current user: public

If you have questions about the server, please let us know.

Query: PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# E-value Template Links and tools%idFirst MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAPLast
1 8.000e-35UniRef50_A0A1D3UGI5 Tyrosine recombinase XerD n=39 Tax=Bacteria TaxID=2 RepID=A0A1D3UGI5_TANFO  ali  98  1MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRALDFLKMYAGENLPFFKIDNAFAEEYKRFLSTAP 189
2 1.000e-30UniRef50_A0A174WIE0 Integrase n=124 Tax=Bacteroidetes TaxID=976 RepID=A0A174WIE0_9BACE  ali  48  1MKKAFSHTKVAVKLRKSPYAEAWFIYLEAYPVYDYEGAKPKRVREYLNRTITTPVWDKNQPTRKSNGEQHYMPKRDVNGVIQCRSQVDQQSCMYADRVRDTWQHEYDSTALYTEKDAETAAQQEKSRAHFLDYVKFLTYERHKGDSESIIGNWERFLGMLKEFTGKNIPFSEIDMPFIENYRNYVLTAP 191
3 4.000e-29UniRef50_A0A1C5ZX82 Tyrosine recombinase XerD n=22 Tax=Bacteroidales TaxID=171549 RepID=A0A1C5ZX82_9BACE  ali  54  1MKKALPNTKVTVKLRKSNYKDEWYLIIESYPVYKRGSKQASRVVESINRTISTPIWDKSSIRILPDGTFNYKPKRDLNGIIQCRSTIDQEACIYADNVRKLRQYEYDSAILYTDKENEIAAQNERSEQDFIKYFNSIISKRHPNSSDSIIANWRRVVELLKIYSKGQIPFKEISVKLLEDIKMFLLRAP 191
4 5.000e-29UniRef50_J9FE40 Site-specific recombinase, phage integrase family n=3 Tax=root TaxID=1 RepID=J9FE40_9ZZZZ  ali  51  1MKKALAHTQVIVKLRKSVYREEWYLLLEAYPVFQDGSTTPKRTREYVNRTISTPIWDKSRKKVDSNGKATYKPKRDLNGVIQCKSHLDQEACIYADKVREIRQREFDNAFLYTDTDSEQAQQLARSRYNFLEYFSEMEKKRHAQFSEAISTTWNRVYENFKIFINGDIPFSKIDLKLIEEFRLYLLSA. 190
5 1.000e-28UniRef50_UPI000408F1C3 site-specific integrase n=3 Tax=Algoriphagus TaxID=246875 RepID=UPI000408F1C3  ali  26  1....MKATKVTLRKR-PLENGKISLYLDFYPPIVDPNTGKKKRRDYLGFHIFE------------------------NPKTPTQKEFNRVCILKAESIRTQKEIEFLNNNFG-------FYDKFNLKRDFLQYFLEKGKTHSRTS--GNQGNWKSAYEHLKLYSGGICTFAEVTPEFCEGFKEYLSKT. 150
6 8.000e-28UniRef50_A0A2W7R9A3 Site-specific recombinase XerD n=1 Tax=Algoriphagus ratkowskyi TaxID=57028 RepID=A0A2W7R9A3_9BACT  ali  24  1....MKAIKVTLRKR-SLENNKVSLYLDFYPPIQDPSTGKKKRRDYLGLHIFAS------------------------PKTPTEKEFNRICLLKAESIRNQKEIEFLSNNFG-------FYDKFNQKRDFLQYFLD--KGRSRSSSMGNYGNWKSAYEHLNIYSGGSCTFSEVTAEFCEGFKDYLSRT. 150
7 1.000e-27UniRef50_A0A174VMK7 Site-specific recombinase XerD n=11 Tax=Bacteroidales TaxID=171549 RepID=A0A174VMK7_BACUN  ali  23  5......CTKVTVRKR-PIKNGQLSLYLDFYPPIRHPKTGKLTRREYLGIYIY------------------------ANPTEKFEAEFNKTMLRNAELIKCRRTEAIINEEFG-------FLDRNRGKESFLEYFRS------KMADDDNFRNWNVAYKHFEKYCGGSCTFDDLTVEYCQGFLTYMLS.. 147
8 2.000e-27UniRef50_D2QNA3 Integrase family protein n=11 Tax=Bacteroidetes TaxID=976 RepID=D2QNA3_SPILD  ali  20  2.......IKVHLR-KKSISNGRTSLYLDYYPAIPHPDTGKDTRREFLGLYLF------------------------NRPKTPADKEQNAETLALAENLRAKRQIDVQNG-------AYGFLSKKSLNTCFVAYCEQLAALKTGSNKDG----WESALHYLRDFTGGQLKLSNLTPKKCRDFRAYMMDA. 146
9 2.000e-27UniRef50_A0A1C5VXE8 Tyrosine recombinase XerD n=31 Tax=root TaxID=1 RepID=A0A1C5VXE8_9BACE  ali  23  5......CTKVTVRKR-PIKNGQLSLYLDFYPPIRHPKTGKLTRREYLGIYIY------------------------ANPTEKFEAEFNKTMLRNAELIKCRRTEAIINEEFG-------FLDRNRGKESFLEYFRS------KMADDDNFRNWNVAYKHFEKYCGGSCTFDDLTVEYCQGFLTYMLS.. 147
10 2.000e-27UniRef50_A0A0X8C070 Integrase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0X8C070_9FLAO  ali  25  3.......TKVTLRQ-KPISKGRKSLYLDFYPPITVAGSDTSTRREFLGLYI------------------------MNSPKTPLEKQDNKQTLQLAEQIKQKRDNEINKPEVYTAFEIEQLKVREKGELSFISYFEQQMEKRIGK----NYDVWFSSFFYLKEFSKGSLKFSDLNEKFCNDYKDYLLNA. 154
11 1.000e-26UniRef50_D2QEW1 Integrase family protein n=2 Tax=Cytophagaceae TaxID=89373 RepID=D2QEW1_SPILD  ali  19  2........KVTLRE-KPINDGKISLYLDFYPAISHPETGKDTRREFLGLYLF------------------------DKPRTELDRQHNKATKLLAQNICATRQLEVQAG-------NYGFLKKKVVAVDFLAYFKKQADIEKARDK-GSRNNWNSAYLHLYNFTTGKLTVDEVTADFCKSFRDYLTTA. 148
12 1.000e-26UniRef50_I8ZLK9 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=I8ZLK9_BACVU  ali  19  1....MSKCKVTLRKRKIKNGTQYSLCLDYYPGYRDNTTMKVITREALGIYIF------------------------AKPANQQERDFNARMMKKAEILRNRRYEAIFN-------ENNGFFDKSKMKGDFLAYFKELADRKNIK--------WQHVYKHFERFVNGKCTLEEVDVDLCRKFMEYLLNAP 147
13 2.000e-26UniRef50_B0NN78 Site-specific recombinase, phage integrase family n=3 Tax=Bacteroidales TaxID=171549 RepID=B0NN78_BACSE  ali  30  1MRKA-KATKVTLRFRML-TTGKETLYLDYYPGIPNPKTGETMRREYLGMYVVPLKKRTGELQTNKDGSHKYN-------------EEDAETIRLAEIIRANRQNELSKAEIYTEAEAELLKAKERSKGDFIAYFRDCAKDKKE----SNYNNWMSALKHLQDYTKKSKRFCDIDLLWCERFRDYLLN.. 173
14 2.000e-26UniRef50_R6F8S9 Integrase n=1 Tax=Prevotella sp. CAG:520 TaxID=1262929 RepID=R6F8S9_9BACT  ali  56  1MKKALSNTKVTVKLRKSVHDNEWYLFIESYPVYKKGDNKPSRVVESVNRTISTPQWDMSSIRVLPDGSFNYKPKRDVNGIIQCKSRIDQEACIYADNVRKLRQHEYDNAALYSDREEEIIEQNERSAQDFIKYFIDIIDKRHPNSSNAIIVNWNRVGELLKMYSGKPIPFKSVTVKLLEDIKMFLLRAP 192
15 2.000e-26UniRef50_A0A1B8ZCA4 Recombinase n=117 Tax=Bacteria TaxID=2 RepID=A0A1B8ZCA4_9FLAO  ali  56  2..KQITKTQVTVRLRKAEDRNEWYLYLEIFPVFIAGKEEPQRVREYLNRSVKTIEWDKKRVARTKTGVKSFKPKRDDNGVIICRGERDCETMLYADGIRKLRQKEYDXXXXXXXXXXXXXXXXXXXXXKFTNYCKLLLKKRHGNSSDSIRTNWKCLIEFIVEFAGDDLRFSKIDLSFADDFKMYLLSAP 192
16 4.000e-26UniRef50_A0A180FIV2 Tyrosine recombinase XerD n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A180FIV2_9BACT  ali  29  2..RKLKTTKVTLRFRMLDT-GKETLYLDYYPAVYNPQTGKETRREYLGMYVVPLQNRKGELHTNRDGTHKYN-------------EADRETIRLADIIKANRQNELSKAEIYTDQEAELLKAKERGKGDFITYFQDM----GKDKRDSNYCSWQSALKYIRAYTRETKRFCDIDLLWCERYRDFLLN.. 173
17 5.000e-26UniRef50_UPI00020F0253 integrase n=1 Tax=Porphyromonas gingivalis TaxID=837 RepID=UPI00020F0253  ali  19  4.....TCTKVTLRQR-LYDSGRISLYLDYYPAIRNPETMQMTRREYLGIYLY------------------------AHPKNEMERSFNNDMLNKAEAIRCIRVQSLINEEFG-------FLDRTKMKTDFLAYFLKMCRKKDQK--------WRIVYQHFYNYVQGHCTFGDVTIELCQGFREYLLNA. 146
18 5.000e-26UniRef50_A0A255TT37 Integrase n=181 Tax=root TaxID=1 RepID=A0A255TT37_9BACT  ali  20  8.........VTLRTRKIKGGEQLSFYLDYYPGYRDESTMKVMRHESLGIYIY------------------------AKPKNQREKDYNERMREKAEALRCRRYESIIN-------ERYDFFDKEKMKGDFLAYFKQKADKKN--------CKWQHVYKHFARFCNNKCRFDEITVDLCNKFREYLLNAP 148
19 8.000e-26UniRef50_A0A2T0WVY2 Site-specific recombinase XerD n=1 Tax=Mongoliibacter ruber TaxID=1750599 RepID=A0A2T0WVY2_9BACT  ali  25  3.......IKVTLRQKK-ISKGRQSLYLDFYPAIPHPETGDPTRREFLGLYVFE------------------------KPKTPIDKQHNTDTLKIGESIRQKRENFLNKPEIYSEYEKEQLRKKELGEHCFVEYFRKLANKRKA----SNHDNWVSALNYIEAFTKGTLKFADLNESFFEDFKEYLLTT. 154
20 8.000e-26UniRef50_A0A174RHE2 Tyrosine recombinase XerD n=169 Tax=root TaxID=1 RepID=A0A174RHE2_9BACT  ali  20  4.....TCTKVTVRQR-AIRNNRISLYLDYYPAVRNPETMQMSRREYLGIYIY------------------------AHPKNEMEREFNNDMLNKAEAIRCIRVQSLINEEFG-------FLDKTKQKADFLAYFKKMCRSKDQK--------WQFVYQHFYNFVKGQCTFGDVNVNLCKKFREYLLNA. 146
21 9.000e-26UniRef50_A0A1W2GMA0 Site-specific recombinase XerD n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1W2GMA0_9BACT  ali  25  2........KVTLRQKK-ISKGMISLYLDFYPPLVDPETKKSTRREFLKLYLYE------------------------KPRGVLEKNHNKETKIQADSIRSSRQLDIQANRF-------DFIFKDTKQIDFLAFFKKLTGQRWK--SDGNHGNWLSTYNYLERFTHGQCSTTDIDKAFCEDFKNYLQTT. 147
22 1.000e-25UniRef50_A0A1B1S8W7 Integrase n=2 Tax=Muribaculaceae TaxID=2005473 RepID=A0A1B1S8W7_9BACT  ali  23  4.....TCTKVFLR-RRPYAGGKVSLYLDYYPAIRNPHTNKMTRRETLGIVIFAE------------------------PANEIQRRFNQEMEEKAEAIRCIRYQSLVN-------EQFGFLDKTKQKMDFLAYFEKKAK--------SKYDKWMSVYLHFKKFCGGRCTFGDITTELCEEFREYLLYA. 146
23 1.000e-25UniRef50_B3EKK6 Integrase family protein n=3 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=B3EKK6_CHLPB  ali  23  1....MDVSSVHLRKRKQGKSGRISLYLEFYKGAPDGKAKVLRDYEYLNLYL------------------------DDKPRTAAEKEHNKNILELAKSIKAKRELEIKNGQYGFDS-------CVKAKALFLSYFKAEAEKKSKPGYPGN---WGSTLKHLTRFVEKHVTFREIDKAFCEGFKDYLRD.. 156
24 2.000e-25UniRef50_A0A076P4K9 DNA integration/recombination/inversion protein n=3 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A076P4K9_FLAPS  ali  24  2.......IKVTIRQR-AMTKGMQSLYLDFYPPIFIPATKKLTRREFLKLHII------------------------AKPKNPMERNSNTQTLALAEQIRLKRENEINKPEIYNEFETEQLKEKAKGEVSFTDYFKKQVEKRHG----SNYDVWKYSFNHFKQFSKTDVKFNELTKVFCNDYKDYLLKA. 153
25 2.000e-25UniRef50_A0A0B0BQA2 Integrase n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A0B0BQA2_9BACT  ali  19  3....MKCPKVTLRSR-PISHGRRSLYLDYYPAIRIPDTMKKTRTETLGIYVY------------------------ARPRSQHEKSHNDEMYRKARLIASTRLPAIINKQYG-------FLDTTRGNRDFLEYFRQIVGEH-------NSSLWKGCYNHFRFFVKNSCICAEVDIELCRKFRSYLLSA. 147
26 2.000e-25UniRef50_UPI0009ABDF70 site-specific integrase n=1 Tax=Spirosoma aerolatum TaxID=1211326 RepID=UPI0009ABDF70  ali  18  2.......IKVKLR-KKPITDGRTSLYLDYYPAIPHPDTGKPTRREFLGLYLF------------------------NRPKTPADKEQNSETLALAETLRAKRQIDVQLG-------AYGFLSKKTQNTCFVAYCEQLAASRTGSNKDG----WDSALHYLRDFTGGSLKLSELTLKKCRDFRAYMMQA. 146
27 1.000e-24UniRef50_M7N1G9 Tyrosine recombinase XerC n=1 Tax=Cesiribacter andamanensis AMV16 TaxID=1279009 RepID=M7N1G9_9BACT  ali  27  2.......TKVKIRT-KPMSGNRQSLYLDIYPPVPHPETGQPVRREYLKLFLF------------------------DKPKTELDREHNRETKGLAENIKAKRQLEIQAG-------NYGFLASKKKAAEFIPYFEQQAQKRTGN----TLKCWSVSLDHFKNFAGDNLTFLDITETLINDFREYLL... 144
28 2.000e-24UniRef50_A0A098C054 Integrase n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A098C054_9PORP  ali  21  3.....KAIKVRLREQKNKS-GRISLYLDFYPPIYDADKKKETRRKFINIYLYE------------------------KPKDRIEKEHNQVARMKAEQIRSEYELRLFNKSFGLV-------DRFAGKADFLAYFYEKVRKRY--TSKGNYDNWLSTYNYLEAFTDGKCLFEDVDEKFCERFREYLKTT. 151
29 4.000e-24UniRef50_A0A0C5WB84 Recombinase n=17 Tax=Bacteria TaxID=2 RepID=A0A0C5WB84_9FLAO  ali  27  2........KISIRKKKL-ADGRESIYLDCYF----PNAEKKRVKEYLKLYTYP------------------------NPRNSKDREHNKKTMLLAESIRSKRFMEEQHEQHGF-----GHFVKGDTSANFIKYFEEQTNKRY--NSTGNYGNWDSVLKHLIKYKGEDVLFSQVDSKWLEGFKEYLKNT. 145
30 6.000e-24UniRef50_A0A098S7F0 Uncharacterized protein n=1 Tax=Phaeodactylibacter xiamenensis TaxID=1524460 RepID=A0A098S7F0_9BACT  ali  21  2........KVTLRKKKLKGN-RIRLYLDFYPAVPHPDTGKPTRREFLKLFLYQ------------------------RPRDEEEREHNRETKQMAKAICAQRQIELQQG-------NYDFLAKYFGNEDFLNFLKAQVEHREKIQR--NYQSWRSTYHYLYRFTEGFLPLKKIDVKFCKSFREYMLST. 147
31 9.000e-24UniRef50_UPI000DE4C634 site-specific integrase n=1 Tax=Pedobacter namyangjuensis TaxID=600626 RepID=UPI000DE4C634  ali  27  2.......SKVTLR-KKELASGRISFFLDYYPPIPHPSNGRPIRKEYLKLYMVKD------------------------PNNQVDRNFNKQTELIAQNIRAKRQLDIQNRQYG-------FLSAERLMGSFIDFFRNVVRKKTGTNSD----VWYMALRYLTDYAGHDVRFADLNVHFCDEYKEYLLSAP 147
32 1.000e-23UniRef50_A0A258JTL6 Integrase n=1 Tax=Flavobacteriales bacterium 32-34-25 TaxID=1970508 RepID=A0A258JTL6_9FLAO  ali  24  3.......IKVKLRKRKVTGD-RHSLYLDFYPAVVNSQNGELSRREYLGLYIFDST------------------------RNPLDKLHNTNTLNLAEQIRQKKESEFNKPEIYSALEQEQIKKNKKQDGDFIAYFKKLAEK----KNLSNRFLWLGSCDFLKLFKKNGLKFSDIDPELCDDFREFLETT. 154
33 1.000e-23UniRef50_A0A261Q9R5 Mobilization protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A261Q9R5_9BACT  ali  25  1MALRKTTAKETVRLRKDLKDGVKSLFLDIYL-------NGKRTYEYLKLYLIP-------------------------PKSAADRSKNKETLQLAQSIRAKRQVEIQNKEYG-------FSSAFKLELNFLEYFERVAKE--RLDSKGNYGNWDSALKHLEKYCKSSTTFKDVDVKFVEGFRTYLEK.. 147
34 1.000e-23UniRef50_A0A0Q0XQ55 Integrase n=1 Tax=Nonlabens sp. YIK11 TaxID=1453349 RepID=A0A0Q0XQ55_9FLAO  ali  22  2......TVKVTLR-KKTITRGRQSLYLDFYPPIKNPNKDGFTRREFLGLYI------------------------LSKPKTTTEKQSNKQKLYIAEQLCLKRENELNKPEIYTAFELDQKRKIEAGNKCFIKYCQGLASERKG----SNKKSWKSALNYLVEFCNGSIKFNELNIDVLERYKRYLLNS. 154
35 2.000e-23UniRef50_A0A2E2FHZ0 Recombinase n=20 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2FHZ0_9FLAO  ali  26  2........KVTLRERH--QGGKISLYLDYY-------HKGKRKAEYLKLYIEP------------------------NPKSKAERELNKKTMQLAESIRAKRLIEIQNG-------VYGFRDNEKLKGSFLEYIQLLTNK--RHNSKGNYGNWDSMLKHLKGYIPYDKTFEEIDRQFVMGFKEYLDH.. 138
36 2.000e-23UniRef50_A0A173ZNS8 Tyrosine recombinase XerD n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A173ZNS8_9BACT  ali  23  3.......VKVKL-LQKKISGGRKTLYLDFYPAIISLKTGKETRREFLGLYIHE------------------------KPKNAIEKQYNAEQLKLAEAIRQQKENTHNKPEIYNEYEKERLRKKELGDRDFVEYFR----RTAGKRSGSNHNNWMSALTYLEQFTGGRVKFADLSEQYLEEFKEYLLTT. 154
37 2.000e-23UniRef50_A0A2W5UW87 Uncharacterized protein n=1 Tax=Citrobacter freundii TaxID=546 RepID=A0A2W5UW87_CITFR  ali  22  4.........VKLRSRPTKNGSKKLLFLDIYPPVRNPDTGKLQRKDYLKIFLFT------------------------NPTDKIEWEHNKETLELARCVCAARQLEVQNNRF-------DFLSQRMRNGSFLEFFMSQLRPKKK----SNYEGWRMAIEYFRSFAKGDVKFPEINETFSEEYADYLLSG. 147
38 3.000e-23UniRef50_W8VR01 Integrase n=4 Tax=Bacteroidetes TaxID=976 RepID=W8VR01_9FLAO  ali  28  2........KVTLRERK--KNGKIALYLDYY-------HKGKRKTEYLKLYLS------------------------LNAKSKAEKDLNKKTKELATTICAQRQIEIQNGHYG-------FQDIEKLKGSFIAYVTALAEK--KNTSKGNHGNWYSMLKHLKAFQTTDISFDQVDKQFVERFKEYLDKT. 139
39 3.000e-23UniRef50_F5J2W0 Uncharacterized protein n=10 Tax=Bacteroidales TaxID=171549 RepID=F5J2W0_9BACT  ali  20  5.......TRVHLRQRDV-TRGRISLYLDYYPAIRDTHSMKMTRREYLGIYIY------------------------AKPRNEFEKEFNNEMLMKAEAIRSIRVQSIINEEFG-------FLDKNKAKADFLIYFKTKAEKKDQK--------WMKVYLHFSNFVKGKCTFGQVTVDLCNRFRDYLQDA. 145
40 5.000e-23UniRef50_A0A1A9B1Z2 Tyrosine recombinase XerD n=195 Tax=Proteobacteria TaxID=1224 RepID=A0A1A9B1Z2_PLESH  ali  21  2........KISIEFREPDAEGKRALRLTYYAGSYTGIRKHKRSREPLDLFLY------------------------DKPRTPAQRLHNKETQRAAEAIRAKRLFEYETGKHHLDFSNA-------YKASFFEYFQEVTDQ-KAAGSKSNHSIWISALKHLRQYHKPELTFEEVDQLFLEGFRHYLMH.. 153
41 6.000e-23UniRef50_A0A1Z3W2M8 Site-specific integrase n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1Z3W2M8_9FLAO  ali  27  2.......SKVTLR-KKPISQGRQSLYLEIYPPIYNPDTGIMQRKQYLKLYIY------------------------KRPKNDIEKELNKETLALAEYVRAQRQIDLQSRRFDFISDA-------KMKSNFLDFFEEQAAKRK------NCYNWSMSVRYFKEFAGSIVPFTALNETLCEEYADYLLSGP 145
42 9.000e-23UniRef50_A0A1T5DDA2 Phage integrase SAM-like domain-containing protein n=1 Tax=Dyadobacter psychrophilus TaxID=651661 RepID=A0A1T5DDA2_9BACT  ali  22  4......TRSVKLRE-KILSDGRKSLYLDYYPAIYIPETGKETRREFLKIYLY------------------------DKPANPTQKEYNRISKAKAESIRSERELQFINQ-------NFDFADRLNAKKDFLAYFKAMAAKRNK--SKGNYDNWYGTYKYLDLYTMGKCTFGQVDEKFCEGFKMFLDK.. 150
43 1.000e-22UniRef50_A0A174PQV5 Tyrosine recombinase XerC n=72 Tax=root TaxID=1 RepID=A0A174PQV5_9FIRM  ali  24  1MTKKTTTQKEPVRLRKKLLNGNVSLYLDIC-------RNGKRHKEYLKLYL-------------------------IDAKTPMEREQNRQTLATAQAVKSKRLIEIQNGE-------YSFTRQFKENTPFLEYYRKMVEERHNNESQGNWGNWRSCLRYLEIYCDNKTTFKDVTPEFVLGFKEFLNN.. 150
44 2.000e-22UniRef50_UPI000DCB81A8 hypothetical protein n=1 Tax=Mucilaginibacter rubeus TaxID=2027860 RepID=UPI000DCB81A8  ali  23  2........KVTIRTH-ALTKGRHRLFLDYYPLIVNPKTKKQTGYENLKLFVY------------------------DHPTTPAEKNHNRTTMELANTICAKRQLELQAQKHGMS-------PSFRKHESFITYFRKLADQQRGL----NWHNWDSSVRYFQLFADGDISFAELDLSLCEQFKRFLLDEP 147
45 2.000e-22UniRef50_A0A0J1BFD4 Integrase n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A0J1BFD4_9SPHI  ali  28  2.......SKVKIRKR-PLKDNRHSLYLDYYPPLRHPKTGKLIRRENLKLYIY------------------------DKPKNDYHKKHNKETLLLAEHVRCNRQLDVQNRKFGFLSDDAR-------DADFIEFFKEFNRKKQTSLSDQAA----MSVKYFQAFAGETLKFSDLDEFFCEDYKSFLLSGP 147
46 3.000e-22UniRef50_J5V1K0 Site-specific recombinase, phage integrase family n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=J5V1K0_9FLAO  ali  29  3.........IHLRQRASKKTRKISLYLEIYKGYIRGKIKHIRDYEYLDYFLYE------------------------KPKNQAEKQHNAEQLKFAEAVKAQRILEIQNGTYGFN-------NLHLLNANFIEYFQKLTDE--RKESNGNYGNWDSALKQLIKYAGKIVPFKDVTTEFCEGFKEFLLT.. 149
47 7.000e-22UniRef50_A0A1Y4U8S2 Recombinase n=3 Tax=Alistipes TaxID=239759 RepID=A0A1Y4U8S2_9BACT  ali  18  3.........IKLHQKPQRSTGRTSLVLEYYYGYTRGRIKHRRRFETLEYFLYT------------------------TPRNKAERDHNKINLEMAEKVKAKRLLDEQN-------EQYGFAGQFKIRTNLVEFIRGMIEQ--RKDSPGNWGNWDSMLKHLIAYAGTQTTFERVDRRFVEGFRNYLAK.. 150
48 8.000e-22UniRef50_UPI000C0469BB site-specific integrase n=1 Tax=Bacteroides sp. KFT8 TaxID=2025659 RepID=UPI000C0469BB  ali  20  7.........VTLRQR-PRRNGTLSLFLEFYPGYRDPKTMELIRRRSLGIYIYAE------------------------PKDQLQKDYNAIMLEKAEAIRCNIFTEIIN-------EKYNFFSKGRTKESFLDYFDDL--------SKTKHAKWLSSYKHFEKFSHGKCSFDELSVEFCRKFMEYLMDA. 145
49 1.000e-21UniRef50_J9FIF1 Tyrosine type site-specific recombinase (Fragment) n=1 Tax=gut metagenome TaxID=749906 RepID=J9FIF1_9ZZZZ  ali  21  3.KKISAKTKEPIRLRKKLANGNQSLYLDIYL-------NGKRSYEFLKLYLIP-------------------------GKTKADKNQNEETLRTANAIKAQKIVDLQNEEHGFATIG------NKAKANFIDYMEAQLAMQVEKGRTSYVSSVKSTIIHLRRYKGDAITLKQVDKAYLLGFIDFLNTT. 152
50 2.000e-21UniRef50_A0A1G5JS38 Site-specific recombinase XerD n=38 Tax=Flavobacterium TaxID=237 RepID=A0A1G5JS38_9FLAO  ali  22  1....MSKSIVTLR-KKAISQGRMSLYLDFYPPVWNSAINDYTRREFLKIYVYQ------------------------KPADQYQKIANTESLHTAELIRARRQNEINKSEIYSAFEKEQLVIQAVGNESFLQYYKNL----GNKKVGNNLSIWACAIVHFETFKGRDLSFKEVTVTLIEDYRDYLLKA. 156
