSIFDGLESSEKEELLKKGESAYWKLMEATNT---------KLVINHIH----NGDRVTLRFFKHKDSDGVLFAEVENGANTSLSSWN-YDEESETLQKSNLLHKYTANDFVSKEDKLPDS---------YHAVVHYSFI-DELTIQVSLYTWMEKEFENRKISNELF------LKWNGENFVEKI 213

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.