51 2.000e-21UniRef50_A0A0R2S024 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0R2S024_9FLAO  ali  20  2........KVTLRKR-ARSNGKIALFLDYYPPIISPKTGLSTRWEYLEMYLYNP------------------------PRDEFEKKHNREVEMMARAIASERQLDRIAGRYGYQRSSE--------YDDFLEFYRQQMEK--KSKETSNHGGWVASFKTYEIFVKGQCSFGELKPQLINDYKDFLLN.. 145
52 7.000e-21UniRef50_R5EU68 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:20 TaxID=1262738 RepID=R5EU68_9BACE  ali  20  1....MNDCKVTLRTR-PLKNRMLSFYLDYYPGYRDKETMKVIRHESLGIYIY------------------------ANPKNKREQDFNEVMAEKAEAIRCRRFESAVN-------ERYDFFDKYKLKADFLEYFRNQLRKHDPK--------WEFVYLHFSNFVHGKCTFEELDIDLCNKFREYLLTA. 145
53 8.000e-21UniRef50_A0A173UJ17 Tyrosine recombinase XerD n=69 Tax=Bacteroidales TaxID=171549 RepID=A0A173UJ17_9BACT  ali  19  7.........VTLRTR-PLKNRMLSFYLDYYPGYRDKETMKVIRHESLGIYVY------------------------ANPRNKREQNFNEVMTEKAEAIRCRRFESVVN-------ERYDFFDRYKLKADFLEYYRKQLRRHDQK--------WEFVYLHFRNFVHGKCTFEEIDIDLCNKFREYLLSA. 145
54 1.000e-20UniRef50_A0A1I2F6E9 Phage integrase SAM-like domain-containing protein n=1 Tax=Spirosoma endophyticum TaxID=662367 RepID=A0A1I2F6E9_9BACT  ali  21  2.......IKVMLRT-KPISKGRKTLYLDFYPAIAHPNTGKQTRHEFLRLYLF------------------------SRPKTPADKEQKAETLALAETIRARRQIEVQAGSYG-------FLSKKNLDTCFVKYCERLAEERVGINKTG----WESMLIYLNDFSDGSLKQTDLTETKCRDFRNFLLTS. 146
55 2.000e-20UniRef50_A0A1I1UGN4 Site-specific recombinase XerD n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I1UGN4_9FLAO  ali  20  4.........VTLRY-KEIANGKKSLYLDYYPAIINPATGKETRREFLKLQIH------------------------SVPKNEMEKSHNKETIQFAELVRSKRLIQIRDKEYG-------FKENINFSLNFVAFYQTIIEDYYNKSSRNNYLSWKASLKYFEEFAGDKLSTNQITLLHIKKYRSFLLST. 150
56 2.000e-20UniRef50_UPI000C0BE45E site-specific integrase n=1 Tax=Sphingobacterium sp. 1.A.4 TaxID=2044603 RepID=UPI000C0BE45E  ali  20  1....MKSYRVTLREQKNKS-GRTSLYLDIYPPIYDEKKKKETRRKFLDLYLFE------------------------KPTNKIEREHNKFTMVKAKKIESEWQMDLLGQTLDMPFISSK-------DLDFLAYFKSIVKKRY--TSKGNYDNWLSTYNYLEDYTKGQCLMSEVDEAFCQGFKDYLDS.. 149
57 2.000e-20UniRef50_A0A2U1AWP4 Site-specific recombinase XerD n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2U1AWP4_9BACT  ali  23  18.......TKVALR-RKPISKERLSLYLDFYPPIPHPDTGKLTRREFLGLFLFE------------------------KPKTQLEKHHNKETQALATNICAQRQLAIQNLNFG-------FLAKEKQKITLLDYYRKEAARH----NGSNGQVWQSSLLYMQDFFSEGQKLFELTVADCNAYKDFLLHA. 162
58 2.000e-20UniRef50_A0A1Y3X0V0 Mobilization protein n=1 Tax=Alistipes sp. An54 TaxID=1965645 RepID=A0A1Y3X0V0_9BACT  ali  20  5.....KKERVNLRKR-LMPSGNTSLYLDVF-------TKEGRKYEYLKLYLVPEH-------------------------TRADKEQNRQTMQLAEAIRAKRTVEIQNDEYG-------FKSAYKEDTLFFDYYKAMCEKRLGAESKSNWGNWYSCLKHLEKYKNHKITFAKITPEWVQGFRDYLDN.. 147
59 3.000e-20UniRef50_A0A2R3Z916 Integrase n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2R3Z916_9FLAO  ali  23  4.........VTLRSKKL-AKGKLSLYLDFYPEIVNPKTGKPTRREFLKLKIFE------------------------NPKNEIEREHNSTQIQLAEQIRAKRLIDIRNKEYGL-------KEHMNLDINFYDFFKSIVGEYYNNGSKGNYHSWKSSLDYWEKYIGKSLMSKQLLPYHVEKFRDFLLSA. 150
60 6.000e-20UniRef50_K5ZVH3 Uncharacterized protein n=13 Tax=Bacteroidales TaxID=171549 RepID=K5ZVH3_9BACT  ali  19  4......CKSVTLRMR-DRRNGTKSLFLDFWPGYRNPETMELIRRRSLGMYIY------------------------ANPISTQQKKYNEAILAKAEAIRCKVFIEVIN-------EKYDFFNQDRLKEDFLAYFKNIVNR--------NFAKCDAAYKHFSRFCHNKCTFEMLDTVFCNKYKEYLLDT. 145
61 8.000e-20UniRef50_A0A2E4GBA6 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2E4GBA6_9EURY  ali  19  2........KISIEVREADSDGKRAIRLVYYGGSYTDPETGKRRHKRSREPLDLFLYDK--------------------PRTPAQRHHNKEAERAAEAIRAKRLYEYETGKHGFAG-------TSQLKASFFDYFQTITDE-KAAGSQSNHSVWVSTLKHLKVFHRPELTFEEVDQAFLEGFKHYLTH.. 153
62 1.000e-19UniRef50_A0A1H5N4Z6 Site-specific recombinase XerD n=3 Tax=Salinimicrobium TaxID=561367 RepID=A0A1H5N4Z6_9FLAO  ali  24  4.........VTLRSKKL-ANGKLSLYLDFYPQIINPKTGKPTRREFLKLKIFE------------------------NPKNELEREHNSTQIQLAEQIRAKRLMDIRNKEYGL-------KEHIDLDANFYNFFANIVEEYYNNGSKGNYHSWKSSLEYWEKYIGKNLNTKQLLSYHVEKYRAFLLSA. 150
63 1.000e-19UniRef50_A0A1I4WA83 Site-specific recombinase XerD n=1 Tax=Algoriella xinjiangensis TaxID=684065 RepID=A0A1I4WA83_9FLAO  ali  30  3.......IKVTLRKR-PLKNGKLSLYLDFYPSIIR--NGKSTRREFLGLSIYE------------------------NPKGQIEKQYNKNIEAIAESIASKKGIELNRPEIYNDMEKAQLEKKNKESQNFIDYIKKIADRRHG----SNYQNWISAIMYLEHYTNSKLLFKDINLTFAEDYKHFLLNT. 152
64 2.000e-19UniRef50_A0A1L3J2J5 Integrase n=1 Tax=Gramella salexigens TaxID=1913577 RepID=A0A1L3J2J5_9FLAO  ali  27  2.......IKVSLRSKK-ISKGRRSLYLDFYPPIENPTTRKPTRRQFLKLYIIE------------------------KPKTLMDKQYNKEKLIIANSIRQRRENQLNKPEIYSDFEREQIRRKEIGNQSFLTYFLEQSDKKYG----SNRNIWLSAYSYLKQFAGRDLKFNQLNEGYFENFKTFLLSA. 153
65 2.000e-19UniRef50_A0A2E2IY28 Recombinase (Fragment) n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E2IY28_9FLAO  ali  29  2........KVTLRQRK--KNDKISLYLDYY-------HKGKRKTEYLRLYLTP------------------------NPKTKTEREVNKKTKQLAETICAQRQIEIQNG-------IYGFQDIEKLKGSFITYVTALAEK--KNTSSGNYGNWNSMLKHLKIFCPTDVSFQDLDKSFVERFKEYLDK.. 138
66 3.000e-19UniRef50_A0A098LKH4 Integrase n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=A0A098LKH4_9BACT  ali  25  2........KVTLREKRGKE--KSSLYLEYY-------KNGKRQYEFLKLKIFNS------------------------PTTSEQRKQNKETLALAEKIRAKRLLELQSLSHGFVPE-------FKKQTDFLEYFKMLVED--KNSSKSNFDSWNSCYQQLKKFAKPGITFADIDENLINKFKEHLLK.. 138
67 3.000e-19UniRef50_A0A081PC55 Uncharacterized protein n=11 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A081PC55_9SPHI  ali  24  3........KVKMRMR-TIVNNRKSIVLDYSPPIKNPTSGKKHRFETLKLYVYDDPAD------------------------QWERQHNKETMMLARAVCAQRQLDIQNRRFGFISDTLR-------DSSFIDFFKIEARKKQQSFSDN----WGMGLRYFIAFAGHDLKFPELNDYLCEDYKNYLLSGP 148
68 3.000e-19UniRef50_A0A0P0F7L5 Tyrosine recombinase XerD n=10 Tax=Bacteria TaxID=2 RepID=A0A0P0F7L5_BACT4  ali  23  3.....NCKKVTLRLRHCKH-GKMSYYLDYYPPYRDKKTMKTIRHEYLGIYIYES------------------------PKNSHELAFNKTMEEKAEIIRCRRFEEIIN-------ERYNLYDKQRLNESFIDYYEKEARKHNQK--------WIYVCKHFKNYVNGKCSFGEVDVELCQGFAEYLL... 143
69 4.000e-19UniRef50_A0A2T0U3Z8 Site-specific recombinase XerD n=1 Tax=Arcticibacter pallidicorallinus TaxID=1259464 RepID=A0A2T0U3Z8_9SPHI  ali  19  4.....KSIRVTLREQKNKS-GRTSLYLDFYPAIYDEKKKKDTRRKFMDLYVFE------------------------KPANKMEREHNKFTMIKARQIENEYQLEFLSERLGMPSIS-------NKDLDFLQYFKSIVKKRY--TSKGNYDNWLSTYNYVVRFTNGSCLASQVNERFCKDFKEYLDTT. 152
70 4.000e-19UniRef50_UPI000870BC05 site-specific integrase n=2 Tax=Flavobacterium gilvum TaxID=1492737 RepID=UPI000870BC05  ali  25  3.......VKVTLR-KKSISNKRQTLFLDFYPPILN-ENGETTRREFLKMYIFDD------------------------ARNPLDKVHNKNTLALAEQIRQKRENSLNKPEIYTELESAQLKKTKKQDGNFIAYFKKLANK----KNDSNRFIWLGSCEFLVMLKGEGLRFADITVELVDEFREFLETT. 153
71 5.000e-19UniRef50_A0A0T6ZTZ8 Uncharacterized protein (Fragment) n=1 Tax=Sinorhizobium sp. GL28 TaxID=1358418 RepID=A0A0T6ZTZ8_9RHIZ  ali  19  1...................GRMLSYYLDYYPGYRDESTMKVIRHESLGIYIY------------------------AKPKNQTEQKYNLNLTARAEAIRCRRFEAIVN-------ERYDFFDKEKMKGDFLAYFKRLADKKNSK--------WQHVYMHFRTFTQGKCTFGEINVDLCNRFREYLLTAP 131
72 6.000e-19UniRef50_B3JGV6 Site-specific recombinase, phage integrase family n=2 Tax=Bacteroides TaxID=816 RepID=B3JGV6_9BACE  ali  18  3.......SKVYLRKKK-ISKGRVSLYLDFYPPILIPGTNRTTRRYFLNVHLPE------------------------KPKSFAEREHVKSIMQKMEIFRLRVLEQIIN-------EKFDFYDKIVEKTDFLDYFKNESLKHNKK--------WIYVYQHFAAFTNNKCTFADINVALCQRFRSYLLNT. 143
73 9.000e-19UniRef50_K1UB82 Phage integrase family protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1UB82_9ZZZZ  ali  20  16...QSKRTPIEIKLKRELKNGRTSLVLEYYLGYTNGTTRPKRKFETLEYFLYT------------------------APRNKAERDHNKINLEMAEKVKAKRLLAEQN-------EQYGFAVPFKIRTNLVEFIRGMVEQ--RKDSPGNWGNWDSMLKHLIAYAGTETTFERIDRRFVEGFRTYLAK.. 170
74 1.000e-18UniRef50_A0A174K608 Tyrosine recombinase XerD n=37 Tax=root TaxID=1 RepID=A0A174K608_9BACT  ali  20  4.KKQEVKLKEPVRIRKQLANGNQSIYLDYYTGDIIRKENGKRQYEFLKLYLIPE-------------------------KTREDKAKNEATLALAKAIQSKRIVELQN-------DAHGFQNTNKSKANVIDYLMNMRSQSKERGSLNYEKTIGNAIRELKLFRGDYIAFRDIDKDFLNSFVDFLKQA. 162
75 1.000e-18UniRef50_A0A176TDL6 Integrase n=21 Tax=Bacteroidetes TaxID=976 RepID=A0A176TDL6_9FLAO  ali  21  3.......VKVKLRE-KNISGGRKSLYLDFYPAITNHKTGKKTRREFLGLYLYLDXXXXXXXXXXXXXXXXXXXXXXXKGLSSTDKMHNSNTLRRAESIRQKRDNIIGKPEIYSNVEKEQLRINELGEQCFIEYLKKLANKKYG----STHSSWISALKFFEAFTKGSVKFKDLTPNLLEDFKSYLLKA. 197
76 2.000e-18UniRef50_K6AVI5 Uncharacterized protein n=6 Tax=Bacteroidia TaxID=200643 RepID=K6AVI5_9BACT  ali  21  1MAKQV-KVKEPVRIRKKLANGNESIYLDLY-------KDGDRVYEFLKLYLIPE-------------------------KSKADKEANRKTLELANAIKAKRIVELQNNEHGFKT------NTTRSKMNLIQFVLHLADEQKSGNKRSYYYTLHSLAKHLEAYAGDKITFTKVNTEFVKGFIAYLRTA. 152
77 2.000e-18UniRef50_A0A1Q3X2I3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 46-16 TaxID=1895925 RepID=A0A1Q3X2I3_9BACT  ali  18  2........KVHI-YRKKISKNRSSLFLDFYPPIKHPVTGKLTRREFLGMYI------------------------LEKPRTPIEREQNKATLFIAEKVRSERQIDIQ-------AENYGFLRKKLENRDLLPFFKEIAENY-KLTARGDKNNWMAVYNYLFRFCDGVFMAKDVSEDFCLDFKEYIQRS. 148
78 2.000e-18UniRef50_A0A1F3R6N2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_31_6 TaxID=1797363 RepID=A0A1F3R6N2_9BACT  ali  22  3.........IKVRT-KELSNGRLSIFLDYYPPIKGP-NGKLTRREFLKRY------------------------NLKHPKNQDEKRLNRENMFFADTVRLAREKDMLN-------EQNGLYNSRNNTKDFIEYFRILCED--RMESDGNYGNWLSTLRYLIAFTSDTCKMSDINEEFCNKFKDYLLKA. 146
79 3.000e-18UniRef50_A0A1D7QKX8 Uncharacterized protein n=1 Tax=Pedobacter steynii TaxID=430522 RepID=A0A1D7QKX8_9SPHI  ali  23  3.........VTLRKKKISGGRKISLYLDYYPPILHPETGKFTRREFLSLYL------------------------LVRPRTEMELELNRKTLTLAKNICADRQIEI-------SYKRFGFLEKDNRLGSFVQFFKDLEKKSGDKG-------FEMARRYFEAYAGPDIRFIDVDEEFAEEYRDYLLSKP 144
80 3.000e-18UniRef50_A0A0E3UYD6 Uncharacterized protein n=1 Tax=Pontibacter korlensis TaxID=400092 RepID=A0A0E3UYD6_9BACT  ali  20  3.........VILRQRQKTDRGKISLFLDI-------SHNGKRWTKFLKIYLHPEP--------------------TSGRLSPKLKADNREKLAKAEAIRTKYESDLVFGEYG-------FVEKNKGSANFIEYFEALT-TGKKKKSAGNYGNWDSALKHLIKYNGGKIKFTDISPAWVSGFKNYLDT.. 146
81 5.000e-18UniRef50_A0A1I6SQI4 Site-specific recombinase XerD n=1 Tax=Lutibacter maritimus TaxID=593133 RepID=A0A1I6SQI4_9FLAO  ali  21  4.........VTLRQ-KSIANEKSSLYLDYFPPIISPKTGKETRREFLKLTIH------------------------NNPTKQTEKQHNKTTIEFAEIIRAKRLVQIRNKEFG-------FKENIEANINFVSYYSTIVEEYLNKGSRNNYLTWKASFAYFKKFIGNKVSSKNISIEIVKNYRSFLLTT. 150
82 7.000e-18UniRef50_K1SQT9 Phage integrase family protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1SQT9_9ZZZZ  ali  22  3..........................LEYYLGYTNGTTRPKRKFETLEYFLYT------------------------APRNKAERDHNKINLEMAEKVKAKRLLAEQN-------EQYGFAVPFKIRTNLVEFIRGMVEQ--RKDSPGNWGNWDSMLKHLIAYAGTETTFERIDRRFVEGFRTYLAKRP 135
83 1.000e-17UniRef50_D1W5M7 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=D1W5M7_9BACT  ali  76  1MKKELDNTKATVRLRKSPYRKEWYLYIESYPVRVTGKETPQRVREYLNRAITTPIWDKSRTARTTDRSTSYKPKRDLNGIIQCKSELDQEACIYADNVRKLRQREYDNVSLYSDTELAQAEQKEKSQQNFIKYFASLL................................................... 138
84 2.000e-17UniRef50_A0A1X7IWG4 Phage integrase family protein n=1 Tax=Arenibacter troitsensis TaxID=188872 RepID=A0A1X7IWG4_9FLAO  ali  21  2........KIHLRKKKLKS-GSTSLYIEYYKGHKEGKVKHIRDFEYLELYLTTD------------------------PKTAAEKKKNRENLELADQILAIRKAEVYQGT-------YNIQNGHKEKTGLLDFYEQQKEERYQT--KGNYDNWDAAQKHIEAYCPKHITFSDVDVDFIKGFKKYLDT.. 149
85 2.000e-17UniRef50_A0A2I9EGG6 Tyrosine recombinase XerD n=79 Tax=Bacteroidetes TaxID=976 RepID=A0A2I9EGG6_9FLAO  ali  21  2........KINLKQKKLK-NGKSSLFLEFYNGYRNGVKKHLRKFEYLKQYVF------------------------DNPKNAEEKRENKETLQLAENILAIRKAEYIQGK-------YKIKNDKKGEVTFLDYYEQL--KEDRFETKANYGNWDAALKHIEKYCPPHKQLKDIDTDFVKGFKRYLNT.. 149
86 2.000e-17UniRef50_R5TXG7 Tyrosine type site-specific recombinase n=1 Tax=Bacteroides sp. CAG:702 TaxID=1262747 RepID=R5TXG7_9BACE  ali  16  6.KQTKAKEPVTIRF-KSLAKGSKSIYLDIY-------RDGVRSYEFLKLYLIPE-------------------------KNDQDKAANLVTMDAANAIKARRVREIISGEAGIKDRPGKYLLLLDWMLQRQDRADKAAKDAGRKKS-NTAEGIKTTTAHLRRYKGKSITLSQIDKDFCEGFAAYLKGA. 163
87 2.000e-17UniRef50_I9F4S2 Uncharacterized protein n=43 Tax=root TaxID=1 RepID=I9F4S2_9BACE  ali  23  5..KKPKKVKEPIRLRKDLSDGSKSLYLDIY-------RNGKRTYEYLKLYLIPGTDSNT-------------------------RRQNEITMAAANAIKSKRIIELTSGEAGIVNHTDKIYL-----LDWMQTYLEYQEKRDKKG----IGQIKAVTHILKEYAGERFILDRVDLAFCQGYIDYMLTT. 150
88 3.000e-17UniRef50_A7M3V5 Site-specific recombinase, phage integrase family n=4 Tax=Bacteroides TaxID=816 RepID=A7M3V5_BACO1  ali  21  1MKKQI-KVKEPIRLRKKLSNGNESLYLDIY-------TDGKRDYEFLKLYIIQE-------------------------RTKEDKEKNTQTLKLANAIKSKRIVELQNEEHGFRTSSV------KSKANIINYIDSFVENLPKDTKNGYICTMQGLKYHLSKYKGENITFKDIDRKFLAGFTEYLKVA. 152
89 3.000e-17UniRef50_U6RR86 Uncharacterized protein n=1 Tax=Bacteroides sp. HPS0048 TaxID=1078089 RepID=U6RR86_9BACE  ali  23  5.KRVQQKEPVKIRE-KVLANGNIHLYLDIYY-------KGKRTREFLRLYIVPEH-------------------------TPADKELNRETRNMALSIRSKRQLELSRTE-------YDLPKPFAEDTPFLAFYRKLVEERKNPYTPSTYANWKASLAYLEMYADNTTRFKDINKDWINGYKEFLNT.. 151
90 3.000e-17UniRef50_J3CAW8 Site-specific recombinase XerD n=21 Tax=Bacteroidetes TaxID=976 RepID=J3CAW8_9FLAO  ali  20  2.......TRVKLRQ-KPISNGQESHYLDIYPPIAHPITGELKRKYFLHLHTY------------------------LNPKNNVEKLHNIETLKLVEYRKAERLIDIQNKNYDFLIK--------KRISDFTEFFQAEANKRPDSYN------WQMAVRYFQNFCGKNLPFIELDYPTCEQFRNFLLSNP 144
91 4.000e-17UniRef50_F0QZG0 Integrase family protein n=141 Tax=root TaxID=1 RepID=F0QZG0_BACSH  ali  22  59..RQPKKVKEPVRLRKDLSDGSKSLYLDIY-------RNGKRTYEYLKMYLIPETDENARRR-------------------------NKATMNAANAIKSKRIIEMTNGEAGIENEKEKVFL-----LDWMQTYKENQEKRGKKDE----NQIKVAIRIIEDYAGKKVTLDQIDKAFCQGYIDYLM... 202
92 4.000e-17UniRef50_J0RTG5 Phage integrase (Fragment) n=1 Tax=Flavobacterium sp. F52 TaxID=1202532 RepID=J0RTG5_9FLAO  ali  22  1......................MSLYLDFYPPVWNSAINDYTRREFLKIYVYQ------------------------KPADQYQKIANKESLHTAELIRARRQNEINKSEIYSAFEKEQLAIQAVGNESFLQYYKNL----GNKKVGNNLSIWACAIIHFEAFKGRDLSFKEVTVTLIEDYRDYLLKA. 139
93 5.000e-17UniRef50_C9KS96 Site-specific recombinase, phage integrase family n=2 Tax=Bacteroidales TaxID=171549 RepID=C9KS96_9BACE  ali  22  5..KKPAKLKEPIRLRKDLSGGNKSLYLDINY-------KGKRSYEYLRLYLIPEVDYNA-------------------------RQQNEITMAAANAIKSKRIIELTSGEAGIVNHTDKVYL-----LDWMHTYQENQEKRDKKG----ASQITAVTHILEEYAGERFTLDRIDLAFCQGYIDYMLTT. 150
94 6.000e-17UniRef50_I3C100 Site-specific recombinase XerD n=55 Tax=Bacteria TaxID=2 RepID=I3C100_9FLAO  ali  20  2.......IKAHLRKKKLKT-GKQSLYIEYYKGTQNGKIKHLREYEYLQLYLIQ------------------------NPKSADEKKKNKEQLELAKQILAIRQAEIYQGKF-------KIQNNHKGKTTLLSFYEQKKEERYQT--KGNYDNWDAAQKHLERYCPAHITFNDVDVEFIKGFRKHLDT.. 150
95 9.000e-17UniRef50_A0A174MHH4 Integrase n=166 Tax=Bacteria TaxID=2 RepID=A0A174MHH4_BACT4  ali  16  1MAKLENKTKENPKEQNKLSDGRISLYLEYYLGREEDENGNQVYYDSGKMQGKPKFAVKHNRR-----KENLSLYLIDKPRTPAERQQNKETLELATKIRAEREQEFKESMLG-------YRLKKDRTVNFLDYFQAYINSYTKKDIRMVQIALSRFKDFLKEQYPMNIKPELITKEMMEQFVAYLQS.. 183
96 1.000e-16UniRef50_D4IKV8 Site-specific recombinase XerD n=4 Tax=Alistipes TaxID=239759 RepID=D4IKV8_9BACT  ali  19  2......KEKEVIRLRRKATQSGESLYLDIYF-------KGKRRYEFLRLYLIPE-------------------------RTKADRLKNEQTLRLAIAIKSRRTIELFNNKYGFATE--------KPDVNLIEYIQLVAANKLKQGRIGIKGTFDTLVYHLTKYHGDKIALQDIDIRYVKGFVQYLSTA. 143
97 1.000e-16UniRef50_A0A1G7XEK9 Site-specific recombinase XerD n=1 Tax=Psychroflexus sediminis TaxID=470826 RepID=A0A1G7XEK9_9FLAO  ali  21  3.......VKVSLRQ-KPIKGGKLSLYLDYYPPIIN-KDGKETRREFLKMHIFE------------------------KPANSEQKSHNKTTLSIAEKIRDSRNLSIYNKEYG-------FKDNVVLNIDFIKYYEELVERKSNTVSKKNHQSWEASLMHYKDYAKK-IYTRSLNKKHVEGYKEHLQT.. 148
98 2.000e-16UniRef50_A0A1Y4FNM5 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y4FNM5_9BACE  ali  16  1MARTKKSESVPVRIRKELENGNKSIYLDIYY-------ERKRRYEFLKLYLIPET-------------------------SAEARAQNEHTLKAANAIKSQRIIDITNKKPPLVL-------SEKGKMRLIDWMEIYMEQRKQNGKRGLEPSVHSTVVQLQKY-DPKARLCDVDKEFLDGFVEYMTK.. 148
99 5.000e-16UniRef50_A0A180FVP4 Uncharacterized protein n=1 Tax=Bacteroidales bacterium Barb7 TaxID=1633203 RepID=A0A180FVP4_9BACT  ali  28  2..RKLKTTKVTLRFRMLDT-GRETLYLDYYPAVYNSQTGKETRREYLGMYAVPLKNRKGELHTNRDGIHKYN-------------EADRETIRLADIIKANRQNELSKAEIYTDQEAELLKAKERGKGDFIAYFRDMA----KDKKDSNYSSWQSALN............................... 139
100 6.000e-16UniRef50_A0A1H2TCB6 Site-specific recombinase XerD n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1H2TCB6_9BACT  ali  21  2........KIHLRKRKRGKKQMASLYLTCIP-----RPGAKVQYEWLNLHVYE------------------------NPKTNIEKDHNKETMLLAESVKAQRILDHQTTGHG-------FVSSVKGKVGFLDYFKKLADR-KREDSNGNYGNWQSAYEHLKTYIGRRYTLDQIDENFLEGFKQYLQ... 152
101 6.000e-16UniRef50_F0REM9 Tyrosine type site-specific recombinase n=2 Tax=Cellulophaga lytica TaxID=979 RepID=F0REM9_CELLC  ali  21  2........KISLRKKKL-ATGRISLYLEYYNGYENGKTIHDRAFEYLKLYLHG------------------------NPITANEKNENKQTLNLAENILTLKKAELIKGKFNIE-------DNQKGKTLLLDYYKKLQEERY--ESKGNYDNWEAAFKHLERFSKLNIAIKDIDEDFLKGFKKYL.... 147
102 8.000e-16UniRef50_A0A174WMM8 Integrase n=12 Tax=Bacteroidales TaxID=171549 RepID=A0A174WMM8_9BACE  ali  16  5..KKQVKLKEPIKIRKSLADGNKSIYLDIYY-------KGVRKYEYLKLYLVPE-------------------------INPICKEQNKQTMAVAERIKAERIKALHG---HGILDWETVKQGSMLLTTWIKKYCEGGVGIKKSTLHCRVEMLHTVEKYLDETNKGFISLEEVNAEFCRGYVKFLRNFP 157
103 8.000e-16UniRef50_A0A2W5U3M6 Recombinase n=2 Tax=Bacteria TaxID=2 RepID=A0A2W5U3M6_9RHOO  ali  21  11........PVKLRQREL-ANGNYTLYLDMY-------WKGQREYDYLNLYVK-------------------------KSNNAQDKEQNNNTLMLADQIKAQRIIDLQSGKY--------KMKQPKTGLSFLEYFNKL--KIDRLNSKGNYGNWDSAYKHLLTFTNKDLTIDEVDESWLMRLKHYLLN.. 147
104 9.000e-16UniRef50_UPI0009EE6DA5 hypothetical protein n=1 Tax=Alistipes sp. Marseille-P2431 TaxID=1816676 RepID=UPI0009EE6DA5  ali  18  7.........IKLRS-KPTGSGNRSLYLDLYY-------RGDRRYEFLHLYLVPE-------------------------RTKSDRLKNEETLRLANAIKSQRTVEFFNDLHGFTSK--------KPDVNLIQYIEQVSNNKQKIGKNGVPGSLRMLIYHLKKYKGDRILLKDVDVKYLNGFVRYLSSA. 144
105 9.000e-16UniRef50_A0A088F5J4 Integrase n=16 Tax=Bacteroidales TaxID=171549 RepID=A0A088F5J4_BACFG  ali  18  5..KKQVKLKEPIKIRKSLADGNKSIYLDIY-------WKGVRKYEYLKLYIIPE-------------------------VNPLCKEQNKETMALAERIKAERIKALHG---HGVQDWETVKQGSQLLTGWIKKYCEGGISTKKSTLHCRVEMLHTVEKYLEESNQTFITLEEVNADFCRGYVKFLRTFP 157
106 9.000e-16UniRef50_A0A1I0NJH2 Site-specific recombinase XerD n=1 Tax=Chryseobacterium wanjuense TaxID=356305 RepID=A0A1I0NJH2_9FLAO  ali  23  3.........ITLKQKKLK-DGRISLYIEYYKGSNTDSNGKRRDFEYLKIYLYE------------------------NPKSASEKKANKENEKLAEDILAIRKTEYVQGKF-------DIKNTSKGKRRFLEYFEEKTEE--KSSSVNNYGNWYSTLHHLKKILPKNLLFEEIDPTVIKRVKDY..... 146
107 1.000e-15UniRef50_R5JKM2 Integrase n=1 Tax=Bacteroides sp. CAG:189 TaxID=1262737 RepID=R5JKM2_9BACE  ali  22  5..KKPTKVKEPIRLRKPLSDGSKSLYLDIY-------RDGKRTYEYLKMYIIPETDNNA-------------------------RKQNLVTMDAANAIKSKRIIELTNGEAGIENREKVFL------LDWMNTYKENQAKWGKKDG----NQISVTIRILKDYAGERMTMDRIDKAFCQDYLDYLMT.. 148
108 1.000e-15UniRef50_UPI00082A3BFF site-specific integrase n=1 Tax=Rufibacter roseus TaxID=1567108 RepID=UPI00082A3BFF  ali  25  3.........VALRAKKTKE-GKEKLYLDIY-------HNGKRETKFFPFTI-------------------------TNGKDATSKKEDKENRKIAEAARLKVEQQLVN-------DQYGLIDLKSKPTDFIAYFWEYAEE--KKASKGNYSVWVSSIKQLQTYSNGSLQFSHIDKKFVEGFKTFLTK.. 138
109 1.000e-15UniRef50_S0GF22 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=S0GF22_9BACT  ali  20  4.....TCTKVTVRQR-AIRNNRISLYLDYYPAVRNPETMQMSRREYLGIYIY------------------------AHPKNEMEREFNNDMLNKAEAIRCIRVQSLINEEFG-------FLDKTKQKADFLAYFKKMCHNKDQK--------WQFVYQHFYNFVKGQCTCN.................. 129
110 1.000e-15UniRef50_A0A1Y4C0K5 Uncharacterized protein n=1 Tax=Muribaculum sp. An287 TaxID=1965623 RepID=A0A1Y4C0K5_9BACT  ali  17  9......TIKEPIKIRKQLKDGNQSIYLDCY-------VNGIREYKFLNLYLRPDTSRD-------------------------NKMWNKEQLCLANAIKAQYIIDIQNGEFGFKDR------NRTRKLSFLTYCEDLASEYEANGQTSCAVLMRSAIKRMVAYKGKNITFNHINKEFLIGFIEHLNS.. 152
111 1.000e-15UniRef50_A0A1S2VQJ2 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=A0A1S2VQJ2_9BACT  ali  20  3.........VKLRKR-ALASGKISLYLDAY-------NGEERTYEFLRLYLY------------------------KRPKDELEKQHNKDVLQTAEHLRAKRELQL-------SVQRNGLTPVLKTKINFLAYFQTFIDTYPKKDGR----MFKGALRYLKEFAQADLSTRALTESFCFNFKTFL.... 136
112 1.000e-15UniRef50_A0A1H8C6X2 Phage integrase family protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1H8C6X2_9BACT  ali  20  4..........NLRKKIIAGGRKVSLYIDYFPPVWNPIKKIYTRREYLKLHLYT------------------------KPTNDVELKLNKIHQEIAEKIYLQRMKVL-------MLDANGLFNKDALEADVYTFAWNYIRGKQKDKVDTFH--YEVCLKYLKNFVGEHLKFKHIDEIFITRFKDFLLNT. 148
113 2.000e-15UniRef50_A0A172XY88 Uncharacterized protein n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A172XY88_9FLAO  ali  21  4........KVTV-LKKLVKGNKSNLSLNFYPPVFNRKTGKKTRYEKTSYFIYNEFQSDGKKQSKIEILTDKNGNPKKLTLTPAQKHHNKEINEMIELYRAKRFKEVINPDIYSETELRALELAENRSKIFTEYFKE-----KAQNATSSEGVWSGCYGHFVKCYG-NVLFQDINKALIEDFKSKLLNA. 184
114 3.000e-15UniRef50_UPI00082A9495 site-specific integrase n=1 Tax=Rufibacter ruber TaxID=1783499 RepID=UPI00082A9495  ali  17  3.........VELRRKKLKS-GKESLYLDIY-------HNGERNYEFLKLYL-------------------------IKPITKQDRLHNKEILKAAESLRAKKELYINSLEHGYEPE-------FKKKVNFISYFENFLSNYKNKD----IRIVRYCCKYFKEFAGKDLYPYEVTEQFCLDFKSYLED.. 137
115 3.000e-15UniRef50_A0A0H4VKM8 Uncharacterized protein n=4 Tax=Hymenobacteraceae TaxID=1853232 RepID=A0A0H4VKM8_9BACT  ali  19  1MKKLANKEPVRLREKKL-TNGNLSLYLDYY-------KEGERQYEFLKLYLI------------------------AKPKNPLEKDANQTNLELAQRIKAKRTEEALMGTFDLQA-------KSLSHTDFIKFYQAYITHYTKKDNRVLSATLSKFKDFLERYGKEKLACKDLTQNLIIGFKDYLE... 148
116 3.000e-15UniRef50_UPI000998FFD0 hypothetical protein n=2 Tax=Elizabethkingia TaxID=308865 RepID=UPI000998FFD0  ali  22  4........KVTI-LKKLVKGNKSNLSLNFYPPVFNRKSGKNTRYEKTSYFIYNDFDSKGKKQSRVEITLDKNGKPKKLALTPSQKQHNKETLQYIDIYRAKRFKEIIKPEIYTEAELKAEQLAENKRKLFTEYFREKSETATKS-----KGAWQACYGYFVRYYGNKL-FSDINNTLIEDFKNKLLNS. 184
117 4.000e-15UniRef50_A0A1T5P471 Site-specific recombinase XerD n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1T5P471_9BACT  ali  21  16.......................SLYLDYYPPVWNPHNKRFTRREFLNLYVH------------------------ANPVTPLEVKENKLYSEIAEKIYIKRMKAL-------MLEENGLFNKDSLDADFFLYAKSFIREKQRENVDTTH--YETAVKYLHKWMGDHCKFRHIDEIFLQKFKQFLLNT. 147
118 4.000e-15UniRef50_A0A2S7SR41 Integrase n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A2S7SR41_9BACT  ali  19  3.........VTIR-KKPLANGLTALYLDVY-------QNGKRHKENL-----------------------ENCRLVTNATTVADRKRNKEIKELAENIRVKREQEIIS-------LSYDVVASFKGNVDFIEYFENYISNYTKKDKRNMEGVCKRFQTFMKNEGIKSLTMRQLTESIVYKFSEYLMDT. 143
119 4.000e-15UniRef50_J1YGB7 Mobilizable transposon, int protein n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=J1YGB7_9ALTE  ali  15  2........KLSIEKKPADRAGRQQLLLTRNYGSYTDESGKKRKRQSLDLFIY------------------------ATPKDKAQRDYNKKTLELAERIQAQAIVDLANNKYHFEDEA-------KQQQSFIDYMQQIIEEKRKTDGKSNVSIWESVLIHLQRFSGHQLSFANFDTTLLQDFRIYLTTT. 154
120 4.000e-15UniRef50_A0A174NWF3 Tyrosine recombinase XerD n=2 Tax=Bacteria TaxID=2 RepID=A0A174NWF3_9FIRM  ali  15  1....MSSVKAILRIDKINAKGLAPLYL-------RSTHNRKSAFKALGIYIHPDDWDAVAEKVRKSKR--VPNSTRINNLIAAQKLEVQNYL-----------LDVAGGAKPYNPQAVKRAVSRFNHASFTQYAEDYLKSINTAEKYTTYKTYRTLLRNLNEYAGRELYFGDIDVTFLKDYYRYM.... 161
121 4.000e-15UniRef50_A0A015R844 Phage integrase family protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A015R844_BACFG  ali  15  9........................................................................IYIFAKPANQQERDFNARMMKKAVILRNQRYEAIFN-------ENNGFFDKTKMKGDFLAYFKGLADRKNIK--------WQHVYKHFQRFVNGKCTFEEVDVDLCRKFMEYLLDAP 110
122 5.000e-15UniRef50_U2CVV4 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=U2CVV4_9BACE  ali  52  3............................................ESINRTISTPIWDKSSIRILPDGTFNYKPKRDLNGIIQCRSTIDQEACIYADNVRKLRQHEYDSAILYTDKENEIAAQNERSEQDFIKYFNRIISTRHPNSSDSIIVNWRRVGELLKMYSQGQIPFKAISVKLLEDIKMFLLRAP 149
123 5.000e-15UniRef50_M7XZG8 Integrase n=4 Tax=Bacteroidetes TaxID=976 RepID=M7XZG8_9BACT  ali  24  1......................MALYLDYY-------QKGFRKTEYLDIYLVPEP--------------------DKGKLTPAQIANNKERLRLAEAICHQKQLDFLSG-------IYNVHDIKKQKSLFIPYLEKLAVN--KNTSTGNDGNWKSMIKHLKEYAHPGVTFENVSLEFIEGFKRHLTRA. 130
124 6.000e-15UniRef50_Q64NG3 Tyrosine type site-specific recombinase n=6 Tax=Bacteroides fragilis TaxID=817 RepID=Q64NG3_BACFR  ali  17  1....MSKCKVTLRKRKVKNGTQYSLCLDYYPGYRDNITMKVITREALGIYIF------------------------AKPANQQERDFNARMMKKAEILRNRRYESIFN-------ENNGFFDKAKMKGDFLAYFKGVADRKN--------ITWQHVYKHFERFVNGKCTFEEVEPQ............. 134
125 9.000e-15UniRef50_A0A2T2TQ16 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium QS_7_67_15 TaxID=1919107 RepID=A0A2T2TQ16_9BACT  ali  15  4.............KHKTNSDGHSPIYLRIYAG-------GKTKYKSLSVYIHERHWNEGQRRVRKSHRQHAQINTRIT-----------ERLAEAEGAVLDRQREGKPVRPRHVKRALSEADGGATQENFLAYGEKVARRLQRNEQISTARLYRAVLRKLRDATGKQLPFEEVTPQLLRDYEAY..... 157
126 9.000e-15UniRef50_A0A257L2M3 Integrase n=1 Tax=Bacteroidetes bacterium B1(2017) TaxID=2015582 RepID=A0A257L2M3_9BACT  ali  11  1....MAHVKIVLRKKQNKEGK--------YPLTLRITKDRKASFIHLGYNLDIEDWDEDKQRVKKSHPNSARLNNYILKKLSEANDQ---------------SLELETQKSYVSSQAVKQKIKPSVGSTFFPQAELYLQRLKEAGKYNQYTADKPRINHFKAFIKQDIAFQDISVALLERFQSHVKN.. 160
127 1.000e-14UniRef50_A0A174PVD9 Tyrosine recombinase XerD n=20 Tax=Bacteria TaxID=2 RepID=A0A174PVD9_9FIRM  ali  15  5.KKALKKEPIRLRERKL-ANGNLGLYLDIY-------VKGTRKYESLGLYLIPE-------------------------KTPLDKQMNIHTRQVAEKIKADRIIALQERGI---KQYEKIKQSNMSLLDWLRKYEQENFGFRPSTLKGRVDMRKKVEEYLEQQKTPYISMSEVDADFCRGFLRFLATA. 156
128 1.000e-14UniRef50_A0A173ZB03 Integrase n=10 Tax=Bacteroidales TaxID=171549 RepID=A0A173ZB03_BACVU  ali  18  5..KKIESTPVRIRF-KELENGNKSIYLDIYY-------EKKRRYEFLKLYLIPEN-------------------------SSEARKQNKHTMKAADAIRAQRILEISNNRTPVT-------ISEKAKVLLVDWVNEYKNRSLQQGKTSSENHVHSALKQLRKY-NAKARLCDVDKDFLDGFVEFMK... 147
129 1.000e-14UniRef50_A0A0E9N1L9 Uncharacterized protein n=1 Tax=Flavihumibacter petaseus NBRC 106054 TaxID=1220578 RepID=A0A0E9N1L9_9BACT  ali  13  1....MAKSSVVLQEHKTNKNGLHPIYLRI-------TVDGKRNYLATGKYCSARMWDARNECLRDASDHAKLINSDLD-------------LIKADALKKIVDDRVAGKLVTSVSVKRAAAAPGKGGKDFFQFAEKFIAASKARKNDRTIVNYVSHTKHFNSFIKGPIAFEEITPELLGKYEAHLRAA. 166
130 1.000e-14UniRef50_A0A139JYG5 Integrase n=79 Tax=Bacteria TaxID=2 RepID=A0A139JYG5_BACUN  ali  15  1MKKQLNKEPIKVRTKKLV-NGCQSIYLDIY-------MNGRRQYEFLKLYIIPEH-------------------------NQADKKRNVETLNLANAIKAQKILEIYNQTYGFNH-------NRLSNMKLTGYMKLIAEQS--VNNRVRKSAIHAVVCHLERYTPNGILLRKVDKTYLLGFIDYLKKT. 147
131 1.000e-14UniRef50_A0A173SW71 Tyrosine recombinase XerD n=16 Tax=Bacteroidales TaxID=171549 RepID=A0A173SW71_9BACT  ali  15  4.KKNEMKAKEPVKLRKKLSNANLSIYLDIYY-------KGKRYYEFLKLYLTPERF-------------------------PEDRDKNRITLRLANSIKAQRIIDLQNEIYGVRM------INGLGKKTLLEFLSELYTDKSAHGDKAYSLRLRSLANHLRDYM-PQCLLKDIDTGFVKGFIAHLRKQP 153
132 4.000e-14UniRef50_G2Z2Y6 Phage integrase n=3 Tax=Flavobacterium TaxID=237 RepID=G2Z2Y6_FLABF  ali  21  3.........VTLRKRELKDKGRFALYLDIY-------MDKKQIQENLKLYLESE------------------------KGNSTAKQMNKQTLEIAEKIRVERLYQIQN-------DAFGFKIPEKKYFTYNEYFLELLKERRRTG--INQCTWESVYRHLNNY-NKSILFTEITERYLEEFKSYLLS.. 139
133 7.000e-14UniRef50_A0A2S4ZX89 Uncharacterized protein n=1 Tax=Solitalea sp. HR-AV TaxID=2079460 RepID=A0A2S4ZX89_9SPHI  ali  16  1....MATLKLFLNTQKINKTGQAPLYLRI-------IHNRKSRYISLAIYLKENEWDNVNRRVKKNHPNSTRLNKLIATKIAEAEDLILEMENAAS----------------STAKDVQQHIKGKPKYSFYEYFDLYMKSIETRLKVPTIVSYRVFEKSIKDFEPKNLTFEDIDLQWLKRFSNWLRN.. 161
134 8.000e-14UniRef50_D8DX33 Mobilizable transposon, int protein n=6 Tax=Bacteroidales TaxID=171549 RepID=D8DX33_PREBR  ali  19  2.......SRVILKYRNISQGKMKSIYLEFNPAI-HDIKGNSIRYECLNLEIYT------------------------NPENSHQFKHNRSVEEIAETIRCERYLQLVRHD-------YSFLAKARLDEDFLEYFR--------LNGDCHGAKYQSSRLHFERFCKGQCKFRDINASLCERFRLYLLRA. 142
135 9.000e-14UniRef50_D2QCJ3 Integrase family protein n=9 Tax=Bacteroidetes TaxID=976 RepID=D2QCJ3_SPILD  ali  12  3.....SSIKIVLR-KKPNQDGT-------FPIAIRITKDRKSTYTYLGYSVTEAQWDAKEHKVKKNHPNSTRLNNLIENK---------------KTELSDKLIELQVQQKDTSVSAIRKQIKPKQHTSFFTQAGAYIENMRKEGKYNRVLTEEARIKHFKSFLDGDITFPEIDVPLLNRFRAYLKS.. 162
136 9.000e-14UniRef50_D0TDQ1 Uncharacterized protein n=1 Tax=Bacteroides sp. 2_1_33B TaxID=469589 RepID=D0TDQ1_9BACE  ali  15  4.KKNEMKAKEPVKLRKKLSNANQSIYLDIYY-------KGKRYYEFLKLYLTPERF-------------------------PEDRDKNRITLRLANSIKAQRIIDLQNEIYGVRMI------NGLGKKTLLKFLSELSTDKSAHGDKAYSLRLRSLANHLRDYM-PQCLLKDIDTGFVKGFIAHLRKQP 153
137 1.000e-13UniRef50_A0A2V9XHN5 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9XHN5_9BACT  ali  23  14.........IKVRSRLLRDGKTQTVYLDLY-------SRGRRQLEYLNLYLTGNW------------------------------AADRETFRVAEAIASKRTLELIGDEHG-------FATLTRQRADFIEYCRKLADTKHA---HNTREVWRKALEHFTTFCGGRLAFSSLNHSTVQAFHEYLL... 143
138 2.000e-13UniRef50_A0A2K8Z458 Integrase n=1 Tax=Spirosoma sp. HA7 TaxID=2057025 RepID=A0A2K8Z458_9BACT  ali  11  11....LPQVKVMLYTSKTLADGSHPLRLRI-------TKDGNRKYVSIGENSPLNWWDVEKELPRRSHPEQKRLLTLIKKWETSYSDAAKQLHEIGHPFTIDMIID-------SVTETSKKPRKDRKGIMLLSYLKDIYEQLQVAQRVGNANVYHDTRRVLAKFLHDDCPLSTVNVSFLNQFETYLRS.. 180
139 2.000e-13UniRef50_A0A219AE81 Recombinase n=1 Tax=Chryseobacterium sp. VAUSW3 TaxID=2010998 RepID=A0A219AE81_9FLAO  ali  16  1....MATVKLILRTQQADKTGAAPLYI-------RVIKDRKTKFISTGYKFLPAQWNPIDQVVRKSFKGSARMNALLAQKVADASGEVADLERKSKTVSARRLKEAING---------------KRSMNFFAFADDRLEKMKNSVSIQTLKAYKAQLRKFEEYNGRDVNFDDMTVAFLKDYMNY..... 159
140 2.000e-13UniRef50_A0A2E2SIK8 Uncharacterized protein n=1 Tax=Cytophagaceae bacterium TaxID=2026729 RepID=A0A2E2SIK8_9BACT  ali  23  2........KIHLKKKKLNS-GKYSLYIEYYRGHEKGKTKHLREFEYLKQYLI------------------------INPKNASEKKANEETQLRAEQILSIRRAEYAQGK-------YSIKDRSKEKLNFLSYYDKLKEERY--ESKGNYDNWDAAQNHLEKYCKKQITFEDIDENFVLGFKKYLNK.. 150
141 2.000e-13UniRef50_A0A2K8Z087 Integrase n=1 Tax=Spirosoma sp. HA7 TaxID=2057025 RepID=A0A2K8Z087_9BACT  ali  21  3.........VAVRKKVMADGQRYALFLDI-------VHEGQRTKEYLKRYVF------------------------KKPRNPVERQHNEEVLEYAKQLRNKRENELFTDE---VREVKERKQQKNQTLNFFEYFDGYIDRYTNKDKR----MMVTLYNTLRAYVGKDILPKQLDEQFCRDFLEYL.... 141
142 2.000e-13UniRef50_A0A1A9I082 Uncharacterized protein n=1 Tax=Niabella ginsenosidivorans TaxID=1176587 RepID=A0A1A9I082_9BACT  ali  17  12LKGNQNIMSVTLRKRK-NADGSTSLRLDIY-------NNGQRSYELL------------------------SHLKLEKPSTPLARENNKDLLRQAEAIRVARAAELEAGGYNLVSDAGKRTV-------VITWLKSYSENYKKKDARNVSGVINRFEEYLKAERKMQITFPQLTPALIEGFIDYLND.. 159
143 2.000e-13UniRef50_A0A0T0M9T0 Recombinase n=9 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0T0M9T0_9FLAO  ali  18  2........KISLSQRKLK-DGRISLSIEFYRGS-EITEDGKRKHLR--------------------NFENLDTYLIVDPKTAKEKKENKEALEFAENVIAIRKAEYAQGRF-------ELKNTAKAKRVFLNFFADLAEEKRTLDSSNNYGNWFSTYQHLKKVVPKNLTFEEIDEFFIKKVRKYFEK.. 151
144 2.000e-13UniRef50_C3RB21 Site-specific recombinase, phage integrase family n=9 Tax=Bacteroidales TaxID=171549 RepID=C3RB21_9BACE  ali  19  5..KKVIKAKEPVRIRKELQNGNKSIYLDIY-------RNGKRTYEFLKLYIVPE-------------------------IDPASRAMNQHNMALANKIKADRIIELTNSEKGVSNATLRGRIKLSELLDL--YARWLEDNGKKSSIRGVNSIRKATFQF-----RGDVPIRMLDKDYCMAFMNFLRN.. 151
145 3.000e-13UniRef50_A0A1I7IM98 Site-specific recombinase XerD n=1 Tax=Pontibacter akesuensis TaxID=388950 RepID=A0A1I7IM98_9BACT  ali  21  3.........ITVRHRKL-SNGKQKIYLDI-------VQAKKRKTETTK------------------------WQRYEKPRTQDEKEHNRKVDQLAEMLRADREKELFYGE-------YDFKKASSAKADFIELFREEADERFR--KRGAKSNTYCSFKHFCKFTNNKCSVKDIDAAFVKSFRDYLLT.. 139
146 3.000e-13UniRef50_A0A1G6GG23 Site-specific recombinase XerD n=1 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6GG23_9BACT  ali  14  3.........VKLREN-GKESGVRSLFLDI-------TTNGKRYKEYLGLTLEP-------------------------PKSTEIRQKNKQTKLLAESIRAKRELELQAQD-------YEFTPAFKKGVDFVAYFEKFVADYPHKDLRIVKYSKIWFVKYLESQNITTLKPKQLDERICKGYLEFMQKG. 141
147 3.000e-13UniRef50_A0A1Q3Z6H0 Uncharacterized protein n=1 Tax=Chryseobacterium sp. 36-9 TaxID=1895905 RepID=A0A1Q3Z6H0_9FLAO  ali  19  3.........VTLREKLTRNGLYKSLYLDIY------VSSNERYRESLKLKLY------------------------AKPKATTERTHNINTKNLAEQVRAKKILEIQEGRYGI-------KITKSKYSDFIQYFEMLTEKRENSG--INYSHWYSTKKQLINFSKTKPSFAQINKQWLEDFKQYLM... 143
148 3.000e-13UniRef50_UPI000DCAF9B1 site-specific integrase n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCAF9B1  ali  20  12......KEPVRLRQRRIKNGG-YSLYLDTY-------WNGKRSYDFLKLYLNPPTDD-------------------------LAIIENKTTLELAKQIKYKRILELQTGLHGSAVVKPRPK--------FRDFFAELASEKIRFDN--NAGNWASAFKHVLVFLGENPTIQEIDDIWLEEFRAYLL... 149
149 3.000e-13UniRef50_A0A1X9YUL5 Uncharacterized protein n=1 Tax=Pontibacter actiniarum TaxID=323450 RepID=A0A1X9YUL5_9BACT  ali  19  3........KVNIVEKKL-TGGKVSLLLDYY-------QHGQRKKETLKLYVYPSDKRS---------------------KNPILKNAFEETYAKALYLKHKKEMQLAHGEHDLPTKTDK-------TASFIHYFEQLAESRNQN--------WQSVRRHLYDYTKGKLTFGNVTEEWLHRFQEYLRT.. 137
150 3.000e-13UniRef50_A0A2S7T192 Recombinase n=1 Tax=Chitinophagaceae bacterium RB1R16 TaxID=2077091 RepID=A0A2S7T192_9BACT  ali  23  3.........VNLRQRE--SGKKIALYLDIY-------RSGERKQEFLKD-------------------LYLHPKPEKGRLSKEENDHNKHHTAIAEEIRYQREKELINGTYNIE-------DRSKIDGSFIEYFTKLME--TKRDSIGNYGNWVSTKLHLVEYCKKNATFKAIDKEWLQGFKDHLQN.. 144
151 4.000e-13UniRef50_R6F748 Site-specific recombinase phage integrase family n=1 Tax=Prevotella sp. CAG:520 TaxID=1262929 RepID=R6F748_9BACT  ali  16  7.......SPVRLRT-KNLSSGRVSLYLDI-------VKDGERRKEYLGLYLLPE-------------------------LTKADKNANKATMKIAEEIRAKRMVDLIEGRLSFAGDKAK-------RTDLLTWLEEQQTYYYNNNNTNYSKTIHNLIRHIRLFRGDKLTMKDVTPGFLRSFLDYLK... 145
152 5.000e-13UniRef50_A0A1B1S9L3 Integrase n=10 Tax=Bacteria TaxID=2 RepID=A0A1B1S9L3_9BACT  ali  13  17.................LKDGRASLYLEFYLGRSEDDEGNQVFYTSGAMTGKPKYQVKHIRKR-----ENLNLYIWLHPRNTQERLQNKNTLALAEKIRFEREQEFLE-------DREGYRLKKERQRDFLQYYRDFFNEN-PNLSRMMKCSIRQSYTKFINFLHESLRMEQLTPDMVTAFTDYLKK.. 186
153 5.000e-13UniRef50_F7LYH5 Uncharacterized protein n=19 Tax=Bacteroidales TaxID=171549 RepID=F7LYH5_9BACE  ali  16  1....MTAIRV-VRQGKKGKTDRLPLYVEFY-------INREKIRIAVRLSVTSKEWDE--------------QNEVIKGRDKESKDKNLIISNIRSRVSDIFVRARLKNETLTKESFFRQYNNPSDFGTFFDFARVYLKQISKTISFGTWKHHVSIIKKLETFAPG-LVFSEITHEFLLSFFAYLRK.. 160
154 5.000e-13UniRef50_C9KTZ2 Site-specific recombinase, phage integrase family n=6 Tax=Bacteroidales TaxID=171549 RepID=C9KTZ2_9BACE  ali  18  2........KITIRTR-ALKTGSRSIYLDFY-------EKGERWSEYLNLFLVPDD-------------------------TPDAKRLNDASMAKANEIKSKRLLGIDEDETETGGSEPNQLPKRIFADWLNDYIEGI--RRSPSYSQSTYHNYRSTVNIIKAYRRPRYLMSKIDKKFIAGLLDFMQNT. 150
155 5.000e-13UniRef50_A0A2D0NJK9 Integrase n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NJK9_9BACT  ali  16  1....MPSLKIVLFTSKMYQNGDH-------PVMLRVTHNRKLKYYGLNLSCTLQQWDQHKCRFNRNFNNY--------------KEKNRLLHFWEEKAYRIIDGLIKEDVAFHHKIFERKFVTNHRSISVFEFFNELMEELEKKGKAGNRRVYKGAKNALKKFHNKNLSFSDIDYIFLKKFETHLL... 162
156 6.000e-13UniRef50_UPI000D6B1245 site-specific integrase n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6B1245  ali  19  5..KVVMTTKLLIRKKRVNAKGETAILVGYY-------HDHKHCLFSTGIYVKPKDWDETGQKIKRSMKGFSTRNSVLN---QLKADIDEIALEL------KFQGVVPTTEQVKKAHNSKVGKGEIEQKTFMDYFDSFVEENRPQKAHGTIQKYITLQNHLKEFHSTQLSFDVINNSFYNSFINFL.... 174
157 1.000e-12UniRef50_A0A2K8Z9Z1 Integrase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A2K8Z9Z1_9BACT  ali  11  1....MATINIVLRKEKKKDG--------TFPLAIRITKDRKSSYIYFDYSIKSDDWDADKQRVKKSYPNSWLNNFLSTKKLEAEKQA----------------IELETQKSHVSSHAVRQRIKPSTGSTFFAQADLYLQRLKEAGKYNQYTADKPRVKHFKEFIKQDIALPEITVAVLERFKGHIRT.. 160
158 1.000e-12UniRef50_A0A1F3KR78 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3KR78_9BACT  ali  17  1....MATTKLLLKYNKKNKMGEIPFYIRI-------IKNRKAHFLSTGIFIKPEYWDEENHRVRKSHKNASYINAYLAGK-------------LADAER--MALDLETSKNDYSKKKAKREILGRSDESFLSFAENYVEKLKEKGNQGTYHKAEIVLRKLKQYKNKDLKFDNLNVAFLKDYEEHLR... 161
159 1.000e-12UniRef50_A0A173ZDT3 Integrase n=10 Tax=Bacteroidales TaxID=171549 RepID=A0A173ZDT3_BACVU  ali  17  5..KKQVKVKEPVRLRNELKDGRKSIYLDIYY-------NGRRTYQSLKLYLVPETDVSAQI-------------------------QNANTLAIANAIKTEKILNLTNKIAGITDRSY------KANMLFTDWMRVYRQDVEKRASASALIWVDRVTNELEKY-DNSVTLAEIDRDYIMRFLSHLLDRP 153
160 1.000e-12UniRef50_UPI0005C649C8 site-specific integrase n=1 Tax=Bacteroides timonensis TaxID=1470345 RepID=UPI0005C649C8  ali  12  32....MATIKAKLNVCRVTKSGK-------YPLVIQFIHMGQRRMLRTGLKIEPEYFDMKQECMVYHPGSPYRRDKI--------REMNRHLQSIRDTI-NNRIAALGTSLYTADDIAIWFRHCNSRNYLFL-YMEQMIEEKKNSRKFGIARAYQSTLNSLRTFCSEEISFKDVNSQFVRTYELYLQ... 197
161 1.000e-12UniRef50_A0A1F3LXN6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_42_66 TaxID=1797351 RepID=A0A1F3LXN6_9BACT  ali  19  10.RKGTKKNNVVLRE-KVLTTGSISLYLDIY-------RDGVRSYEFLKLYI------------------------NDKARTPIERQTNKETLELAEKIRTQRESELNHSKHG-------FISPIKKSTLYINYVASYLNSYSKKDIRMIKGATERFRNFLSEKMPGNLKLSHIDKQMMVSFVEYLKT.. 160
162 2.000e-12UniRef50_UPI0003FCEDA2 site-specific integrase n=1 Tax=Prevotella albensis TaxID=77768 RepID=UPI0003FCEDA2  ali  17  10.RNAIIKQPVKLRYKTLKKNNK-SLYLDIYL-------NGIRKYEFLRLYLVPE-------------------------VDENCKKHNQQVLRQALNIQAQRMMEIYGGVPMKPHEKPHLPVKLS------DFIQQYAESYRNAGHRSRYQTILTLIPHLEIFGAKDLPLCEIDKDFCLQFIQYLETA. 159
163 2.000e-12UniRef50_A0A259TXW6 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A259TXW6_9BACT  ali  12  1....MATITPLLRLPKARPDGHAPLWLRF-------SDTQRTVYLSLGVYLHPRFWNDRKREVRKGHPHAERINGLITKRLAE-----------AEDERLRLMVEREPVTLDALRNALAERVTAEEPVCFLAYVERFLEGVGKGGNVRRVRRESVVVGKLREFAAPDLPFERITPELLRDFEAHL.... 167
164 2.000e-12UniRef50_A0A0F8W1I7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8W1I7_9ZZZZ  ali  14  13....MASIKVVLRKKPLQSG--------AYPISLRITKDRKTKFFKTLFDAHISDWDPNSGTFKNNTKFIQENRLLQKIKT------------KAFQICSQLQTE-NEHFTLHDFEMAFRFRSNPVANNFFSFWENLIEDMIVAGRTGNAKANREGYKALKKFSGTNLRFDEISYAYLSKFENHLRS.. 175
165 2.000e-12UniRef50_A0A1G6H7C6 Site-specific recombinase XerD n=1 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6H7C6_9BACT  ali  16  5......SAKIYSREDFKRKDGTNPLYLRI-------TINRKTKKFSLGISVKSSYWDKKNGKVRKGDPAHFNKNLTL-----------ESCLKRAEEILFEYRINRKQLTFDAFDVAYQVPHSQKT-LSFIDYATEYVESMRNNGSYDTYRTRKSCISKVKQFAKGDISLTSIDLAFLQRFEEHM.... 165
166 3.000e-12UniRef50_A0A0S8I0L7 Uncharacterized protein (Fragment) n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8I0L7_9BACT  ali  25  3.........VTLRKRKL-SRNRYSLYLDIYY-------HGKRYYEFLKLYLGKDNVS------------------------------NKETLRLAENIRAKRQLEIQNNEYG-------FIPSFKRNLNFVDYFKKIADNKK------HLRYYKATLNLLEQKVNGHVKISNIDEKFLTDFQSYLL... 128
167 3.000e-12UniRef50_A0A2P5MRD2 Integrase n=1 Tax=Methylomonas sp. TaxID=418 RepID=A0A2P5MRD2_METSP  ali  20  2........KVTIEKRVNKTGDKQNIRLVYWYGSEDGKLKHNRKREQLDQFLY------------------------VNPKSKPEQQHNKDTLALVEAIRAKRITEAASSEHG-------FISPNKQDVRFYQLFDAMMNERKTFASKTSHNLWRGCREQVKKYWPEQLLLKHIDEDALKGLKRFLET.. 153
168 4.000e-12UniRef50_A0A239WCU1 Tyrosine recombinase XerC n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A239WCU1_9FLAO  ali  15  1....MASVKLILRLQQADATGACPLYI-------RVIKDRKSKLITTGLKLLPKDWDEAKQRIKKSMKNSARYNAFLDQKIADASALIADSERRSKNITAKKLKEAIKG---------------KDNVEFFKYSKDKLKKLQKTYTVSTYDNYLAQLQKFENFVNGDLCFHDIDIVLLQDYMNYMANT. 163
169 4.000e-12UniRef50_A0A081PC75 Uncharacterized protein n=3 Tax=Pedobacter TaxID=84567 RepID=A0A081PC75_9SPHI  ali  18  26................................................................KEWRENLKLRVYDKPSSSVEKEHNRKTLALAESIKAKKTLEYQ-------DEKYNVVTGFKSQGSFLKYFKTLTDARRKND--GNHGNWKSTYKHLLDFCNGDARFSDVDDDFLNKFKHFLSNG. 141
170 4.000e-12UniRef50_A0A1M6EXR6 Site-specific recombinase XerD n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A1M6EXR6_9BACT  ali  12  1....MASTKLVIRSDR-KNFGKTTIYVQY-------THKSIKKKFSTSISVEPERWNVKGQKIIGSTTEVTENNLTIQAARARIDQIVRHAIMHGEEPTFALVEERLKQSPTPAGQAAEQKSPQTTYTSFLELFASYIEATSSMKAHGTVKHYKSTLNHLHAYANKKLSLAQVDTTFYHDFVQFL.... 178
171 4.000e-12UniRef50_A0A0S3FTN0 Transposase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A0S3FTN0_9FLAO  ali  23  6MKRKGQISKKNVEKGKSRMN---SLYLMYY-----DEDTKQRSREWLSLYLY------------------------DKPKNFLEKEHNKETELLAEAIKAQKVLDFQNKKNGFVSSVSG-------KIGFLEYFKSLV--VKKYESNGNYGNWYSTHKHLKNFKGKDIQISKVDELFLENFKIYLLTS. 153
172 4.000e-12UniRef50_A0A174D6G3 Tyrosine recombinase XerD n=3 Tax=Bacteroidia TaxID=200643 RepID=A0A174D6G3_9BACT  ali  20  1..................................................................................MQKLHNEEILAKAELIRCYRVAELIN-------RNIGYIGPEKRNRDFLDYFKKATLKHPQ--------TWQSAYLHFYRFSKEHCLFGDLDFKLCSRFREYLLDT. 91
173 5.000e-12UniRef50_A0A2E0UKR1 Recombinase n=1 Tax=Ectothiorhodospiraceae bacterium TaxID=2026737 RepID=A0A2E0UKR1_9GAMM  ali  24  2........KVTLRERTVKS-GRTQLYFDIYYG------DGKRKTKAFG-------------------------------TLSGNRQQDKEARRIAGAARSKLEIELLN-------ESHGFHKPFQLERNFFEFFDQVMDN-----KKGNYGCWKSTRFHLVNFVGKSLHFKTITPQWLESLKSYLLS.. 131
174 5.000e-12UniRef50_G2Z2Y8 Probable transposase n=15 Tax=Bacteroidetes TaxID=976 RepID=G2Z2Y8_FLABF  ali  20  29...............................LMYNDEENKKRSYEFLRLYLY------------------------DKPKNFLEKEHNKETQLLAESIRAQKILDLQSRKHGFVSSVSG-------KIGFLEYFKLVVEN--KCESSGNHGNWLSTLKHLTNFCGKDVQLSKIDDLFLESFKVYLLT.. 152
175 5.000e-12UniRef50_D7VHV3 Site-specific recombinase, phage integrase family n=1 Tax=Sphingobacterium spiritivorum ATCC 33861 TaxID=525373 RepID=D7VHV3_9SPHI :_  ali  15  4....MATVKAVIREDKINAKNEAPIYLRI-------TKNRKTTFLSLQISVPPLYWDKERECIKKNNKIKGYVRLNNFIDNERVRMKNQ-------------LVEAEQSDRTLSSKKIKDIIKGEEEPDFFEFAEQYQKTIESSESVRLYNQYKAILNKLERFNKRQLKFSEITVSYLKRFSEHLAT.. 167
176 5.000e-12UniRef50_I3C1P5 Site-specific recombinase XerD n=42 Tax=Flavobacteriaceae TaxID=49546 RepID=I3C1P5_9FLAO  ali  12  1....MATVKAVLRKKKNPEG--------CYPIAIRITKDRKSSYLGTGQHIEEKHWDEKNRCIRKSHPN-------------ANIINNFLITKIAEA--NKKVLEAENNEDYQTVNAIKKKIRQNKKINFFAVADMHLENLKNREKHHQYDTELGRLKKFKSFLRKNLSFNELNVPLLKKFETYLLH.. 161
177 6.000e-12UniRef50_A0A1F3KDK0 Uncharacterized protein n=2 Tax=Bacteroidetes bacterium GWF2_35_48 TaxID=1797343 RepID=A0A1F3KDK0_9BACT  ali  13  1....MPTTKLILFEHKAKKNKEAPIYL-------RLIKDRKPKYVSLKLYILPKYWDEDGQKVKPGHPNSTRMNAYLVERTNDA---------------MKSLLDVEIDDPNAPAIALKQSVMGVAPEDFFTYAFRFIKQYESKGKIGTYRRFKAVLTKLQTYTGPKFNFNQFNIKFLQEYENHMRGT. 163
178 7.000e-12UniRef50_G8TJF8 Integrase family protein n=1 Tax=Niastella koreensis (strain DSM 17620 / KACC 11465 / GR20-10) TaxID=700598 RepID=G8TJF8_NIAKG  ali  13  1....MSTLKIVLR-RKPNKDGSFPLCL-------RVTKDRKTSFIHLGYSLQESEWDAQAQRVKRSHPNSVRLNNFLAKKLTEA---------------TDTALELESHKKYTTSKAVVQKINPKVSNSFMAQAKIHLSNLEKTKNFNRWTNESSLFKNFKKFLGGDIGFEGITSTLLKQFAAHLK... 160
179 8.000e-12UniRef50_A0A1Q3JRS8 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 41-5 TaxID=1895836 RepID=A0A1Q3JRS8_9SPHI  ali  14  10...........LRIDKPNKGGTKKQDAGTVPLHLIISVKGDRVYHNTGVSMYPEQWDDKNGKVREFAKKYGLRQIDLPPITEQAEKDNATLNKLQDDIKAIFELDGVQYSSRMIKDELAQKLKPATKKDFMDNYIRMNEATRKAGSLQVYRTVRRRLAEYESYAKTKVTFTNVDYAFFEAFQAYLYDA. 201
180 9.000e-12UniRef50_A0A2E4PFJ6 Recombinase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2E4PFJ6_FLASP  ali  17  26................................................................NRKRERTVMFYHSQPKNSSEREHNKETKKLEEHFVSNLTLKIQSGELGIQVSKHK-------NKNFIEFFSYLTQKRESTDK--NYSTWRSALKHLKEFCPDGLSFKQMDKHWLEDFKHFL.... 137
181 9.000e-12UniRef50_G9S2V4 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=G9S2V4_9BACT  ali  19  4.KVTIKSTKEPVRLRKNLANGVQSLYLDCY-------VDGKRSYEFLKLYLIPE-------------------------KGAMAKAQNEATLQAANAIKMTRILEITNNKAGLKNTSLKAKQTL---ADWMETFKKKQAQKGIKDQKLIHKTINVLTKY-----NINIPLNKIDRQYCIGFMSFLKN.. 150
182 1.000e-11UniRef50_Q11V33 Tn5520-like integrase (Transfer factor) n=1 Tax=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) TaxID=269798 RepID=Q11V33_CYT  ali  15  1....MASVKVFLAKNKQLKNGE-------YPVWIRIIIDRKTKYSSLGISTKLEWWDENKCIPNKKNPNKFELETLISKK-------------IAEVKKAIMESEIEN-KSYSADEIIATTKKSKNKITVLKFYDEVIERFKKANKIGNAAVYRDSRKALFKFRGKDLFFHELDPGMLNKLEEYLL... 162
183 1.000e-11UniRef50_A0A1G9BU22 Site-specific recombinase XerD n=3 Tax=Cytophagales TaxID=768507 RepID=A0A1G9BU22_9BACT  ali  15  1....MASVKVVRKANKEDKFGKAPLYLRI-------IKDRKAKFVALSIRVLEEEWDEETQQVVKIKGLKGREMRLKV------QQYNKAIAKKRSEAEDV-ALDLETTSKYVAPQKIKETIMGKSSESFLKYAHRYLASLEKSKKMGTLGKGKSVISKLEIYLGRDIVFTDIDYTFLKSYETYLR... 169
184 1.000e-11UniRef50_A0A271IU82 Uncharacterized protein n=2 Tax=Rubrivirga sp. SAORIC476 TaxID=1961794 RepID=A0A271IU82_9BACT  ali  12  1....MPAVTPVLWHYRTNKDGLSPIYL-------RLADGQKTRYRSLKVSVREGQWNDRACRVSGRHPNAAEINKMI--ADEVQRAEDEVFRRTA-------VGERTDADAVARSLTVRPTDDKPGQSDFFSFADELVGGYKTRGQMWTHDRYVSVLKKMRAYTGEPFAFSGLTPAFLRRYEAHLAK.. 167
185 1.000e-11UniRef50_R6XWP4 Site-specific recombinase n=2 Tax=environmental samples TaxID=2231195 RepID=R6XWP4_9BACT  ali  18  4.KKTMTRAKEPIKIWKPLKNGNKALYLRRY--IAHTQSKGYVYEKLDGLFLIDDK----------------------KGKDKSAKERNNQALQVASLMKCERIKEYMNEKVGIKKKAVRDMPLKDWMQTYAE------RKSAQGQSGSNAATIHNTMLHLIIYKGETVKMSQLDKTFCEGFVTYLANA. 161
186 1.000e-11UniRef50_A6LG68 Site-specific recombinase n=1 Tax=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) TaxI  ali  15  13......KQPVKIRYKKL-ANGNLSIYLDIY-------QNGKRNYKFLKLYLVPETNEKA-------------------------KAINRKNMDLAEAIKAQMIIQLNTTIHGLSNQ------KESSKILLRDYIRSFAETKGK----STQQNLNSLVYHLERSKGTDIQIGKVDKYYIMDFIEYLEDA. 151
187 1.000e-11UniRef50_K0XFW1 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=K0XFW1_9BACT  ali  14  5..KKSSKLKEPVRVRKKLADGSESYYLDIY-------VNGKRSYEFLKMYHLPE-------------------------VNARVREQNRATREAVEAIKSQRIIEITNSKAGIKSKSAWQKLTL---ADWLEKFYAIQERKGIK----RVEKLGSIIKIINQY-GKSTRMGDIDKKWVLGFIDWIQHT. 151
188 2.000e-11UniRef50_A0A1Y4JBH8 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y4JBH8_9BACE  ali  17  5..KKQIKAKEPVRLRNKLKNGNTSIYLDIY-------HDGRRSYQFLRLYLVPETDY-------------------------ASKIQNANTLATANAIKAEKILELTNKLAGITDRSY------KAKMLFTDWMRVYHDHMKRGGSKSALTWINRCIAELEEYNGM-VTLAEVDRDYLLGFMERLLT.. 152
189 2.000e-11UniRef50_A0A132GST6 Site-specific recombinase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A132GST6_9BACT  ali  15  3.........VELRSR-LLKNGNKTLYLDFY-------EKGKRWYEYLDLYIVP-------------------------GNTPAIKKENEGTMNKAIAIKAKRILGIEDE----PEPAVNGELPKRVFADWLDYYKRLEDEDRLSESSENVDSCIKVVKYLAFKHRPRMLMKKIDKKFLVDFFDYLQHT. 148
190 2.000e-11UniRef50_E7C714 Integrase n=1 Tax=uncultured nuHF2 cluster bacterium HF0770_13K08 TaxID=723591 RepID=E7C714_9BACT  ali  19  7................................IWTFYHNGQRHYDFLKLYL-------------------------VKGTSSRVIAANRETLELAETIKTQKQNEINHSEHGL-------IPSFKRNADFVAYFKKLGERKGQSSKV-----WRNVLNYLEVFTGGRVVFKNIDELWLEKWQRFLL... 123
191 2.000e-11UniRef50_A0A258JYH0 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium 32-34-25 TaxID=1970508 RepID=A0A258JYH0_9FLAO  ali  12  19.RKIIVPMKESFTFREKKSNGKTPLVL-------TLRSNSKKERIALNLDIDTDYWDKNKQR--------------LKPINQEHIDINLILDNIQSKITQIKTSYRLSDRVLTLETLKKEFLSDMPRIRFTAFYKIMLEEEKVLMEIGSYKRYCSVLKKIEAF-DNDITFMEIDQNWLDKFRKHLR... 182
192 2.000e-11UniRef50_A4CGU6 Putative bacteriophage integrase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A4CGU6_ROBBH  ali  19  3.........VHLRSRKLKSGDR-SLYLDI-------HHHGDRWREFLKIRISPKDSDRTEKK------------------------------RIAERIRANRELELLSQSTGH-------IPSHLTNLNFFDFAENYLSNYPFKDVRIVH---NAVQKFKVALGNTRLTFAQITPKVMEAFKDYLIH.. 132
193 2.000e-11UniRef50_A0A2A4N659 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4N659_9BACT  ali  17  3.........VILRKRK-NSDGTTSLLLDIY-------NNGKRSYEFLK------------------------NSKLCKPVTALDRKNNRERLNLAKQICNKREQQIQSDEYDVSPE-------FRKGIDFVDFFESYLDKYNKKDKRVMNACFNKFKEFLKAESITERSSKKLSANIIIRFKEYL.... 139
194 3.000e-11UniRef50_F2IEY5 Integrase family protein n=1 Tax=Fluviicola taffensis (strain DSM 16823 / NCIMB 13979 / RW262) TaxID=755732 RepID=F2IEY5_FLUTR  ali  15  1....MSSVSIILRKDKVNKKGE-------YPIHFRIIKYRKVNYISSGFSTLESNWDEKNKRIKARGSDSKETASRINAQISKRFSEIQ-----------QEVISLETSNRNVSIKTIKDKVIGKKSMDFFEFANSVTESYLTDSKIGTYSKTKGIIEKLKKY-DSSLSFIDITPKFLTAYEAYLRT.. 164
195 3.000e-11UniRef50_A0A2G2NZQ0 Uncharacterized protein n=1 Tax=Lutibacter sp. TaxID=1925666 RepID=A0A2G2NZQ0_9FLAO  ali  14  1....MATIKLTLDKRRKLGDGRSPLIL-------RLTHKSNSTSIQTGIKLHFSEWDSKKLRVLKKHSIQKELNLQLKDII----LRYEQKLRIAEIEKPYCNV--------VDLKKLITSNSFGESVEFNSFSSEQVEMLKKQGRFGNAQSYITATNSLIKYGGKNLELGEIDYNFILGFENHLSS.. 164
196 3.000e-11UniRef50_A0A2G2CVX0 Uncharacterized protein n=3 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2CVX0_9FLAO  ali  11  1....MAKVKLKLDQRKNRPDGT-------FPLILSLAHNSKTRTISLKYYFKREEWDQPNLTPINVDYHKAIGVRVRAKLSKAESLIEQLRIELISDLKAKIEAEVLSNDSTTDVQKTKFIINRTNKASLTAYSQKKIERMRFSSKHGSADAIETAMRSIERFTNPDVSFSEVDLTFLKDF........ 177
197 3.000e-11UniRef50_UPI000B7F0056 hypothetical protein n=1 Tax=Fabibacter pacificus TaxID=1267423 RepID=UPI000B7F0056  ali  17  6.......................................RQKDQGTGKIYIHLEFNLPGEKRRRKSTGLYL----FSKPKNPTERKHNREIKELAEAIKSQYLIKVKNKEFGFNDDTHQ-------KLDFYKYLDLLLRK--KSDSLGNLGNWKSMKKHLQNFHNGELLFRDVNQTFVLNFKEYLDK.. 140
198 4.000e-11UniRef50_A0A1E5SV52 Integrase n=2 Tax=Bacteria TaxID=2 RepID=A0A1E5SV52_9BACT  ali  16  1....MASIKAVLRRNKQRKDGTI-------PVAIRITKDRKTRFIFTGQYVLEKDWNDDSQ-VNMIRKSHPNAKRLNNLIRTKISEANDSILQADTADENISVEQIKN-----------RVKRSRANTDFFDVANERIKAYRAKGTFSVAQAEESICNNLKRFIKKELSFQEITVGFLERFKTF..... 162
199 4.000e-11UniRef50_UPI000A040A08 hypothetical protein n=1 Tax=Segetibacter koreensis TaxID=398037 RepID=UPI000A040A08  ali  17  58............................ICNMNINISSKPSRDNKKLWYYL---EWGKSTGQRKATGIFSW-----IKPRNQVEKNHNKEALIILDTKRSQMVLDQQS-------INSSYVPQHKLKANFLDYYSDYIKANRKAGNR----HLETSLTAFKNFLKKDISAIDITENLCEGFRNYLL... 197
200 5.000e-11UniRef50_F5J119 Uncharacterized protein n=2 Tax=Dysgonomonas gadei TaxID=156974 RepID=F5J119_9BACT  ali  14  3.....TSINVMLYTYKVLSNGESPL-------VIRLTQNKKRKYVRLNITLSPEYWDSKRDKLKSSCPNK-------------EYVENIITEKLSKYQKQVLEYQSIGKEYSLNQLIEAVEGKPQKNITVCDYLNSVIENLTKENRIGNATHYQALYNSLERFTKNQLQFVDIDVPFLNKYETHLRS.. 165
201 5.000e-11UniRef50_A0A1G7ETW2 Site-specific recombinase XerD n=1 Tax=Mucilaginibacter pineti TaxID=1391627 RepID=A0A1G7ETW2_9SPHI  ali  12  1....MTSIKIFPKMNKINKYGHAPIYL-------RLIKNRRIKYLALDIHIDPKDWNEEICKLNPDANNA---------------EQINSYLEIKEAEAQNTALEMEIKSNLVSLYNIKTKIKGVKPVDFFAFFEKRIQERDEELSIGSLRRYKSVLKKLRNFSGEQLYFDELNVLFIRRFQNHLTD.. 162
202 5.000e-11UniRef50_E4TLX3 Integrase family protein n=1 Tax=Marivirga tractuosa (strain ATCC 23168 / DSM 4126 / NBRC 15989 / NCIMB 1408 / VKM B-1430 / H-43) Tax  ali  14  4.....TSVSVTLDKRRPKKNG-------FYPIIFRLNHYDKNTSISSKHDIDDKYWDFTNKKVKKGCPQFSSTSAFNNFLVSKLSDFSNEIL---------RLESLGRLESMSIQDVKKAITRDKKDVQFYAYTTEWIEDLKNTGRKGYARTFDDLIRELKIFTNKDFSFRELNYEFLKKFDTFYLS.. 170
203 5.000e-11UniRef50_A0A078S8D5 Uncharacterized protein n=1 Tax=Parabacteroides distasonis str. 3999B T(B) 4 TaxID=1339344 RepID=A0A078S8D5_9BACT  ali  15  4.KKNEMKAKEPVKLRKKQSNANLSIYLDIYY-------KGKRYYEFLKLYLTPERF-------------------------PEDRDKNRITLRLANSIKAQRIIDLQNEIYGVRM------INGLGKKTLLEFLSELSTDKSAHGDKAYSLRLRSLANHLRDYM-PQCLLKDIDTGFVKGFIAHLRKQP 153
204 5.000e-11UniRef50_K2P5J4 Site-specific recombinase XerD n=1 Tax=Galbibacter marinus TaxID=555500 RepID=K2P5J4_9FLAO  ali  15  17..KMSGTISINIRIRKKSKNKLSSIYLDIY------QKDQKRHRIPLGVRIPIKDFDAKKQRV--------------KPSNNFSKDYNLIIEKKLSDINNIMVVYRLRGDKLTVEKLYEELSSPSYNIDFIEFYRKNLEHQKGSSKESTYKQQKSSLEKIKKFRSK-ILFHEIDKQFFIEFVKFLK... 182
205 6.000e-11UniRef50_A0A1V5IUT6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA104 TaxID=1852816 RepID=A0A1V5IUT6_9BACT  ali  23  4.KNIVPDQKVKLRKRKLPS-GNVALFLDY-------VQNETRMRESLGLTLYP-------------------------GTTTSIKEKNQRTLLKAEAFRIEKEKEIL--------HLVQKKENLGAKTLFLQYYRDMVEERHGNDTQGNWGNWKSCLRYLEIYASEKTTFADITV.............. 137
206 6.000e-11UniRef50_A0A2N5YK72 Recombinase n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YK72_9BACT  ali  14  1....MATVKVVLRKDKVNQNGLAPLYLRI-------IKDRKSKFISLGVKVEPKYWNEEKSVIRKGAVNYQELN-------------NFILQKRAEAERTA--LDIEGTTKSATTKRIKDEIIGKKPSNFFEYAERKLSELKHTIAPSTHTTYGFYIGKIEKFLGKNITFQEMDIDFIKRYEKYL.... 161
207 8.000e-11UniRef50_A0A1B7XKS9 Uncharacterized protein n=1 Tax=Tamlana sp. s12 TaxID=1630406 RepID=A0A1B7XKS9_9FLAO  ali  20  38..............................PVYLHVTSKRKRKRIHLDLYVDPNMWDKEQACLVGPKHVV--------------SDTNLILDNIKSKITDIRTVYKLSSKTLTIDSFIDEFTNEMPRLNFVSFFNRVLEDRKNTISVATYAKERSIYTKLKSY-KKEILFCDIDNYFFLKFRNHL.... 177
208 8.000e-11UniRef50_A0A264Y4J7 Uncharacterized protein n=1 Tax=Prevotella sp. 885 TaxID=2022527 RepID=A0A264Y4J7_9BACT  ali  19  2........KIELRHRKH-SSGNQTLYLEFYEGRN------KRRYESLNLFLVPE-------------------------RTEEDRRVNEATLALAQKIKAERILGIERP----VEDDEEPELPHRVFSEWMDQYIEH-KKVDDNISDSHYRTLTSTIKIVKSYKRPRMLLSKVDKNFYKNFLIYIKD.. 147
209 1.000e-10UniRef50_A0A1H3Z1V0 Site-specific recombinase XerD n=1 Tax=Pedobacter hartonius TaxID=425514 RepID=A0A1H3Z1V0_9SPHI  ali  14  1....MVQIKVILDNRKEKADGTCPIY-------YRITEQRKASYISTGFSVQEEHWNEKERTVIKKHPNAQFIN-------------NSISKRYSEIQKIIIQLE-DEGKYSIEGVKNRLLAPKRTATSVKEFSKELIEQLKSQKKIGNALIYQTAINRLFSFKNQSLKFIDIDLTFIENYNTFL.... 161
210 1.000e-10UniRef50_A0A2E3SFA9 Integrase n=1 Tax=Muricauda sp. TaxID=192149 RepID=A0A2E3SFA9_9FLAO  ali  16  10...KMASIKLTL-KKKALTDGSFPIFLRI-------TKDRKHKHYKTLYNASIEEWDDKLGQFKN------------NTKFIQENRFLQQLKAKAFTVCSQLEIEKENYTLYDFDKAFTTKSQKKNTKNFFYFWDEIIEELTKSGRTGDTTIHDESFKALKKFHGTQLEFQQINFTFLSKYEVHLRS.. 175
211 1.000e-10UniRef50_R9HW56 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=R9HW56_9BACE  ali  16  2...ALPKSRINLKY-KDIDGGRKSIYLDYY-------KGGKRVRESLRLYLLPETDRKA-------------------------IAGNKTVMRQAREILRIRLEELAASDNGLEIEATVPDIPLANII------KDYHSVVLGRGDKSTASNIMGMYRAVKAYRGEDVMLSAVDVEYCDGLVDFLRD.. 146
212 1.000e-10UniRef50_UPI000DD32386 site-specific integrase n=2 Tax=Rhodothermaceae TaxID=563843 RepID=UPI000DD32386  ali  12  1....MASVRIIQRKDKSRADGTAPLYVRI-------TARRRSRYVSTGIYVEPRHFNAARQEVRRSHPLASAYNARLQ-------DLRLEAERAAEADAPEAVKDALQGRAG----------------SLTRYFERFIEGLEQAGQYWERKKYTTTLRKLRACLGEEIDFADLDREALRRFEVYLRD.. 154
213 1.000e-10UniRef50_A0A1Y4UAU8 Uncharacterized protein n=3 Tax=Alistipes TaxID=239759 RepID=A0A1Y4UAU8_9BACT  ali  16  3...KLPTPTLYLRSDKRKKNGRMPLYIRF------PRIDGEEPKYPMGIDLLPEEWDDKTKEPIDDALKLIIE---------------KELTRIRTRIYNVLVNGEKLTKTCLREIVANEEPKDPGDASFYEYFDKYVLERRQAGKRSTEKGYDTTRRALKEFR-EKIRIKDIDAKFINDFERFLIK.. 166
214 1.000e-10UniRef50_A0A016AW90 Phage integrase family protein n=1 Tax=Bacteroides fragilis str. 3976T8 TaxID=1339314 RepID=A0A016AW90_BACFG  ali  13  5.KKKLTDNSVKVRY-KTLADGRKSVYLDCCDGCR-------RTYDFLKLYILPETDREAVRR-------------------------NKATMKKVEEIQRERTLQLMGIGNGGTGDKPVFHTDMPLSEWMDAYIGEQKRYGVKNTAIITK------VARILGTIAPDVRMSQVDKDFCLMFIDYLRN.. 151
215 1.000e-10UniRef50_A0A2V3PU36 Site-specific recombinase XerD n=5 Tax=Bacteroidales TaxID=171549 RepID=A0A2V3PU36_9BACT  ali  14  3.....TTVNVVCYKNKKLSNGESPLMLRIC-------MNRKSKYKSLGISVNPQFWDFDKNRPKSNCPN---------------KDLILKIILDKEAEYQKRILELKSEDQEFTASTLIAPKSKHIIKTVGEFYKELVTEFEQSGRIGNSRIYKDSLRSIEMFTNNDIPFSHIDLDFLKGYEKYLR... 163
216 1.000e-10UniRef50_A0A2W7NTS6 Site-specific recombinase XerD n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2W7NTS6_9BACT  ali  13  1....MAKFKIILYKWKQYNDGK-------YPIIIQLIHNRKRKVITLGYTATPEEWIEELGRFSKSVKNYKVLNQAL-----------ESTELKAERIINEIKIE---NKLFSFELFQSRFSNDGKTISVFPFYEEIIGELLSIEKVNTANIYKSSFNIIRKFRNKDLTFYDINYEFLKQFETYL.... 161
217 1.000e-10UniRef50_A0A1G7ITE9 Site-specific recombinase XerD n=2 Tax=Pricia antarctica TaxID=641691 RepID=A0A1G7ITE9_9FLAO  ali  16  16....MATLKTVLHPKINKKGTKD------YRLAIRLTVNRKRSYYHLGQKVEPKFWDAPGEKVKSSHSRH--------------KQLNRLIRKKYDEIEDVIFELEASKHDYTAKQVIDSIRKNTKKLSFFELADEHIEDLTKAKNHNRAISDKSKINRLKEFAKNNLTFEEIDEDLLKKMKIYLRNT. 180
218 1.000e-10UniRef50_A3WNK9 Tyrosine type site-specific recombinase n=1 Tax=Idiomarina baltica OS145 TaxID=314276 RepID=A3WNK9_9GAMM  ali  19  2........KITIQKREPDKNGHRALRLVYYHGSKNGSRAQKRSYEPLNLFLY------------------------DKPRLPAEREHNKTVNQKAEAIRAKRLLEIESSRHGLD-------DRTKLSASFFDYFDQLAGKHET.............................................. 108
219 2.000e-10UniRef50_A0A1F3EAY4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWB2_41_8 TaxID=1797322 RepID=A0A1F3EAY4_9BACT  ali  19  1....MSSPKVFLHSGYKKKDGTCAIYI-------LVHIENKSLKFATGITVDPAKFD--------------HQKSRIKGASKEVKDKNLIIDKSLALINDIEVRYRLQQKELTADLLKREWINPSRRIDFYAFFDEAIKERKGDIAESTIRQHKSAIEKLKKF-KPKLTFSEIDQEFIESYRRWLKAAP 163
220 2.000e-10UniRef50_D4INU9 Site-specific recombinase XerD n=7 Tax=Bacteroidales TaxID=171549 RepID=D4INU9_9BACT  ali  12  3.....ANIEVICYKYKPLKDGTLPLML-------RVTKDRKRKYVSLGLSLQEKFWDFEKGKPKRNCPNKEQIERLIAAKTAEYNDLIVEMTA-------------QQREYTVETLVSHFHNQVRC-ATVVELYDKLIDDMKRGGKLGNAGVYKYSRTSLLKFTGQRIPFSDIDAVWLRRYENWLRTS. 166
221 2.000e-10UniRef50_F7L7B7 Uncharacterized protein n=4 Tax=Bacteroides TaxID=816 RepID=F7L7B7_BACOV  ali  20  4.QKESVKPKNFVRLRKKLANGNKSLYLDIY-------RDGVRSYEFLKMYLIPEKN------------------------NVTAKQQNENTLQAAEVIRSERQNAIVKGQAGITDASAKNKLLL---MDWLKIYRAKLEKRQYKD----ISHVDNLMRILAGYKPATMRLTGIDKDFAKGFIDYLKH.. 153
222 2.000e-10UniRef50_A0A1Q6F5M8 Integrase n=5 Tax=Bacteroidales TaxID=171549 RepID=A0A1Q6F5M8_9BACT  ali  16  1MAKLQNKTKDNPKEQRPLKDGRISLYLEYYLG----RTETPVVDEDGNPVLYTTGAMAGKPKVKITHNRKKEYYLIASPKTPAERQQNKEILELAKRVRYEREEELKENKHGYRLKKEEVE------INYLDWMAEYHANYTKSDGNQIRRARTVFIDFLKKAAGLKVKPEQLTKDLMRSFTEYLIK.. 217
223 3.000e-10UniRef50_UPI000CF63ABC hypothetical protein n=1 Tax=Apibacter adventoris TaxID=1679466 RepID=UPI000CF63ABC  ali  21  3.........IRLRKRELKEKGRYALYLDIYAYQ-------KQWQENLKLYLEND------------------------KGNPTLRQMNKQTMSVAEKIKVGRLFQIQN-------DVFGFKQLEKIYRTFNEFFYELWQERERTG--INFDSWDSVSKHLNNF-NENIPFTHLTERYLEEFKAYLLT.. 139
224 3.000e-10UniRef50_A0A191TL18 Uncharacterized protein n=1 Tax=Arachidicoccus sp. BS20 TaxID=1850526 RepID=A0A191TL18_9BACT  ali  16  3.........VTLRKRK-NADGSQSLLLDIY-------HNGKRRYEFLK------------------------HLKLDKGTTLTERQRNKDKLETAKKIAAHRANELES-------HNYKVIVDAGRKADVIQWMQAFVDKYQLKDKRNVQGVLNRFITFLNETKQNGLTFGDFSENIAVDFRNYLNH.. 141
225 3.000e-10UniRef50_A0A2T7QA57 Uncharacterized protein n=1 Tax=Terrimonas sp. NS-102 TaxID=2171976 RepID=A0A2T7QA57_9BACT  ali  15  6..........................LRFKIARMNFIQIPNRKKDKIFYYYDLGGRGKGQRPATGIFTY-------IKPKDQIQKNHNKEARLILETKKSQFIIE-------SQAVGTPYMPQHKFRDNFLDYFAEYVKLNRKNDNR----HLSCCFTKFKCFVGKSISPIEITENFCKRFRQYLLD.. 149
226 3.000e-10UniRef50_A0A0E4A0T7 Uncharacterized protein n=3 Tax=Cytophagaceae TaxID=89373 RepID=A0A0E4A0T7_9BACT  ali  10  6....LPQIKVMLYTSKTLADGSHPLRLRI-------TKDGGRKYISIGENCPRAQWDVEKELPRRSHPEQKRLLALIKKWETTYAEAAKRLQDIGHPFTIDMIID-------AVTEASKKPRKERGGVMLLSHLQNIVDQLQEARQVGNSNVYRDTRRVLAKFHDKDCPLSNVNVPFLNRFETHLRS.. 175
227 4.000e-10UniRef50_F3QYM5 Site-specific recombinase, phage integrase family n=2 Tax=Bacteroidales TaxID=171549 RepID=F3QYM5_9BACT  ali  15  7..KDSKKSPVKIRF-KAMKDGRRSIYLDCY-------RNGHRSYEYLKLYLVPETDDKSLR-------------------------LNEAAMRKAETACRKKLRELKKLPAENRRLMDTQDCISNKGISILEWLSRFKEIQRSRGVHDIH-AIDRLCAILSEMNCGDTKVNEIGKDFCIAFVEYLKTG. 158
228 5.000e-10UniRef50_D8DYF4 Mobilizable transposon, int protein n=1 Tax=Prevotella bryantii B14 TaxID=752555 RepID=D8DYF4_PREBR  ali  53  2..................................................................................CRSQKDQEACIFADKVRDFRQHKYDNQTLYTDTEAEQAAQNERSKCDFIQYFAELKEKRHKNSSKSIQVNWNRELALLKLYTGGKLLFGRIDLNLIEDYKD...... 103
229 5.000e-10UniRef50_UPI000370BCBA site-specific integrase n=1 Tax=Gracilimonas tropica TaxID=454600 RepID=UPI000370BCBA  ali  11  1....MPTIKAVLRPPKDKEGQK--------PIYIRIADAGKTRYVSTGLKVKPGLWNENKREVRENDFIDAAH-------------LNKIISDKVKAIRDEAYQLQADNQNVNADILKKKAKSKEYRGSFIEYGKTFA-KQKRRVNVRTGKRYDAVLSKIEEYTGGKLQFKDVTVTWLKEFSAWLAD.. 161
230 5.000e-10UniRef50_A0A1E3ZYW5 Uncharacterized protein (Fragment) n=1 Tax=Cytophagaceae bacterium SCN 52-12 TaxID=1660162 RepID=A0A1E3ZYW5_9BACT  ali  14  3.....TNVVVSLDTRRKKKDGS-------YPIIMRLGHDGKTTSIPLGLSIDEKDWDDKQRKVKKT-------YTGVNSVTWLNNRIQKIKTEAMDIILKLHDDGILQTLPITSLK--DRITQKDAKDSFIEFANQCINELIAANRIGTARSYKGIISILKDYRKGDLLFKEITYDFLTKFEIH..... 166
231 6.000e-10UniRef50_A0A264Y7M5 Uncharacterized protein n=1 Tax=Prevotella sp. 885 TaxID=2022527 RepID=A0A264Y7M5_9BACT  ali  14  18.RRFVDKEKIKLRTRE-RANGNFVIYLDMYIGE-----------------------GKHKCETVNIDNQPLYLVPENGRNDTINKTRNNKTWEQAKAVKAQRIIDKQNGELGFNQSVE------RRKMEVLAYIEHYKDEAIKKERHVHLTDIPGLYNHFKDFAGTKITFAQLDRDTILRFIDFLKTS. 179
232 6.000e-10UniRef50_A0A0A7LHW5 Integrase n=10 Tax=Cytophagales TaxID=768507 RepID=A0A0A7LHW5_9BACT  ali  12  12.....ATVKVVYYTHKTLADGSH-------PFMVRITKDRKLKYLATGLSLHPKYWNEAKREVRKSFPEPGREELLTKLQEWQTKYENAAKSLAADD---------EQHDAPAVAAKAIEGRKATRRIKLLAYCTELSDAMKAGGQVGNATIYRDLRNQLAKFAGGDIAFDKVSVSFCNKWEASLRAT. 185
233 6.000e-10UniRef50_Q2S4Z3 Phage integrase family protein n=4 Tax=Bacteria TaxID=2 RepID=Q2S4Z3_SALRD  ali  55....MPAISIIARTRRKDDHGRVPIRLRI-------SHRGEKRFIALPVKVLAKKWNGDKRRVTGTHPDAGEINTFLSDLERAAFSVISRLERAGTLITAQRIKDEIQEEREEVKSA---------PEDFLAFAREKVKGYKRRGQIGTFRSYRTTCRKFETYGRDEVPFGALEAELFREFRTY..... 223
234 6.000e-10UniRef50_S0GHX9 Uncharacterized protein n=7 Tax=Bacteroidales TaxID=171549 RepID=S0GHX9_9BACT  ali  13  1....MYNVSVKVKRRKSIEAGKRM------PLYVQIIYRREVRKMALPYQLSEEEWDGGREEINIPGESTSE-------RSKELYAIREQFSRDCRTVRSVIYLKEKKGSFTPDEIVEACKERFAV-ANLTKYVEKQICVLQGEGKDETARHYQSTLNAFMHFRGGELRLDEIDAPLLKEFETYLFSS. 171
235 7.000e-10UniRef50_D1W0H0 Site-specific recombinase, phage integrase family n=3 Tax=Prevotella TaxID=838 RepID=D1W0H0_9BACT  ali  11  33............................FYPIMLRITRDRKKKRVKTGLEVKKSDWNQKAKNHKHFRSSYHNAEASNEMLADILSRYDSTYKELRKEGVASSENIIQKVKTGEVSE------------SFLQYAKDRTQEIYDAGGVRNWKKYNGFCNKLETFLKKDISFSEITPSFLSKFDNFLHKLP 185
236 8.000e-10UniRef50_R9ICM6 Uncharacterized protein n=1 Tax=Bacteroides sartorii TaxID=671267 RepID=R9ICM6_9BACE  ali  12  7..............KKQLNKGRVSLYLNY-------SYNGKRRKEYLGIILDP-------------------------PTSAERRAENKNKILIARQIRAKKELEFLSVEYHLNDVENTFYDILPTDKSNVPDFYILIGQFLDTYHKKDKKMVRACITHLRLFTKKNLPVTLLTKDFCINFLEYLRD.. 148
237 8.000e-10UniRef50_UPI0006CFD192 hypothetical protein n=1 Tax=Marinifilum fragile TaxID=570161 RepID=UPI0006CFD192  ali  18  1....MATAKLILDTRKAKKDGT-------YPIKLAISHKSKTSYIRANFAIPEKYWDNGRIKRGCPDIENIRTANNKLASLLLD------ADDFIEELEERRRIDIMSVAQVADYIKNGGKQQQSA-VNFLEYMEKYVPTIKNN---STKEKYNTTLVKLKEYMGTELLFDDITKAWLNRYKEY..... 164
238 8.000e-10UniRef50_A0A1I2AUL5 Phage integrase SAM-like domain-containing protein n=2 Tax=Pedobacter antarcticus TaxID=34086 RepID=A0A1I2AUL5_9SPHI  ali  19  8...................NDRKSIVLDYSPPIKNPATGKLHRFETLKLYVYDDPAD------------------------QWERQYNKEIMMLARAVCAQRQLDIQNRRFGFISDTL-------RDSSFTDFFKVEARKKQQSFSDN----WGMGVRYFIAFAGHDL..................... 121
239 9.000e-10UniRef50_A0A2I9DU58 Tyrosine recombinase XerD n=24 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2I9DU58_9FLAO  ali  18  1....MSSIKIVLR-KKGLTDGT-------YPVCLRITKDRKTKYFNTIFKSTEREWDTHTGCFNKNNTNYIQNNRLL------LKIKDRALKVYADL---EFEREFFNLD---DFGQRFRVDSNPANDNVFPFWEEIVSELKLAGRMGNATMYEETMKSVKNFCGHKIKFQDITNTFLNKYEAWLRS.. 164
240 9.000e-10UniRef50_UPI000A04AC14 site-specific integrase n=1 Tax=Flavobacterium denitrificans TaxID=281361 RepID=UPI000A04AC14  ali  12  39..............................PMVLTLRSKSKKERLSLDIEINIDEWDKAKQR--------------LKPISVENQDINLILDNIESKLTQIKTSYRLSDRILTLEILKKEFLSGMPRIRFTAFYEMMLEEEKVMMEVGSYKRYLSVLKKLKAY-NDDITFIEIDQNWIDKFKKYLR... 179
241 1.000e-09UniRef50_A0A221UWH6 Site-specific tyrosine recombinase XerD n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A221UWH6_9FLAO  ali  14  1....MATINTILRKKSNKKG--------LLPIAVRVTKDRKSTFLYTGQYLDPKFWDEIKQKVKKSHPNSARLN-------------NLIAIKQAEANAILLDTAAKDGDHFSVQELKSQLTTTLTGHSFFEYAEKHFKQLKESKKLSRIDSERPLLKHIKDYMGGRLNFDQITVPFLRGLDSYLRT.. 163
242 1.000e-09UniRef50_A0A1X9U4Y0 Uncharacterized protein n=1 Tax=Photobacterium damselae subsp. damselae TaxID=85581 RepID=A0A1X9U4Y0_PHODD  ali  18  2........KIFIEKRTLKADGTRTLRLIYYTTKSNGSRQRKREHEVLDLFIY------------------------DKPKTPAQRKHNKEHLLLAETIKSKRLVEWQSQKHG-------FEDRTKRSASFIDYFQRQIDIKEQTTSTSNHSIWLSARN............................... 123
243 1.000e-09UniRef50_A0A1C0WM61 Arm DNA-binding domain protein n=28 Tax=Bacteroides TaxID=816 RepID=A0A1C0WM61_BACFG  ali  15  1MAKIENKTKENPKEQNKLSDGRISLYLEYYLGREEDANGNQVYYEDGKMQGKPKFSVKHNRR-----KENLNLYLMDKPRTPAERQQNKETLGLATKIRAEREQEFKESMLG-------YRLKKDCTINFLDYFQAYIDSYTKKDCAWCKLH..................................... 145
244 1.000e-09UniRef50_R5FN98 Tyrosine site-specific recombinase n=8 Tax=Bacteria TaxID=2 RepID=R5FN98_9ACTN  ali  15  1....MTTIKVKFRPSTVKERSGSIVYL--------VTHRRMVRQITTGYKIFPFEWDKRQSKVIC----------CDNERIDIIRPVIQGIRRDIEKLNRIINRFDNQHTEYTSDEIVAEFQRLSQSDTFFSYMDGVIMRLRQLNHIGTANNYRAALGSFKRFRNEDISIESIDHFLIEDYQAYLIST. 167
245 1.000e-09UniRef50_A0A0E2LU08 Site-specific recombinase, phage integrase family n=3 Tax=Bacteria TaxID=2 RepID=A0A0E2LU08_PORGN  ali  100  2...............................................................................................................YSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAP 79
246 1.000e-09UniRef50_A0A1V5YVM9 Tyrosine recombinase XerC n=52 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5YVM9_9BACT  ali  16  1....MASIKLILRNDKVGKTGEAPLYL-------RLIKDRKTKFISLGVRLQPNEWDEDKQRVKKNHSNSARIXXXXXXXXXXXXXXXXXXXXXKSQPSAKKLKEAIKG---------------KAATNFFEYSYARCEKQKTTLSPATYRNYVKYLNKFETFMGKEVYFEDINVTTLKDY........ 156
247 1.000e-09UniRef50_K0X561 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=K0X561_9BACT  ali  13  8...KVDKSPFKLRRRKL-SDGRESLFID-------RTVDGKHEYEFLKLYLVPETSVKAKR-------------------------ENAKTLRQAEEII------LAKTEDMVDDKAREEAAKDKSKMPLSDFIDLLMEEYKQRGQPS-YRHLRASRTKFEKFYPGA-RLCDMDKKFCTDYAEWLKSEP 152
248 2.000e-09UniRef50_A0A139L3X0 Site-specific recombinase, phage integrase family n=73 Tax=Bacteroidaceae TaxID=815 RepID=A0A139L3X0_BACOV  ali  16  47.KKQDMITSVKLMLNKSRILNNGS-----YPLVFQVIHNRRKKLLYTGYRVKEEVFDELEGKIMNGVGSTFTATEVVKMNRELRKMRNRIDTRI-------RQLERTREEFTVEDILAQAFGTGKPQFYLLRYINAQIERKQELKKVGMAAAYKSTRSSLAKFSRPDVRMSEVDSAFVRRYEDFL.... 220
249 2.000e-09UniRef50_R5NWX0 Integrase n=1 Tax=Paraprevotella clara CAG:116 TaxID=1263095 RepID=R5NWX0_9BACT  ali  13  1MGRQPNKLKQNPKLQNAMSDGRASLVLEYYLG----RTETPVYDDDGNPVLYTTGAMKGKPKYTVKHNRKKNLYIWLAPRTAQERQQNKNTLQLAEKIRFEKEQEMLEDRKGYRLKREKE-------CNFLRYFQSHTENFTKPVRKSYYYSYVRFTEYLGRFSKKILPMDAVTPDMVTGFINYLRK.. 187
250 2.000e-09UniRef50_A0A264Y5Z7 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A264Y5Z7_9BACT  ali  16  52.RKRNSKTKEPVRIRKELANGNKSVYLSI-------NVNGRRTYDYLRLYLIPE-------------------------VDAAAREQNKQTMQAVYAIKAQRIMSITNG-------IAGLKDKSRIKMRLVDWLEIFRDAQVERGRQSARNWVNSVLNAVRE-HSPNVTLAEMTKEYCNGFMVFLLN.. 198
251 2.000e-09UniRef50_A0A1G0AY09 Recombinase n=1 Tax=Flavobacteria bacterium RIFCSPLOWO2_12_FULL_31_7 TaxID=1798015 RepID=A0A1G0AY09_9BACT  ali  19  12...................NGMFSHYIEYYKGSQLDKDGKRREFEYLKEYSYQD------------------------PKTPAEKKENKNVEKLCDEIFTIKKTSYIQGK-------YDIKDTVKSKRRFLDYFVEKTEE--KVDSPKNYGNWTATLVHLKRCIAPTILFEDIDETFVKQIRVY..... 146
252 3.000e-09UniRef50_UPI000DB9E2DF site-specific integrase n=2 Tax=Chitinophaga TaxID=79328 RepID=UPI000DB9E2DF  ali  15  5.............ERLSKNGDKITFYYDY------GRKKGQRP--STGIFIYT------------------------HPKSREEKIHNKQARALIDVKKSQKTIE-------QQAIGSAYIPPHKFKANFLDYYDEYVEKNKRDGNR----HLSNSFTQFKEFLKKDISPIEVTENLCKEFRRYLLD.. 136
253 3.000e-09UniRef50_UPI000D70E894 hypothetical protein n=1 Tax=Prosthecochloris sp. V1 TaxID=2017681 RepID=UPI000D70E894  ali  16  3.........VSIRL-KNISKGRQSIYLDFWPPVLN-SQGRQSRREFLKLYVYQ------------------------KPTTPQQRKHNRSTLKLAEKVRAEREIEIQEERY----------NGRRDDTTVIDYLCAEAQRRKQQ----TAKIWNNMIFHAQQHFPEHVQIRSLKVTDCIGFRDY..... 137
254 3.000e-09UniRef50_D3I011 Site-specific recombinase, phage integrase family n=6 Tax=Prevotella TaxID=838 RepID=D3I011_9BACT  ali  11  21............................FYPIMLRITRDRVTRRVKTGLEVKKADWNQQAKHHKHFRSSYHNAEASNDILADILAKYDGTYKELRKEGVASSENIIQKVKTGEVSE------------SFLQYAKDRTQEIYDAGGVRNWKKYNGFCNKLEAFLKKDVSFSEITPSFLSKFDNFLHKLP 173
255 3.000e-09UniRef50_A0A1Z5HMI0 Recombinase n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1Z5HMI0_FLAPS  ali  15  1....MASIKLILRTHQADQTGHSPLYIRI-------IKDRKTKFITAGVKLKESEWDETKQKVKKNHPNSARMXXXXXXXXXXXXXXXXXXXXXVKTISIKKLKEAIKG---------------KEVPNFFEYAYARCEKIKGSVSFGTYKNYTLYTKKFENYVGKDVYFDDITVSVLKDYMAHM.... 160
256 3.000e-09UniRef50_A0A0Q5TII6 Integrase n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0Q5TII6_9BACT  ali  13  1....MATIKAVIKPDKKKDG--------TYPICIRITKDRKTNYEPVGYSATSEQWDAAQGLVRKNYPNSVRLNALIAKRXXXXXXX---------------XXXXXXXXXXXXXXFIKKSTKKAKAATFFIQAELYLTGLKNAGKYNQYTADKPRVKHFKEYLKRDVPFQEIEVSTLEGFKTYVKNT. 161
257 3.000e-09UniRef50_W1I476 Uncultured bacterium extrachromosomal DNA RGI00249 n=1 Tax=uncultured bacterium TaxID=77133 RepID=W1I476_9BACT  ali  18  14.........VKVRFRKLR-NGNKSIYLDVY-------ENGERRYEFLKLYLIPQTSTKA-------------------------RQQNNYTLQIADTLKGQRLKEILNGKAGITNNTKG------KNVVFSDFINAYIKKKKKQGN-SAWKMARWLLLHLQAWKMDGVKLGQIDKQYCLRVLNRLR... 150
258 3.000e-09UniRef50_A0A060R7J9 Tyrosine type site-specific recombinase n=2 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060R7J9_9BACT  ali  12  14.............................YPLVFQIIHRRQRRLIYTDIHLFDDSFDDEKQQIISSERQHFK-RTELSKMNESLRQIRREIESMIEYIAAK-------TTSFTVDNITSLYNRRKGYIYFFTFLECVIEQNRTLEKFGTANNYQSTLRVFEKYLKDKLKFTDVDQKLIKEFDIFLQK.. 164
259 3.000e-09UniRef50_T2KQQ1 Site-specific recombinase XerD n=21 Tax=Bacteria TaxID=2 RepID=T2KQQ1_9FLAO  ali  18  3.....SSVKVVIRKKPNEHKE--------YPLAIRITKERKSSYHYIGQYILLEHWDKRNNRVKKSHPYADNLNSLLLTKIA---EANKSLLNLQEEDCDISSSQIKEKLYTTQS------------FNFFDFSNTYLEELKVNNKLTRLSSEKAYLGNLLKFNKKNLTFKEINVKYLNQYKTFLKS.. 162
260 3.000e-09UniRef50_I9FPV6 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=I9FPV6_9BACE  ali  14  1MAIKIQEPTLFLRVDKKKKDGRMPIYIRF------QRIDGKEPKFPLGISCLPEKWDKAGKHILDNDGSDILLQEELN--------RIKKAIRSAEIDEIEITVDILRE----IVSRKEEKANKPENQSFYYYFEEYISKKKNIGEMGTVKTYHTTIRALKEFRSE-IRIKDISTKLLDDFDKFLIK.. 170
261 4.000e-09UniRef50_A0A1H8SZW7 Site-specific recombinase XerD n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1H8SZW7_9SPHI  ali  14  24....MASVRVRLRDRE-NSDGEHSI-------LIQIIKDRKKSVITLRHSVKLKDWNAKEGTVKKSHPNSTWLN-------------NLIAKQVAEA--SDKLIQLEVNNTDTSAHVIKRAVKAAKDNTFFKQADLYIARLERAGNFNRLSAEKPRVKRLKEFVNNDIHFQEIDTTFLKDFKAWLKGT. 185
262 4.000e-09UniRef50_UPI000D6BBA50 site-specific integrase n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6BBA50  ali  18  2................................VRTWERKGKKRFTYLYI---------ATCIHGRKTSFSMKLKLYKNPKSAKERQHNKDIRLLAEQIRS-------NEEKKLLMYGYGYLDSSRNKVNFFDYAIKIVERKGN----SNQQVYLSALKSLVVFNGDHLLFGEVNSLFLKKYRDFLLN.. 137
263 4.000e-09UniRef50_C3QQU4 Site-specific recombinase, phage integrase family n=19 Tax=Bacteroidales TaxID=171549 RepID=C3QQU4_9BACE  ali  14  6.KSLIEKSPFKLRHRKL-ADGRLSLFLD-------RSVDGGHEYEFLQLYLMPETSAKA-------------------------RRQNAQTLRKAEDIQRERTEALLNAKVGTVPES---KSSDMLLSDWMTIVRKNHEHREARDLNGIDNARKNLLKF-----RADVRLCDVDRQFYIDYIDWLRSS. 151
264 4.000e-09UniRef50_A0A239XRB7 Site-specific recombinase XerD n=1 Tax=Sphingobacterium mizutaii TaxID=1010 RepID=A0A239XRB7_9SPHI  ali  11  4......TIRFSLRTDKKLKDGR-------CPIQMIYSIAGIRSVYNTKLTCLEAYWNKDEQMLQVVNKTALKGYFSNTILDKVQIDEFNNDLNLLKGNVLNIERAFHGKEISSSLVIEQLKLQSNPNIDFIDRYIQENQATRVKGSLKVYGTLKKHLQNFEIYRKKKVTFGEINYSFFQEFRAYL.... 185
265 4.000e-09UniRef50_UPI00041E05F8 hypothetical protein n=1 Tax=Runella zeae TaxID=94255 RepID=UPI00041E05F8  ali  11  1....MATKKVYIDMRRPLQLGQYPLYL-------RVTKDRKSRYVSLGFSCKKELWDEANNLPKKRHPLYKEITIAIE---KAKLEANREILNLHNGDQDFSTEELKNNL---------LADKRKSKLTVFEYFDSYVGQLKANDKIGSANIYHSTKKSIMDFRNGDMEFSDVTPS............. 154
266 4.000e-09UniRef50_H1Y3I4 Integrase family protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=H1Y3I4_9SPHI  ali  12  1....MASLRVVLR-KKANKDGT-------YPLAIRVTKDRKTSFIHLGHHLHAKDWDAKGQKVKTSYPNSKRLNHLILTKTAEAND---------------TLLELETHNKDISSKLVTAEIKPKAATSFFAQADIFVENLRTQGKYNRVLTEQSRIKAIKEFLGNDVTFPEVNVPLLAKLSAWLK... 160
267 4.000e-09UniRef50_UPI000A375E3B hypothetical protein n=1 Tax=Arenibacter sp. AK53 TaxID=1406873 RepID=UPI000A375E3B  ali  14  1....MATVKALLWKRKNKAGE--------CTIAIRITKNRKSTYIHTGQKIKPHDWDEVTSQVKKSHPNSKRLN-------------NFIASKIIEANKSLLEIETESNNNIQIADIKRTISGKHKSHSFYEFTEFYFQELGRNKKYSRINAERPLLNRIKRYPKKNLTFEAITPQFLRGFISYLRSS. 164
268 4.000e-09UniRef50_A0A271IWH8 Uncharacterized protein n=1 Tax=Rubrivirga marina TaxID=1196024 RepID=A0A271IWH8_9BACT  ali  12  1....MATVRPVLWAHKTNRHGHHPIRLRFADASGSL-------YLSVGAYVHPRHWNGRAERVRKTHDLYE--------------EYNRLIETKLNAAERERLRLLTIGEVPTAAALKAAVVGKGYTDCFLDFVQGHLDVVEEQGNVGRVRKERAVMAKLEAFGGSPLPFRRLTPAFLDRWTAWLLT.. 162
269 4.000e-09UniRef50_A0A1B6YAJ1 Uncharacterized protein n=1 Tax=Balneola sp. EhC07 TaxID=1849360 RepID=A0A1B6YAJ1_9BACT  ali  17  7.........LYLRSDSPRKNGE-------YPIYLRITSNRKHKYLSTGISVFQKHWNSDKEVIRKTHPSYKALNKTLSIKLSEAKNAQAELITYGKD----------------NAKSIKARLKVIDETDFFSFAEDYLKLKQRNGKHSQYVQGVVAFNKIEEFEGERLRFNQIDSEYLKSFQDFLIN.. 162
270 4.000e-09UniRef50_A0A1Z9FQ66 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TMED135 TaxID=1986673 RepID=A0A1Z9FQ66_9FLAO  ali  17  19................................YNLIVVKSKKNWYYVIDSYEGSWIDDNGKKKQKRKRRSLGMTIYPKPKTPIEKEHNKKMKMFAEEMVAKMNFDYIT-------RNHSLSNNERRTELFIDYFDNYIK--HKGTSPSDLSVYYTLRGHLISFRGDQQRIQDIDYAYCRDFIGYLTN.. 164
271 4.000e-09UniRef50_A0A2S5A368 Uncharacterized protein n=1 Tax=Solitalea sp. HR-AV TaxID=2079460 RepID=A0A2S5A368_9SPHI  ali  15  1....MATLKLFLNTQKRNKQDEAPLYLRI-------IKDRRSKYISTGIYIKEKDWDNKNRRVKKSHPNSVRINHVIANKLLEAEGQ---------------IMEIQLKDKYADTNTIKRILTGQDDLMFNQFSDYYKKSVEHKYKIATLNKLDTAIKRIKEFNNNDLYFHEINVAWLRSFESFLRT.. 162
272 4.000e-09UniRef50_A0A1M6QYE4 Site-specific recombinase XerD n=2 Tax=Fibrobacter TaxID=832 RepID=A0A1M6QYE4_9BACT  ali  18  6........RITLSARPLRTGGK-SLYLDY-------RVDGKRIRENLQIFLVPE-------------------------KTAADKVKNQEAWRLGKALRDKRESELNMAEAGIK------LPPRPQRTLFADYFPKVLKEYK---NPRTKFNMQDCARKVIAYR-PNVLVAGIDREFMQGFINHL.... 139
273 4.000e-09UniRef50_A0A2N7BH09 Uncharacterized protein n=1 Tax=Siphonobacter sp. BAB-5405 TaxID=1864825 RepID=A0A2N7BH09_9BACT  ali  14  3.....TTVKFYLNSDQPLQNGELPIYVRL---------TKDRKHKYIALSAKSCTKDQWDEKLCLPKKNHPHHKELTIAITQLRLHIQKTILNYENEGREYSLEEL---------KLAAFSDRTKRSITVYNYFEDTIRTQLQSARVGNSNVIRSTYNKLKIFRGKDLEFSDITTQFVKRYEDYLQ... 166
274 4.000e-09UniRef50_A0A1A9I4S9 Uncharacterized protein n=17 Tax=Bacteroidetes TaxID=976 RepID=A0A1A9I4S9_9BACT  ali  12  4.......................................GRRKNAKGDKYLYYYDNGRGKGQRPSMGLFLY-----VKPQNAAEKQHNIETKALIDVKKGQAILDQQS-------VGTGFIPQHKFKANFLDYYADYVEKNKRKGNR----HLQNSFTQFKIFINKSVAPIEITENLAKRFRRFLLD.. 136
275 4.000e-09UniRef50_UPI000D6D26FE site-specific integrase n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6D26FE  ali  23  1....MVKYKVTLRQKPIEKGKKASLFLDI-------TFAGNRFKEYLKTHIFTPATDK------------------------IEKEYNQRMINKAEIIRLERIKELKHSALLENED--------KKFLTFLEYFAQQILKRDQDKSSSTWKSALTCL--LRIEWLQDLQLEHIDYKVLDNIKQYLLH.. 142
276 4.000e-09UniRef50_UPI0004E71AB5 hypothetical protein n=2 Tax=Pectobacterium carotovorum TaxID=554 RepID=UPI0004E71AB5  ali  21  2........KISIEKRQPDREGKRSLRPAHYYGIEDGHRQLKRLHEPLNLFVY------------------------DKPRSPAEREHNKEALRITEAVRSKRLLESETSKH-------KLEDRNKLSASFLDFYHAMME-AKTSGSKSNYSIWVSACHHLK............................ 124
277 4.000e-09UniRef50_A0A255TUH3 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=A0A255TUH3_9BACT  ali  21  7...AYKKEPVRLQLRQ-RAGGKQAVYLEFY-------KEGVRTYERIPDLVIVPETDQKAIK------------------------ANQAVLAKAEKICRQRKREMLKAQKQQGLVVESEKQERKLSMDWIGRYEEIQKNRGVRD----LNSIRSLRRFLSLYRNERVALEDVDIPYCLGFIAFLKTG. 156
278 4.000e-09UniRef50_A0A2T5J5J0 Integrase-like protein n=3 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A2T5J5J0_9SPHI  ali  14  1....MVQLKIVLDTRRQKSDGT-------YPITFRVTDVKKVLYIQFGTSVLADMWDIEQRTIRKNHPNALLLNTALSKKFYQIQKAIKDLVEDGN-----FSFDTLKQCINSSSEIKKAKPILP---SFKTYADKLIADLYKSKKIGNAIVYKTATNRLIKYTNPNLKFIEINYQLLDEFKNHLLSS. 169
279 5.000e-09UniRef50_R7CWC4 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=R7CWC4_9BACE  ali  18  3.........ITVEKRKL-AGGRVALYLNF-------SFGHKRWRESLHLTLE-------------------------DPVDTATRKLNREKMKMALAVRSRRELELITERSGIRT------TKGNAHTDLRDVCTAFIAQYRRKD----IKMVQAAFAQLVRFTANRLYTWRIDRTFCLKFYDYLR... 137
280 5.000e-09UniRef50_A0A1Z5SJX6 Integrase n=2 Tax=Chitinophagaceae bacterium IBVUCB1 TaxID=1985173 RepID=A0A1Z5SJX6_9BACT  ali  18  3.....TSVKIVLR-KKQNSDGS-------FPLAVRITKDRKSSYVYLGHNVHESYWDKTNHRVKKSHPNSVRLNHFLTTKXXXXXXX---------------XXXXXXXXXXXXXXTIKRKIKGTKEASFFAQAQLYLDSLKKQGKYNRENCDKSRIKVFKDYLNSDIAFQDITVSLLMRYRAYLR... 161
281 5.000e-09UniRef50_A0A1G7D149 Site-specific recombinase XerD n=4 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1G7D149_9SPHI  ali  20  2.........VTVRYKKL-SSGKFSAYLDIYSNAVEG--KGKRNYEFLKIYVGKDYSVPGTRIT----------------------ESDKDNLKIINALRNKRENELNFSDHG-------YKQPIKVNYNLLDYFDQCLAKKFN-------YKLECLIIHLKRYFPKDVLVQDVDEDLLDNFQSYLLN.. 141
282 5.000e-09UniRef50_W2CYL9 Uncharacterized protein (Fragment) n=1 Tax=Tannerella sp. oral taxon BU063 isolate Cell 8/11 TaxID=1411915 RepID=W2CYL9_9BACT  ali  18  1................................................................................................................................DFLAYFKGLADRKNIK--------WQHVYKHFQRFVNGKCTFEEVDVDLCRKFMEYLLDAP 53
283 6.000e-09UniRef50_A6KZW4 Putative integrase, tyrosine type site-specific recombinase n=34 Tax=Bacteroides TaxID=816 RepID=A6KZW4_BACV8  ali  11  7..............KKQLNKGRVSLYLNY-------SYNGKRRKEYLGIIL-------------------------DAPTSAERRAENRNKVLIARQIKAKKELEFLSVEYHLNDIENTFDDILPTDKSNVPDFYILIGQYLDTYHKKDKKMVRACITHLRLFTKKSLPITLLTKDFCINFLEYLRD.. 148
284 6.000e-09UniRef50_I8YJZ3 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=I8YJZ3_BACOV  ali  15  33.....NRPKEPIKLRVKILSNSLSLYLDLY-------KDGKRQYEFLKLYLNEETDLSV-------------------------KEQNRQTLEVAYTILHEKIAELNKRGAGF--------ISPKGKVNLIAYILYQADEALKRNKHGYYYTLQALAKHISLYSGDDTQLKQVDKDYIKGFISYLKTA. 177
285 6.000e-09UniRef50_A0A1V6EBY8 Tyrosine recombinase XerD n=1 Tax=Spirochaetes bacterium ADurb.Bin110 TaxID=1852908 RepID=A0A1V6EBY8_9SPIR  ali  22  3.........VAIRKKHNK------LYLDIYY-------KGRRRWESLGLSL------------------------------TGDKQQDREALRLANIARVKREQQLFSQEWGI-------LDPVGSKKHLLDYCQEIAQSMPPR------RHLHKAIPYIKEY-GGNIRLDAVDEQWLEGFKAFLLS.. 123
286 6.000e-09UniRef50_A0A174PSV2 Tyrosine recombinase XerD n=3 Tax=Bacteria TaxID=2 RepID=A0A174PSV2_9FIRM  ali  17  2........KIELRSRKHKS-GNTTLYLEFY------EKGGKRQYESLNLYLIPEMTDN-------------------------DRRVNEATLKKALKIKSERILGI-----GSKSEEKDISTPATEFSKWMDEYLLHLQKGER-YSLAYQNHMRSTVNIVKSYNRPSLMMDKVDKSFYKNFLTYIKD.. 146
287 6.000e-09UniRef50_A0A2N8NBX2 Uncharacterized protein n=1 Tax=Tannerella sp. oral taxon 808 TaxID=712711 RepID=A0A2N8NBX2_9BACT  ali  18  2......NIRITTDERRKRPDGKVPLYLAF-------SGKGKTAFHGLGIYVHPSEFDKETYTVHTADRRRKADFTRYNLFIQSELTRARNML-LALQVAGK-----AAGMLPARFKAMFAAGQTQGSVTFTEYFKTFIERKTGR----TREVYQGTLDKIIRLSGDDVPFEAINYAWLEAFDRSMRTA. 166
288 6.000e-09UniRef50_A0A0B7I0N4 Uncharacterized protein n=1 Tax=Capnocytophaga canimorsus TaxID=28188 RepID=A0A0B7I0N4_9FLAO  ali  21  16........KISLFQRKLKD-GKVSLFIEYYRGSKDGKRRHLREYENLKLYLHQ------------------------NPTSKEEKKQNEETLQLAENILAIRKTEYIQGKF-------DIKNTAKAKRIFLNYFSELAEENRK.............................................. 121
289 7.000e-09UniRef50_R6YA26 Transposase n=1 Tax=Alistipes sp. CAG:29 TaxID=1262694 RepID=R6YA26_9BACT  ali  12  19.............................YPLVFQIIHNRRKKVLYTNYKIRESDFDPVSGKVRADDSRQLSDRSAQR----MNRALNRERKTLLSKIAF-----YEEHGIDFCVEDLDNRSSRQHNVHLLQYMNKQIREKILARRNGTAAAYKSTHSSLQKYLGKDVRASEINPMFVRKYEEFLRK.. 168
290 7.000e-09UniRef50_A0A258YP63 Uncharacterized protein n=2 Tax=Sphingobacteriia TaxID=117747 RepID=A0A258YP63_9BACT  ali  19  3.........VLLRKRK-NADGSISLRLDIY-------NNGQRSIETLK------------------------HLKLKKVSNVADREINKHYLQQAEAIRVTRAAELEANSYNMASDAGKKTIVTVWMQNYID-------GYTKKDKRNLEGALNRFKDYLAEIKKQGLVFGALTSLHIEDFIDYLE... 140
291 7.000e-09UniRef50_L0JBQ5 Uncharacterized protein n=2 Tax=Prevotella dentalis (strain ATCC 49559 / DSM 3688 / JCM 13448 / NCTC 12043 / ES 2772) TaxID=908937 Re  ali  21  1....MQCCKVNLRSR-DKRNGLKSLFLEFYPGYRDPETMELRRRRALGMYIY------------------------AQPQTAAEKEYNRQIMEKAETIRIQVYLEVLN-------ERYGFFSKDKMKESFLPYFEEQLRKTNTKS............................................ 110
292 7.000e-09UniRef50_A0A1Z8UPN1 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TMED68 TaxID=1986718 RepID=A0A1Z8UPN1_9FLAO  ali  16  22......................................NKKVKRGYILRFNYGSVDGKQIRK-----DVYLKTDFNHEPKNPFDRQQNTQAGKDANAILDAVKTMIREGKYPI----IGSHSLKDSENNFIDWLFKTTQENKK-YSDNTKKSYRALVNHIKKFAGNRLPFESIDKSFVARFYDYLK... 159
293 8.000e-09UniRef50_A0A088F996 Recombinase n=21 Tax=Bacteroidales TaxID=171549 RepID=A0A088F996_BACFG  ali  18  3.........ITLRQKDLENDNK-SLYLDIY-------DNGKRKFEFLSLYLIPE-------------------------INQETKERNEATLKRAQEIRAERILETIPEKGHLMVVPDIPDDDSPEVIDWIQTYMEWMDEYSKRTVEQTQYLQERMKEFLKAKRRPHITLMKFDKTWFKAFFLWLKN.. 152
294 9.000e-09UniRef50_UPI0008F476B6 site-specific integrase n=1 Tax=Maribacter sp. 1_2014MBL_MicDiv TaxID=1644130 RepID=UPI0008F476B6  ali  17  1....MASIKLKL-KNKANSNGE-------YPIVLQIIKNRKVKIISLGVFGNPKTWDSKEGLFKSNHNNAIILNTKL-----------EKIKLKARLILLEFEEEDIN--FTLDEFEAKFRTASNETLSVFEYWNEIIAEMESSEKFGNADVNKDTKRSLSKFHGEKLFFSQISVYFLEKYEVFLRS.. 163
295 9.000e-09UniRef50_A0A1G7IT34 Site-specific recombinase XerD n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G7IT34_9FLAO  ali  12  1....MATIKALLWKKENKAGE--------CTIAIRITKNRKSTYIHIGQKIKPKYWDDVTSKVKKSHPNSARLNNFISSKVI---EINRTLLDLESEVNSKKQIAEIKKTISGKYESN----------SFYAFAEAYFDELEKNKKYSRINCEQPLLNRIKGYRAKTLTFQEITPLFLRGFISYLRST. 164
296 1.000e-08UniRef50_A0A1R4KUX1 Integrase n=2 Tax=Sphingobacterium sp. JB170 TaxID=1434842 RepID=A0A1R4KUX1_9SPHI  ali  16  1................................................MDIYPPIYDEKKK--KETRRKFLDLYLFEKPNNKIEREHNKFTVVKAKEIESEWQMDLLGQTLNMPFISSK-------DLDFLAYFKSIVKKRY--TSKGNYDNWLSTYNYLEDYTKGQCLMSQVDETF............ 118
297 1.000e-08UniRef50_A0A258WKA4 Uncharacterized protein n=2 Tax=Sphingobacteriia TaxID=117747 RepID=A0A258WKA4_9SPHI  ali  10  1....MVQLKVLLDKRTQKSDGTSTIY-------FRVTENRKVFYLSTGYSLEAKYWDDNKGTVKRTYPNAQSINASISKKYFDIQKA---------------IIELEDEGIFSMDSLKEKLIPRPSLVTFKQFADMTIEELYKKNRVGNAIVYQTGVNSIFKFKPKELRFTDISSQFIERYIDYL.... 160
298 1.000e-08UniRef50_A0A2A4Q8V9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4Q8V9_9BACT  ali  24  2........RVTLRERKHKN--YISFYLDVYY------SQGQRDRVTIK-----------------------GLQKILNPKTTEDRQRNKDVQRKAEIKVAQLRNEYENQLLGI--------PTPKPRASFIKYADQISEAKAAAGS--YRDKLDAIIVQLKKYAGKDILFEQINENWMENFKSFLLK.. 140
299 1.000e-08UniRef50_A0A1N7KTS9 Recombinase n=1 Tax=Chryseobacterium piscicola TaxID=551459 RepID=A0A1N7KTS9_9FLAO  ali  14  1....MASVKLILRTTQESQTGHCPLYI-------RVIKDRKAKFLTTGQKLKPSEWDEAKQKVKKNHSNSARLNAYLSQLIADAEGQVADVSRKNESVSAKKLKEAIKG---------------KESTLFFDYAFKRLEKINGSISILTHRKYRTHLEKFKKYVGEKFYFEDLTTVLLNDYITY..... 159
300 1.000e-08UniRef50_UPI00039CEA57 site-specific integrase n=1 Tax=Gracilimonas tropica TaxID=454600 RepID=UPI00039CEA57  ali  17  56....................................................................EPKHFKNGEVTKSFNGWAKINQRLKNLENQYWDRVFELEKMGDYSVDEIVNTKTPTKESETFISYARDYNKKFKIQNSPNSFRRHKTVINKLEEYSGSDLKFRQITSTFLKKYIAHLHD.. 174
301 1.000e-08UniRef50_Q2S3L4 Phage integrase family protein n=1 Tax=Salinibacter ruber (strain DSM 13855 / M31) TaxID=309807 RepID=Q2S3L4_SALRD  ali  11  1....MASLTIQCRTERTESNG-------YAPVRLRISHSGKRKFVSLDLDVLASKWNDDRQRVTRSHPDSSRINARLSEVESVAQRAVSRLQSAGEVITASRIQQVVKEELFGEEEESGY-------DDFIAFAWDEVEAYRRRDQMTTFRHYRTGIRKFLGFLEDELSFDALTVQLIREFRNHM.... 176
302 1.000e-08UniRef50_UPI000C9A8763 hypothetical protein n=1 Tax=Akkermansia muciniphila TaxID=239935 RepID=UPI000C9A8763  ali  25  3.....TCTKVFLRKR-PYAGGKLSLYLDYYPAIRNPHTNKMTRRETLGIVIF------------------------ANPTNEMQRRFNQEMEEKAEAIRCIR....................................................................................... 74
303 1.000e-08UniRef50_A0A1I2GDW7 Site-specific recombinase XerD n=1 Tax=Spirosoma endophyticum TaxID=662367 RepID=A0A1I2GDW7_9BACT  ali  14  3.....TNVVISLDTRRQKKDGT-------YPLIMRLGHHENTTSIPLGISIGEKDWDEQKRRVKKTYTGVSSITRLNNQIQKVKSDAMDVIFKLHESGVLQ---------TLSITSLKDRITQKDARDSFFQFATQCEEELIKAHRIGTARSYKGLISVLKDYRGKDLLFKEITYDFLSKFEIH..... 166
304 1.000e-08UniRef50_A0A246AJP9 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium JJC TaxID=512012 RepID=A0A246AJP9_9FLAO  ali  12  1....MATLKFILKTQREDKAGHSPLYI-------RVIQNRKTKFISTGIKLKASQWDQDAQKVRKNYPNSTRMNVILAQKIADAGMMVLEEEKKTKNLTANEIKKALKGEDGLK---------------FFPYKDKVFGRLENTLSVNTMYNYKQLLKKFSEFANQELLMKEVDVALIKDYMNYLVS.. 162
305 1.000e-08UniRef50_A0A271IVD1 Uncharacterized protein n=1 Tax=Rubrivirga marina TaxID=1196024 RepID=A0A271IVD1_9BACT  ali  11  3.....ASVKLVLRTQKTRADGLAPVYL-------RATANRKSRFTSTGIYVRPRDWNDRRQEVRSSCDLADAYNR-----------------RLGELLNDARSAALDASSAGTVVAALTGPAGSATG-----YFERHVGRLDEAGRYWQHKHFGVTLGHLRAALGQDVLWAELDRDALGRFEAHLRNAP 161
306 1.000e-08UniRef50_F8N8W0 Integrase family protein n=5 Tax=Prevotella TaxID=838 RepID=F8N8W0_9BACT  ali  11  18...............KELADGRHSLYLLYNYGYNSDNGKTARKKEFLKLYL------------------------VSTPRTPIERQQNKDVLELAQKIKQERGQQFLNDREGYRLKQKG--------INLFVYFANFIEQSGVADKHVLEGALKNFQDFISEEYPNRIEPKNLSREMMERFAHYIED.. 160
307 1.000e-08UniRef50_A0A090WZW4 Integrase n=1 Tax=Algibacter lectus TaxID=221126 RepID=A0A090WZW4_9FLAO  ali  17  4.........VTLRY-KEIANGKKSLYLDYYPAIINPATGKETRREFLKLQIH------------------------SVPKNEMEKSHNKETIQFAELVRSKRLIQIRDKEYG-------FKENINFSLNFVAFYQTIIEDITIK............................................. 106
308 1.000e-08UniRef50_A0A015UYX3 Phage integrase family protein n=3 Tax=Bacteroides TaxID=816 RepID=A0A015UYX3_BACFG  ali  13  2........RIEIRTRELK-NGNRTIYLDYY-------DKGKRWYEYPKLYLVPD-------------------------SAPHAKDLNKNAMDKAIAIRARR---LLGETPEEDGSPLKEADKILVSAWMDEYAKAMHANAGLSLTYLKHTLIRMVNDYLAHIKSPRLTMDCIGREFYRGFLHYMAD.. 146
309 1.000e-08UniRef50_A0A1G9B3B3 Site-specific recombinase XerD n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G9B3B3_9BACT  ali  16  10......................................KKSKVRSDGLAPIYLIFRQPPHPERLVNTRKYIEPKYFDNKSGTCKRGSNNNAFLTAEIARDELVLDLQKRRQPVTIERVIQLYQQTHPDSFLAFCQEELNLMRGVLSDSTVEDYAYCLSNLEKYR-PDLTFGELTYDFLERYRYYLRN.. 162
310 2.000e-08UniRef50_A0A1M4UGG1 Phage integrase SAM-like domain-containing protein n=4 Tax=Bacteroides TaxID=816 RepID=A0A1M4UGG1_9BACE  ali  13  13...............KTLSNGEHPIMLRVC-------KGGKKKYISLGISVNPKFWDFEKNKPKRNCPN----------REQLIKVINEQEQKYAEQILEFSVE----KREYTPTTLIEAIVPVQKARTVGELFNEYIAQLKDEGRLGYALSVQQVYNSLLKYKGHDIYFSEIDVNWLKAYESWLR... 163
311 2.000e-08UniRef50_UPI00035C91B2 site-specific integrase n=1 Tax=Gracilimonas tropica TaxID=454600 RepID=UPI00035C91B2  ali  15  3.........IKIREKDLKS-GKKSLYLDIY-------HKGKRNYEFLKI-----------------------------GHLTGDKNKDEEIRDKAKAIKAKRELQIFNETYDFDKKDDDLLFT--------DFMQIIADEFEKKGNRNVS----TVLFHVREFGKDDISFRGVDEKWIKGFKDYLLD.. 131
312 2.000e-08UniRef50_A0A0F9R7E5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9R7E5_9ZZZZ  ali  13  1....MATIQVVLRKKPNSAG--------LLPLAIRVTKDRKSSFLYIGQYIDEKFWDSKYNRIKKSHPNSNRLNKLLAKKLSEAND---------------KLIDSDAEGIGQSAKKIKKKIVGKTKMNFFDASEIFLENLLKRNKFNQHYNQEKRLDIFKAFLKKELLFADLDVTLLRGFEAYLL... 160
313 2.000e-08UniRef50_A0A1M5C6W5 Site-specific recombinase XerD n=2 Tax=Aliifodinibius roseus TaxID=1194090 RepID=A0A1M5C6W5_9BACT  ali  22  3.........IKIREKKL-SSGKKSLYLDI-------HHNGERSYEFLKIYLTGDEKDKEKR-------------------------------RKAEIIRGRRLEQIQNQTYGLKTD--------NKEASFYQFFQKIVDKNKEKGIRN----HEAVMKKIKEYHGETLQFKQITKRWVWGFRDFL.... 128
314 2.000e-08UniRef50_A0A0Q9ZBU5 Uncharacterized protein n=2 Tax=Salegentibacter TaxID=143222 RepID=A0A0Q9ZBU5_9FLAO  ali  14  1....MVHLKAILHPKKLNKTE------IIYRLALRVTSFRRRSYFHLGYNIDPKDWDEKAEKVKKSHPKYQHL--------------NRLIRKKYDQLDDIIYEAERNKKQLSAKQITDKIRSNKNNNSFFALAKEHGEDLEKSKKFNRAISDRSKAKIIKDFTGKDVLFPEIDESFLRRFKVYLKN.. 164
315 2.000e-08UniRef50_A0A0S1SFA1 Recombinase n=20 Tax=root TaxID=1 RepID=A0A0S1SFA1_9FLAO  ali  15  1....MATLKTVL-HAKLDKKGNKLHRL-----ALRLTVNRKRSYYHLGQKLKPEYWDERSEKVKISHPKH--------------KQLNRLIRKKYDEVEDIIFELESSKQNYSAKQVVDSIRKNTRRLSFFELADEHIEDLFKANKHNRAISDRSKVNRIKEFVKNNLSFEEIDEHLLKKMKIHLLNT. 165
316 2.000e-08UniRef50_A0A1G1SW91 Uncharacterized protein n=3 Tax=Hymenobacter TaxID=89966 RepID=A0A1G1SW91_9BACT  ali  14  3..........................LDYY-------EHGKRYKKLLQLYVNP---------------------ADKTSRNSILRNAYDETYRQALLLRNQEEQRLIRGEHDLPPVAVRDK-----RASFLEYYDRMAATRNAN--------WRSVHNHLHAFTKGTLAFGDVTEEWVARFQDYL.... 120
317 2.000e-08UniRef50_A0A212J3Q5 Uncharacterized protein n=1 Tax=uncultured Dysgonomonas sp. TaxID=206096 RepID=A0A212J3Q5_9BACT  ali  13  21..............................PLSIRLTQNKKRKYIRIGINIQPQYWDSKKNKLKPNCPDREYLDNIITEKLSKYQKQILEFQSIAKE--------------YSINQLIESVERPTKNISINDYLNSVIENLTKENRIGNATHYQALYNSLERFTKNQLQFVDIDVPFLNKYETHLRN.. 164
318 2.000e-08UniRef50_UPI000B4AE5DD site-specific integrase n=1 Tax=Robiginitalea sp. O458 TaxID=1982593 RepID=UPI000B4AE5DD  ali  19  3.........VQLRSRKLKSGDR-SLYLDI-------HHQGDRWREFLKIRLSPKDPDRTEKK------------------------------RIAERMRANRELELLSN-------ATGHIPAHLTNMNFFVFAENYLSNYPFKDVRIVQ---NAVQKFKLAMGNSRLTFSQINPKVMEAFKDYLIH.. 132
319 2.000e-08UniRef50_A0A2G2ESG6 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2ESG6_9FLAO  ali  13  14..KNYFKVRLVLRKDKRRNDGKCAIY--FYPNL-----NGREFKLSTGKWLEISNWDFKQRKPKSNCAN-------------LRRTLNRELMDIED-----FYSDRIARNKTVTIEMVKSFYRGVDEQDFYPYYDKFLTLKKRTEKESTVKSYIGTLNHLKKFRR-RILINEIDVNFIEAFDYYLR... 171
320 2.000e-08UniRef50_A0A098LDV8 Site-specific recombinase XerD n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=A0A098LDV8_9BACT  ali  12  1....MATIKIIIRK----ENGKIRI-------NSKGESAIFIQYGHLGKSILFPTSIKVDPHFLKFNNKDLDQREPIRKSLPGYSVKNSNIRKLADHIKDRLINQDIVPTVEEVRRIYNQKHKPEEIKDFFTVYEEFINENRAVKAGNTIKQYITSFNHLKKFSKDKIRFEKIDLRFYDKYLNYLIT.. 178
321 2.000e-08UniRef50_F0SEC4 Integrase family protein n=9 Tax=Bacteroidetes TaxID=976 RepID=F0SEC4_PSESL  ali  11  1....MASIKLVLRTQQEDGTGQSPIYI-------RLIKDRKAKFVTTGVKAKASEWDDEKQRLKKNYPNSARMNAFLTQKVADAQAQVADVERTRKSVSARKLKEAIKG---------------KEDPNFFNYCDRRLEKIKSIVSYRTADIYNIYIKKFEKFIGHDFYFSDINTTLVGDYANYCKKT. 163
322 3.000e-08UniRef50_D4IK47 Site-specific recombinase XerD n=32 Tax=Bacteria TaxID=2 RepID=D4IK47_9BACT  ali  13  3.....ATIEVVCYKSKVLANNESPLMLRI-------TKDRKLKYSSIGVSVNPALWDFEKNRPRRNCPNRLHIERLIADKI--------------DAYRAKMIELQAEKKEFTATSLHERVADKTTKRTVGEVFQSQIENLKQTGRTGYALSHREVYNSLLKFNGHNIYFSDIDTVWLKRYETWLR... 163
323 3.000e-08UniRef50_D3I9X8 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 299 str. F0039 TaxID=575614 RepID=D3I9X8_9BACT  ali  19  2......KIKEIVRLRKPLKDGQKSLYLDIY-------VNGTRSYEFLKLYLQPET-------------------------SKIAKEKNKQTLLLADAIKAKRIVEIQTGE---------FRALKNNKVTLMSLIES---RLARKDSVIDKYLSKILRVYLKD---KDIELSKITPKWVERFFDFLEH.. 136
324 3.000e-08UniRef50_A0A1D2THB0 Uncharacterized protein n=1 Tax=Niabella sp. SCN 42-15 TaxID=1660118 RepID=A0A1D2THB0_9BACT  ali  13  3.....ATINLKLWKYRAKQDGTFPIYIRI-------TKNRKSSWLSTDVSVRERDWDDKKGKVKPSHPNSARLNALLQKTELKYQNEVLKVEEKALDIGTKSIKE---------------KILGKDATNFLQVANELMDSYRAQGKIGTYDKCNSIINKLTDYINNGFTFEDLDVKTLMRYRSYLL... 162
325 3.000e-08UniRef50_A0A257L3A5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium B1(2017) TaxID=2015582 RepID=A0A257L3A5_9BACT  ali  13  9.KHQMASASVVLFKSKTLKNGEH-------PIMVRIIKDRQPKYLSVGHSCSQELWDFKKEMPKRKHPHFTELTILIEAK-------------KAEANKALLKIENENISFSSQDVKAK-LVKQVLKLSVFDFLDKIIKELKEAGKIGNSRVYYDLRRVLKLYMGKKLAFTDIKKSYLTKFEQHLKS.. 174
326 3.000e-08UniRef50_A0A258FAU4 Recombinase n=1 Tax=Flavobacteriales bacterium 32-35-8 TaxID=1970509 RepID=A0A258FAU4_9FLAO  ali  14  3.....ASAKIVLR-KKPNANG-------LYPLAIRITKNRRSTFKHVGHYIDIEDWDEKKLEVKRSHPNADILNNLLSTKLSEVRKG-LITLQTEDKDASARQI-------------KTEIYKPTSSLTFFDYADEHLQALEAEKKINRHSADSAWIGYIVKFSKRQLTFQEIDDRFLRKFKIYLK... 162
327 3.000e-08UniRef50_A0A2V1IQM6 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IQM6_9BACT  ali  24  4......CTKVALRQR-LLESGKITLYFDYYPPIRNPKTNKMQRHEYLGIYLYG------------------------NPTNKVQRDFNQAMLEKGELLRCRRQEQVIN................................................................................. 80
328 3.000e-08UniRef50_A0A2W5E3A2 Recombinase (Fragment) n=1 Tax=Pseudopedobacter saltans TaxID=151895 RepID=A0A2W5E3A2_9SPHI  ali  14  1....MASIKLILRVQQADATGSCPLYI-------RLIKDRKSKLITTGVKLKPKDWDGTNQRVKKSMKNSARLNAYLDQKVADASAMIADSERRTKSITAKKLKEAIKG---------------KDSVNFMVYAKAKLKKLEKTYTINTYDNYYSQLLKFEKFVDDDFCFHDIDIVLLQDYMNYMANT. 163
329 4.000e-08UniRef50_A0A0G0AJE7 Putative transposase n=5 Tax=Bacteria TaxID=2 RepID=A0A0G0AJE7_9BACT  ali  22  3.........VKLREKK-INDGRVSLYLDI-------THKNLRKYEFLNIYVSNKRTDLKESQIKR---------------------------KLAESIRSEREYELIIKESGLN-------DPKRKQSDFIIFLENQINSEGHSSK-----SWKSLLVHIKDYCNNRLTFIAITENWIGDFQKYLLT.. 134
330 4.000e-08UniRef50_UPI000422ACFD site-specific integrase n=2 Tax=Arenibacter TaxID=178469 RepID=UPI000422ACFD  ali  15  1....MATLKIVVKKKKSDVNGH--------PVYLRITKNRQCKYYKTPYTAKDEEWVAVNEVFNKRNSNYVQNNRLL-------------IKFKDRAYKIVTELEIENPDYTLQDFDKRYRITFNPVTDVFTFFDEIIEEMTFAGRIGNAKSYKDTKTSVQIFYKRKLKFREVNHAFLSKYDAFLRS.. 164
331 4.000e-08UniRef50_H1H485 Uncharacterized protein n=1 Tax=Myroides odoratimimus CIP 101113 TaxID=883154 RepID=H1H485_9FLAO  ali  19  15.KNIYVTIKTSFYVRKEKSDTRLS------PLYLSLTASGKRERINLKISIDPTKWDKDKQR--------------LKVLSKLDQDINLIIDNIQAKVTNINTVYRLSNKQITPALMRKELTEELPRVNFCSFFKKALEDDKLMIKPGTLRRYKAVLSKLIDYRQE-IYFTEIDHSFFVEYRRYL.... 177
332 4.000e-08UniRef50_A0A1H8YV67 Uncharacterized protein n=1 Tax=Prevotella bryantii B14 TaxID=752555 RepID=A0A1H8YV67_PREBR  ali  44  1MKTPMKRTVFKVILRKSEYKEQWSLLIESFPVFEPGKDKPLRKHEPLGRFITTPIFDKN.................................................................................................................................. 59
333 5.000e-08UniRef50_E5V9M4 Tyrosine type site-specific recombinase n=1 Tax=Bacteroides sp. 4_1_36 TaxID=457393 RepID=E5V9M4_9BACE  ali  12  28................................................................................NQADKKRNVETLNLANAIKAQKILEIYNQTYGFNH-------NRLSNMKLTGYMKLIAEQS--VNNRVRKSAIHAVVCHLERYTPNGILLRKVDKTYLLGFIDYLKKT. 126
334 5.000e-08UniRef50_R6YJM5 Site-specific recombinase phage integrase family n=4 Tax=Bacteroidales TaxID=171549 RepID=R6YJM5_9BACT  ali  16  363.RKRNSKTKEPVRIRKELANGNKSVYLSI-------NVNGRRTYDYLRLYLIPE-------------------------VDAAAREQNKQTMQAVYAIKAQRIMSITNG-------IAGLKDKSRIKMRLVDWLEIFRDAQVERGRQSARNWVNSVLNAVRE-HSPNVTLAEMTKEYCNGFMVFLLN.. 509
335 6.000e-08UniRef50_A0A1I6FVR6 Site-specific recombinase XerD n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1I6FVR6_9FLAO  ali  14  1....MLTTKVLLNKVRQKQDGT-------FPLVIRITYNRKSIYLPLGYNLAEKDFDAKNQRIRPSSKIASNITRLNNGIQEKLKKIYDTVSRLEEDGKIE--------SLSMSSIKKEIEGKSVGNMDFYQFIDSLILDFKKAGKYGNAEIYRTLRNRIEKFHGKRLPFRQINYAFVKK......... 162
336 6.000e-08UniRef50_A0A1H4DX58 Site-specific recombinase XerD n=2 Tax=Pedobacter TaxID=84567 RepID=A0A1H4DX58_9SPHI  ali  16  1....MVTITVNLDKRKVKKDGT-------YPICFGIYHLGKSTTRSSKLYVSEKQWDDKKKTIKSIHPQAQMLNRML-------------IKQLADLQSSLLFAEDAKVQQYLNPIPI-IKESVKPKLTVFGFTNSLIDELKIDGNIGNAWVYTSALNALQKFHNEQLYFEDIDFQFLDKYNKHL.... 161
337 6.000e-08UniRef50_A0A0P0EX89 Tyrosine recombinase XerD n=35 Tax=Bacteroidales TaxID=171549 RepID=A0A0P0EX89_BACT4  ali  12  2........KIEIKERKLTA-GNRSLYLEYY-------ETGFRKKENLHLYLVPEN-------------------------SPKAKKLNRETYDKARVIRAERL--LNPPSFEKKSKQTEGKNEKAETLTWLDWCDEYIQWSKACDNCKKMLQHKGVVRYLERIKQTKILLKNVDAQIITGLFDYMRN.. 150
338 6.000e-08UniRef50_A0A1Y1CFD0 Uncharacterized protein n=2 Tax=Marinilabiliales TaxID=1970189 RepID=A0A1Y1CFD0_9BACT  ali  17  1....MATAKLILDNRKAKKDGT-------FPIKLAISHKTKTSYLSGNFSIPEKYWDNGRIKRGCPDIE--NIRIANNKLAALLFYANDFIAELEERRRVDFMSASQIADYIKNGGKQQHAS-----INFLEYLENYTSTIKNNN---TKEKYKTTLVKLQEYADADLLFDDITKAWLNRYKEH..... 164
339 7.000e-08UniRef50_B4S621 Integrase family protein n=4 Tax=Chlorobiaceae TaxID=191412 RepID=B4S621_PROA2  ali  17  41................................................................................NPADKAQYRQTVQFCKDLIARRQLEMKGLASGLVAQESDYAG-----GDFIAYCKQVADRSKNQKTREN---WHDGIKSLERFCRHGLTFREVDHHWLESYQDFLMDA. 140
340 7.000e-08UniRef50_A0A223V396 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A223V396_9FLAO  ali  14  1....MLTTKVLLNKVRQKQDGT-------FPLVIRITYNRKSIYLPLGYNLAEKDFDAKNQRIRPSSKIASNITRLNNGIQEKLKKIYDTVTRLEEEGKIE--------SLSMSSLKKEIEGKSVGNKDFFNFVDSLIQDLKKAGQYGNAEIYRTLRNKIEKFHGQRLPFRQINYAFVKK......... 162
341 8.000e-08UniRef50_G6AZB1 Site-specific recombinase, phage integrase family n=2 Tax=Prevotella TaxID=838 RepID=G6AZB1_9BACT  ali  19  1....MATVKVKFRAS-SVPGKEGTLY-------YHLIHQRSLRWISTDYHVFPDEWNDKKSAIIVSNRNNRQAHLQL-----IQSQIDWEMKQMQRIIRDK----DAEGISYTIDDIAKEIQQLPSSQSVFAFFRQQIVKKEQMQCIGTKSNYVSATNRFMEFRGEDITFSQMTSEMMEMYQAWL.... 165
342 8.000e-08UniRef50_UPI000493AE3D site-specific integrase n=1 Tax=Pedobacter borealis TaxID=475254 RepID=UPI000493AE3D  ali  20  2.........VTIRERKLK-NGKISLMLDVY-------VNGVREVKSLNIYLDE------------------------NANTPTKKAQNKEKRLKAETICKKKELEIIENNHSLVSVK-------QSNIKFLDYFKAI--KEKKRGSLGNYGNWDSAYKILVEYFDKDVRINDLTDKDLNNIRDYFLST. 140
343 9.000e-08UniRef50_UPI00083F65D6 site-specific integrase n=1 Tax=Rhodohalobacter halophilus TaxID=1812810 RepID=UPI00083F65D6  ali  14  19.............................YPIYLRITNNRKHKYVSTGLSVKKKHWNPEAEEVRRNHDNYKTLNETLELKVNE----------------ARRVQTELSRNGHETAKAIRERIKTTQKADFFELGEQLLKELEANKKYYASKTLKVVLKKFEEFEGERLPLKQIDGGYLEKFENHLRT.. 161
344 9.000e-08UniRef50_A0A1M7EC01 Site-specific recombinase XerD n=2 Tax=Prevotella ruminicola TaxID=839 RepID=A0A1M7EC01_PRERU  ali  14  29.KGVVEARKVTLKGRMLK-DGKISLYLYSC-------INGNVSRTSMGSFLNIETD-------------------------PTIKAQNEETIRLARTKADLMNADAEREENG-------FRPIAKSKANLIEYTLKVADDAKTNNKHGYYYNLQALARHLKTFRGDKIRLSDVDKDFILAFVAYLRN.. 176
345 9.000e-08UniRef50_A9DR55 Tn5520-like integrase (Transfer factor) n=28 Tax=Flavobacteriales TaxID=200644 RepID=A9DR55_9FLAO  ali  18  1....MASIKILLRNKPNKEGQ--------YPVVLKVIKDRKIKVITLGITCLEKDWDKANSKFKKSQPNYMQRNRAL-------------LKKKEQALKIIDDFFLDGVDFTLAQFEAKFRGKSSSNITVIEFWNERLSDLNKAGKTGTARIEKYVKNSLFKYAKKSLHFRDITPVFLEKFEIHLRS.. 163
346 1.000e-07UniRef50_A0A2G4H8V6 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4H8V6_9FLAO  ali  22  2........KINVRKRKT-GDEKSSLNLEI-------TVNGRRTRESLDLFLY------------------------NKPKNKLQEKQNKETLELVEQIKASKTIELQDQKYGTMRQDFG-------KRNFLRFFEEKMEE--RNESAGNYGNWDSALKHLKACFGEVLMINQLNFTF............ 129
347 1.000e-07UniRef50_H1DF10 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=H1DF10_9BACT  ali  14  3.....ACISIVYYTSKTLSNGEHPLMLRI-------SKDGKKKYNSIGVSVHPQFWDFTKNQPKRSCPNRDAILRLITEKTKQYQEQ-------------LIEFKAENKEFTATTLVEKLTNPTKPK-TVGELFTEQIERFKTAKRTGYALSILQVYNSLIKYNKHNIYFSDIDVTWLKKYEQWLRST. 165
348 1.000e-07UniRef50_A0A1Q3UDS9 Uncharacterized protein n=5 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1Q3UDS9_9SPHI  ali  20  2.........VTIRYKKL-STGKFSAYLDVY--SNTGEGKGKRNYEFLKIYVDKDYSDAASRI----------------------SEPDKEKLKIIKALRNKREDELNFSEHG-------YKQPAKINYYLQDYLGQCLAKKFN-------YKLECLIIHLGKYCPKRILFQEVDEEFLDKFQSYLLN.. 141
349 1.000e-07UniRef50_UPI0009B99D78 hypothetical protein n=1 Tax=Parabacteroides sp. Marseille-P3160 TaxID=1917887 RepID=UPI0009B99D78  ali  17  2......TIKVIVDARRANKDG-------LYPVKLSFSNHGKTALSSLGIYVDPDEFDPANNLLLLSNKATKLENQRSNIRI-------KNDLTRAQNLLLSLQVERDNISPVKFKKMLDKGGDIMTNRSFNAYCREVI----TRKSGRTKRSYQSTLKKIERYFGKSVFFDEINYKWLDSFDRKMKN.. 165
350 1.000e-07UniRef50_A0A1V0DBG2 Uncharacterized protein n=1 Tax=Rhodothermaceae bacterium RA TaxID=1779382 RepID=A0A1V0DBG2_9BACT  ali  14  1....MATIRFLLRKDKTRSDGTAPVYL-------RVTSRRRSRHLSTGIRIEPRFWNDARQEVRRSHPLSDAYNA-----------------RLAD-LRLEAERAALEAGARRAAPEAVIQQLDGTGTSFYRFLDAFIDDLERKGRVWSWKRYRVLRGKLEACFGPRLDWGDLDGKALVRLERYLTD.. 158
351 1.000e-07UniRef50_A0A2W4UYX9 Uncharacterized protein (Fragment) n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2W4UYX9_9FLAO  ali  12  25......HSKFVLR-NHVDKKGKSPIYL-------HLTQEGKRERINLNIGVEKKYWNSSKERVSTSH--------------PDANDLNLILDNYFKRITTIKTTYWLNQTPLTMTNFLLEFRAGFSRTEFNAFMLLTLEEAKPSMNPNTWKAQNSVRKKIKAFSSE-ILFSDINFSLIQRFKNY..... 179
352 1.000e-07UniRef50_A0A1H5JTT2 Site-specific recombinase XerD n=1 Tax=Salinimicrobium catena TaxID=390640 RepID=A0A1H5JTT2_9FLAO  ali  14  1....MAKLKVVLHPKIDRKGKKQ------YRLAFRVTAYRRRSYLYLGYNIDPKDWNEEFEKVRKTHPKHQHLNRLIRKKYDQIDDIIFEAASKNEKITANQILDKVRNKLD--------------NTTFYALAEEHIEDLKQAKKLNRAISDRSKLNRIKEYSKKKLHFQEVDELFLRRLKIYLLT.. 164
353 1.000e-07UniRef50_UPI000B93ED2A hypothetical protein n=1 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=UPI000B93ED2A  ali  19  9..............................................................RKSRYIKTSHFIDESQIVGEDEIELDFIIDHLAKPIKTYRIDEIENIELLSVDDVLEILTRDKKDIDFLCFIKYHIEKLKEEGRNSTSKPFTTVLNSLVDYVVPPLYCSKITSKFLKGYAEFLRK.. 135
354 1.000e-07UniRef50_UPI0008F9DC72 nucleoporin-like protein 2 n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9DC72  ali  10  19..........................................RYEHSNYASYSQGNNRNYRDGGNRGDYRRNDNYHWQKGGKGGGGGNTEVDRIAQAIREEVI--VIENGNMWPFTCYSPLAQNGNFKGWEDYSEEMRYEMWKAYQTNTQDTYDKAIRTLHDFREKRRKLKTINQETLLEVRDYLNSSP 165
355 1.000e-07UniRef50_A0A1I4X800 Site-specific recombinase XerD n=1 Tax=Flavobacterium ummariense TaxID=913024 RepID=A0A1I4X800_9FLAO  ali  11  1....MASIKLVQRTQQENATGQSPIYI-------RLIKDRKAKFVTTGVKAKVSEWDDAKQKLKKNYPNSARMNAFLAQKVADAQAQVADHERTKKSVSARKLKEAIKG---------------KADPNFFDYCDKRLEVLKGIVSYRTTVIYEGYIKKFERFLGRDFYFSDINVGILNDYANY..... 159
356 2.000e-07UniRef50_A0A1D7Y002 Site-specific recombinase XerD n=1 Tax=Formosa sp. Hel1_33_131 TaxID=1336794 RepID=A0A1D7Y002_9FLAO  ali  16  26........KIRIKDDYIREDGTSALFLSIYY-------NGKRKRLPLDIAVPVASFDTKTQRVKKNFKFSL--------------DYNLIIEKTLADLNAIEVSYRLSNERISLVKVLEDLQNPSLRVDFNLFAEKTLEFQNKIISPTTYRQQKGCLNKIKRYKSP-LLFIDIDQAFLDRFKSYLKNT. 185
357 2.000e-07UniRef50_UPI000D6CB629 site-specific integrase n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6CB629  ali  24  4.........VSIRERKGKKG--IHLALDIYDG-------GKRSLQSLKITLY------------------------NNPKDNEEKAYNREMRKQAKKLKNEKLVELNRF-------GYDRVMLFNSKSNFFNYAEEIV----KTKIGSNQETWRTALQHLHKFNNKTLNFSQIDIPFAESYKRYLLK.. 139
358 2.000e-07UniRef50_A0A1W6E4P9 Integrase n=7 Tax=Cytophagales TaxID=768507 RepID=A0A1W6E4P9_9BACT  ali  11  12.....ATVTIVYRTAKTLADGSH-------PFWVRITKDRKSKFIATGLSLHAEYWNEEKGKCRRSVPTDKREALE-----AALERWRKKYTEVAEDLST----ADEQHDAIAIATKVSTDRLNTRKFKVLSYFDELIEQFEQTGNVGNRKVYRDVRNKLQAFIGEDVPFDAVTVKFCNEWERTMK... 178
359 2.000e-07UniRef50_A0A1M3R1A2 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1M3R1A2_9SPHI  ali  14  53...................................................YTFEWGKAANQRKASGIFTY-----AKPQTQIEKKHNSEALALLEVKKSELILERQS-------IGSAYIPSHKFQSNFIDFYEQYVTENRIYGNR----HLENSLTQFKAFLAKDILPIDLNESLALRFRKYLLD.. 173
360 2.000e-07UniRef50_A0A0W8ECV2 Uncharacterized protein n=1 Tax=Solirubrum puertoriconensis TaxID=1751427 RepID=A0A0W8ECV2_9BACT  ali  13  4........................................KIRYRKLRDGSEQIFFDVYHKGRREYPTFKEPQLILRPGTDEATKKANAVMEAQAHILLKRLELQLLEGTYEWQQQSAVESRGSEAPQSFLAYFRDEAERRKTQ--RGCKSNTYACFKHFERFVGSDVAFAQFTSQLVEKFKCYLE... 151
361 2.000e-07UniRef50_A0A2E0EPH4 Uncharacterized protein n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E0EPH4_9RICK  ali  14  22......HTKIRVRDSYLNKEGKSRLYL-------HITGDGERKRLSLDLYVDPNVFDAKKQLLRGS--------------SAEIVQDNLVIDNYKAKATSIKTAFYLTNKTLTVDKFVDEFINGVPRTNFLAFCTHFLEHNKTNYAPGTYRRYKSLIAKISRY-KKRIDFADLTYSEIQKIRNYL.... 178
362 2.000e-07UniRef50_A0A1Z5SFA5 Uncharacterized protein n=2 Tax=unclassified Chitinophagaceae TaxID=569836 RepID=A0A1Z5SFA5_9BACT  ali  21  2.........VNVIKRERKLKNSIALYLDY-------RVNGERIQEATGLHIFPQ-------------------------KDERTKQLNKENLIRFEKLRADRQNQLLNG--------VVPLPIDRKKVDFFKYYEEYYVKFPTKERRA-----DAVLKKLKTFHKKPLPIAVIDESFLVRFKGYLE... 134
363 2.000e-07UniRef50_A0A1F3EMP5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWB2_41_8 TaxID=1797322 RepID=A0A1F3EMP5_9BACT  ali  15  1....MAISKVYIDPKKAKKNGEISVYI-------LVHIDYKSVKFNTGVSCFEADFDVKASRISGNSKK--------------AKDDNLIIESCMARINEIFVRYRLQNIPLTAELLKNEWKNPTRRIDFHSFMKEAIEERRPDVTVGTYKNHKAFSTKIKQFR-KSLAFTEITPDFIDSFARWLKT.. 161
364 2.000e-07UniRef50_A0A2G5KPR9 Recombinase n=1 Tax=Maribacter sp. 4G9 TaxID=1889777 RepID=A0A2G5KPR9_9FLAO  ali  13  1....MATVKIVLRKNYQKKDGT-------FPITLRLTKNRRSKFLFTGEYILEKDWDETKGLAKKSHPNSSRLNNMLLKKVTEA---------------HDKALEVEANEKKQSVTTIVKKIIGEDKYDFFKVSEVFLENLLKRKKFNQHYNQEKRLNIFKSFLGKKLSFTDLDVMLLKNFKAYLL... 161
365 2.000e-07UniRef50_F9Z8N5 Integrase family protein n=76 Tax=Bacteria TaxID=2 RepID=F9Z8N5_ODOSD  ali  12  2.................................LRIHKDGKRKLVSIGLSIHPQLWDFTKNEPKPKCPNKDLINKI-------------ILDKKAEYQKEILELNAEQKDYTASSLVENKKAKYEPK-TVIDFYKELIQNFKDAGKTGNKSIYTNSLNSLKAFTHNNILFSDIDVDWLKRYEKW..... 140
366 2.000e-07UniRef50_A0A127B226 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A127B226_9BACT  ali  1....MASVKVLLYTSKVLKNGEHPIML-------RLIKDRKIKYVSLDYSCSKELWDEDEQRPVKKHPHKVELNI-------------KITKMMNDANKIILDFDNNEQNYSVDDIAKALSRKVIGKRTVFQFTDELVQRHKEVGKVGTADAFQNGKRIVSRFTKKDISFKELDYIFLTRLEDDLLK.. 164
367 2.000e-07UniRef50_S0GTR5 Uncharacterized protein n=4 Tax=Parabacteroides TaxID=375288 RepID=S0GTR5_9BACT  ali  15  2............KRRKSKVTGKQT------PLYIQLICRRKMKRIPLDIKVYEEEWDPLTEIVQ-------IPPGTDRQRTEYLLQVSETACETCRMIRQIIEEQPVNKDF-SVDDIVKLYEERSASMYLSAYIQKLADILLAQGKEATSRHYQSLGNSFLSFFGKNIRIDEINEKLIRLYEEYLM... 161
368 3.000e-07UniRef50_A0A2A2GE98 Uncharacterized protein n=1 Tax=Aliifodinibius sp. WN023 TaxID=2032627 RepID=A0A2A2GE98_9BACT  ali  15  1....MTTFKFILWKYRKKNNGEVPIYLRI-------TKNRNPRYVSTGISILPRHWNESKERVRATHSKWEVYNNKLDEFITDARVKANE----------------LKYEGEESSKSIKKKIKGIDSPKFIDYTRELLPTFG----YWKKRKYKVLINKLEAFHGPDLRFNDIDTRFLRKFELWLE... 155
369 3.000e-07UniRef50_A0A1H8UZT2 Site-specific recombinase XerD n=1 Tax=Mucilaginibacter gossypiicola TaxID=551995 RepID=A0A1H8UZT2_9SPHI  ali  17  3.........VTLRQ-KLTNTGRYSWNLDIY-------HEGKRISKSLKLY------------------------TTIKPKTEAEKIHNADVKRLAEKIRLNTEAELINS-------NYSKFGSKQTEISFLDYFAKLTKERRR--SDGTFANWDSTYKVLKQYFGNRIEMSETDLVAIRKFI....... 138
370 3.000e-07UniRef50_R5CKS6 Uncharacterized protein n=7 Tax=Bacteroidales TaxID=171549 RepID=R5CKS6_9BACT  ali  12  1MKRNLPTISAILYTSKTLANGEHPIMLRICY-------NGKRKYKSMGISCKPQEWSDDKQRVKGKRANSLNPI---------------ITKELADAQNYVLSLE-GREDYSASTIIADLQKTAPTKQTLFTLFEERIEFFKEKEKPNTATGYRTLLNIIKKYTGKDLELFEVTTNWLRLFEEYMR... 165
371 3.000e-07UniRef50_A0A2T8HLC1 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=A0A2T8HLC1_9SPHI  ali  13  1....MSKPKIYLKRRSSEEEGQLYLYYSY--------GGDKRLEFYTGFRIKNSYYNDQYWSGNKKPINKKCPFHDNYNRLFEEMKLYAVSLVINERIFDNKELKSRLCDEFKASKVEEPEISNFIAGDFISYCEYVQSERKKSNSLRNPGTTITSLREFAKFKKTTFLFDEINVKFYNAYRDYLLN.. 192
372 3.000e-07UniRef50_A0A174VEC1 Site-specific recombinase XerD n=18 Tax=Bacteroidales TaxID=171549 RepID=A0A174VEC1_BACT4  ali  14  30.............KSKVLANGEHPLMLRI-------SQGKLRYFKSLGISIKASCWNFDKEEPKRNYPNREQLLNIMNQTRQEYVNMMFELKTLGKDFTPQSLAEYVERSC--------------NKQNVGDYIQYIIQYMTAEKRLGNAKAYISCYNSVLRFAGNDIPFTDIDVNWLKRYELYLRK.. 183
373 3.000e-07UniRef50_UPI00047D46A1 hypothetical protein n=1 Tax=Sediminibacter sp. Hel_I_10 TaxID=1392490 RepID=UPI00047D46A1  ali  15  15.KKFFVPMTIKIKRRNVNKDGESLLYL-------HVSSAGERQRIPLDIYVDPKYWIKEREILKGPEEHTEL--------------QNLLVANVKSKITKIKTFYKLSYQDLTMHAFIEEFTNNLPRANFVSFFEHMLEDRRNTIEDSTHRKELAVLNKLKNFQSE-VLFYQIDQMWFTKFRNYL.... 177
374 3.000e-07UniRef50_A0A1H6A6J9 Site-specific recombinase XerD n=5 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A1H6A6J9_9BACT  ali  13  3....VTQTNLVLQRWKPTKQGKFPVVIRIY-------SDKKRRYFRTGVSVLEKDWDEKSASI---------------PGRARDNKKVQSLLKKAEEIVERILVLHDDFDFDLFSKEFSESSPTQSGENFITFWESVIKDLRAENRIGTAASYENALNKFRKFMKDRIPLRQISQHTFEKFRIFM.... 162
375 3.000e-07UniRef50_A0A162R7E9 Uncharacterized protein n=1 Tax=Flavihumibacter sp. CACIAM 22H1 TaxID=1812911 RepID=A0A162R7E9_9BACT  ali  18  7..............KKLLKSGKYSLYIDYFPPVWNPQKQVYTRREYLKLHLHSS------------------------PVTSMEKKENLLYQEIAEKIFIKRMKAL-------MLDANGLFNKDALEADFFVYALNFIRGKQKEK............................................ 106
376 4.000e-07UniRef50_A0A2D0MXZ4 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2D0MXZ4_9BACT  ali  13  1....MASVKLYFDIRRAKSD-------ETYPLKLKVFHKNLARYIPLNFFFKKNQWHVRDHKVNSSYPNSGRVNAQIRNLLSIATNYLAEQELL---IRKLSIDELKQNLINEMFKTDDEADLGNQHETLAHFANSIIERQLKSGKVGTAQTYKTCLKAIFRFSNENLLLKDINHRFLADFEA...... 170
377 4.000e-07UniRef50_A0A1H2B1H1 Phage integrase SAM-like domain-containing protein n=1 Tax=Mucilaginibacter mallensis TaxID=652787 RepID=A0A1H2B1H1_9SPHI  ali  15  17....MATVKIILDKRRAKADGS-------YPINFQICHQRKTTTRSSKINVLEVDWDDSSKSIKKSN----CLHKSLNTKLKKEFADIQSQLLLADDIKVKEFLTPIKEQVEIIEV----------KKTIYQFAQELINQLRIDNKIGNAWVYESTVNVLKTFTTDDLYFEAIDYQFLTQYNSFLVK.. 179
378 4.000e-07UniRef50_A0A1E5SPV7 Uncharacterized protein n=1 Tax=Fabibacter sp. 4D4 TaxID=1889784 RepID=A0A1E5SPV7_9BACT  ali  14  4......TTKVLLNKVRQKQDGS-------YPLVIRVTYNRKIAYIPLGYTFQEKDFDQKNQGLKTASKAVDNVTRFNNQVKDAVKNVYTVISKLEE------DGSVRGMTMTDIKKAILNEGEENGDVTVFQFMETIIDNLKAVGKFGNARIYKDSLNAWKNFRGKDLLFQQITYKTLKDFERFFLK.. 172
379 4.000e-07UniRef50_A0A143XUW0 Site-specific tyrosine recombinase XerD n=2 Tax=Alistipes TaxID=239759 RepID=A0A143XUW0_9BACT  ali  13  17......SIKPMLNIRSGTGDGRHTL-------VIQLIRERRRGVIFTPYRLLPEEFDAARRKAVVTCRRKTHLAFIREVNLFLENQR-------QELGRIVSELERE-GRPFTVHDVTSAYRQRYDNRYVHTFFRRQIEDLRKAGALGTANKYKATLVAFEKFAGRRVDFDSVDENMLLDFERYLRQIP 185
380 4.000e-07UniRef50_A0A2I0D5E3 Uncharacterized protein n=1 Tax=Psychroflexus sp. MES1-P1E TaxID=2058320 RepID=A0A2I0D5E3_9FLAO  ali  16  3.........VKLREKKLSKGG-ISFYLDIY-------KNGKRSYETLDIKIYPRDPTQQK----------------------------KEKREIAKLARNNKEIDLISN-------GYDYLPSHNKKIKFSDYAEAYLDNYTKKDK----AMVDATVKQFKSFSDNSLKLHAIDKKLLLGYKEYLET.. 134
381 4.000e-07UniRef50_A0A2G5L8D1 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2G5L8D1_9FLAO  ali  20  3.........VQLRSRKLKS-GVKSLYLDI-------HHNGERWREFLKIRLSPKDADRIEKK------------------------------RLADKIRANRELEILSDETGHV-------PKHLKNQNFYLFAEHFIKTYKFKDVRIVAS---AVEKFKLAIDNPRLKISQVTPSIMEVYKDYLVH.. 132
382 4.000e-07UniRef50_A0A1G9YWF6 Phage integrase family protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1G9YWF6_9SPHI  ali  13  1....MVYYKLILDTKRIKEDG-------LYTIVIRITHNRNNTTITTGLRVKLDQWDSTSQLIIKSHPNFQKLNSSIS-----------ELYLKIQKIILALQESGEFSFEKLKDQLSNRTVIKVEQITFHEFSNKLIKDMIQLNQTGNALIYQTALNRFMSYSNKSIKFQDIDYNLLSGYKNSLLSS. 166
383 4.000e-07UniRef50_K5Y9A3 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=K5Y9A3_9BACT  ali  13  1....MATFKVS--QKRVNKKGEAPIYVCFYL-------NREKIEIPTRISVPPTFFDKENGIIKKSYEF--------------ASDKNLIISNIKATINDILVCYRLRKEQLTSELFWKEYNSPRSRQDFYEFCEEYQRLRFQEVTEATRKKHRSCLNNLKSF-QPNLSFDQLTTDLFRRFVLYLRN.. 159
384 4.000e-07UniRef50_A0A2E3VSW4 Transposase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2E3VSW4_9FLAO  ali  10  5.......IKLSLDTRRKDTK--------TFPLIFRLSHNQKSTSISTGHKLAASEWDDKRQKIRPAYKGTESPSRLNNLLQKKMARMVDILTKLEEADKLK---------YMSVTEVRSHITRNTKKVTFYQFAEKQIVDLIKANRIGNARAYKHALKAVKNFRKKDFTFDELNLDFLNRFEKH..... 165
385 4.000e-07UniRef50_UPI000698539B site-specific integrase n=1 Tax=Aureispira sp. CCB-QB1 TaxID=1313421 RepID=UPI000698539B  ali  1....MATIKLFHFIGKTYSNGESPILL-------RVTHQRKTKYIALGYSCLPTQWNKDKNRLRKNYPNY--------------KSKNRVLSTLEERAESVLDEFTKLDKPFTFQSFEDRFTNITKSCTVYDFFDIRINEALKTNTKGTYKQTKNALYKFA--PNKKLMFADIDYQFLKKFETH..... 157
386 5.000e-07UniRef50_K1FM98 Uncharacterized protein n=9 Tax=Bacteroides TaxID=816 RepID=K1FM98_BACFG  ali  12  26..KFMATVKLKLNKSRALKDGS-------YPVVFQLLHQRKKEIVYTKYRMKENEFIPVLEKVSSNNYADCKISRELHKMTRSFYLQIKR-------------LEATGDEYTVKDIASAVAHKSAGKYILLDFIDSQIAWKKSMKKDGIAAAYRSTRSSLAKFVGKQVKMSQINQRFVTCYKDFL.... 189
387 5.000e-07UniRef50_UPI00047E0554 site-specific integrase n=1 Tax=Maribacter sp. Hel_I_7 TaxID=1249997 RepID=UPI00047E0554  ali  17  22......KTKFILR-DYVNQSGKSPLY-------MFISSPGDRKRPKTELEFYPKDWDQKTERVKSTAHNSET--------------YNLILENLEAKVSKIKTVYLLNEKPLTATKLAEELKETTERVDFKIFFKKQLAKEAKLYSKGYLKRMNTVLNKLQKY-PHEIMFSDITPEFENKYRIYLAS.. 179
388 5.000e-07UniRef50_A0A1H3Y609 Phage integrase SAM-like domain-containing protein n=2 Tax=Alistipes TaxID=239759 RepID=A0A1H3Y609_9BACT  ali  15  1MGKSTFNIIYVIQKGKAKADGSA-------PVVARITVNGEKSHFATRIYVDPACWLPKEYRTTGMTREERKVNEALDELRVLIKQRYDEMLRRAEAITAGK---LKNAITGLDEKAMKLLDLCDR---FIEDYKGLVE--AKVYGRKTLTRYVSTRNRLSKFITEDIPLSDINPKFAKDFDLWLRTT. 178
389 5.000e-07UniRef50_UPI000422A725 hypothetical protein n=1 Tax=Arenibacter certesii TaxID=228955 RepID=UPI000422A725  ali  11  3.....THIKLSLDTRRRDTK--------TYPLIYRLTHNRKTTSIGTGHQLAVSDWDQKRQKIKPSFKGTESPARLNNLLQKKMAYMVDILTQLEDKDKLK---------YMSVSEVRSHITRSTNEVTFYQFAELQIQDMIKSNRIGNARVYKHTLNAVKNFRNNDFTFDELNLDFLNRFE....... 163
390 5.000e-07UniRef50_UPI0005B6FE6D hypothetical protein n=1 Tax=Prevotella sp. P5-125 TaxID=1602172 RepID=UPI0005B6FE6D  ali  12  2....................GKKKLYKEIIAGYSLTSSKVHRKVYLVGRPLKTGNVSLVRYHSSGSGKFRVRERETTGVILCIEKDQNQEKLRLQQVVCDTLNADLEREE-------ADFKPLPKTKVLLSDYAKELAERSLKENRHSTYSSMNSLAQHAELFRPHS-QLGDIDKKWCLLFIDYLKH.. 170
391 5.000e-07UniRef50_A0A2P8E341 Site-specific recombinase XerD n=2 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A2P8E341_9BACT  ali  14  10............RKDTINKDGKV-------PVSIIVSVSGKRKRIKTDIRTYYFNWDQGLQRRKKIKELNPEFDPNNLPSSMDIEDINQELVLVESRFRDAKKFELDNIAYGVQSLCEAFLLEQKPKTYVLDYIEKYIRENEAKRARGSMSVYKSLKGKLEAYLKKSISFEKIDLAFFRSFENYLIK.. 193
392 5.000e-07UniRef50_A0A1Z9CUJ4 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TMED120 TaxID=1986702 RepID=A0A1Z9CUJ4_9FLAO  ali  20  2........KIRLRQLK-NKNGTVSLRLDTFMGYFTGKRKAKRIRETLPFHIPTEE-------------------------TPNYTEEKLRLLQKADEIRKEKEIQLQESGRY-------PFSKEKTKNDFFIPFLEEIVSIKISNKRNNEAVWLGMQRWDKVFATPIIRFKTINDSHCSSFFNFLEK.. 150
393 5.000e-07UniRef50_A0A127VK73 Uncharacterized protein n=1 Tax=Pedobacter cryoconitis TaxID=188932 RepID=A0A127VK73_9SPHI  ali  13  5...............KLILNDKRSKSDQIYPIVVRVTSNRISTTVSTGLRVHIKEWDAIKAVIKNSHPNCHILNHQL---------LDFYTKVQRSILKLQDQQDFSFENLKLSLKEQPVQTSIQAKISFNEFAEQIIRELHESNKSGNALVYQASWNRLSSFKNKRLNFTDIDYTLLEAFKQHLMK.. 168
394 5.000e-07UniRef50_A0A1D8D1P1 Uncharacterized protein n=1 Tax=Chlorobaculum limnaeum TaxID=274537 RepID=A0A1D8D1P1_CHLLM  ali  12  1..............................................MGVNIYRRESKDGERVQFYIDVYASGQRRRVAAGLPA-RLSNKADVKRAE--RDAHIKARQFEEELRTDAAAFFNKKDRDKTDFVQYCRDL------SKARGNPGAWSGMVNRLSEFTGGSVKMSGVNALFGQRFRRFLIDA. 133
395 5.000e-07UniRef50_A0A0B7IRE2 Uncharacterized protein n=2 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7IRE2_9FLAO  ali  17  14LQKKLVTMNVKVRRDYVNKHGMSPVYLLI-------TSQGKRIRQRLPIEVRPEDWDEKKGRFKKSAENAVGYNIAIENEIA--------------KIKDVRLVYYISNKELTLEQLVQEYNNASSNYCFVAFMEKYVEQ--QNIKPGSLRKEKSRIAKIKRFQKE-IPFSQITIEWIERYIAYM.... 175
396 5.000e-07UniRef50_A0A221UVN2 Tyrosine recombinase XerD n=2 Tax=Arenibacter TaxID=178469 RepID=A0A221UVN2_9FLAO  ali  12  3.....THIKLSLDTRRKDTK--------TFPLIFRLTHNRKTTSIGTGHQLFVSDWDQKRHQIKPSF----------KGTESPARLNNLLQKRMAYMVDMLTQLEDNNKKYMSVSEVRSYITRTSNKVTFYQFTEQQIQDMLKSKRVGNARVYKHTLNAVKNFRKKDFTFDELNLDFLNRFEKY..... 165
397 5.000e-07UniRef50_A0A2G2EP86 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2EP86_9FLAO  ali  12  2..KNTLSIRTVLRKDKMNQGGLSPIYLSI-------SLNKKKFKLSTGQWLEEKDWNFDQSAPKRKFPNLKRKLRLDV--------MNLEDFFLEKTARNEFV----------TPELIKNYYKGEDDYDFYVYFDKFLKSKSKKVRHSTMKSYHGTYRAFKEF-KSDLLMAEIDLKLIKRFDSYLRD.. 160
398 6.000e-07UniRef50_A0A264Y5L1 Recombinase (Fragment) n=5 Tax=Bacteroidales TaxID=171549 RepID=A0A264Y5L1_9BACT  ali  14  3.........ITIRQ-KALANDNISLYLDIYDG-------GKRKFEFLSLYLLPE-------------------------VDAETKARNEETLQRVHQIRAERILETIPEVGHLMIVKEIPNDESPEVLDWIQYIDWMSDNTDYSKAIVDQSKYLKYLEFLANKRRPHITLRKFDKEWFKAFFLWLKN.. 152
399 6.000e-07UniRef50_A0A2K2W2F1 Uncharacterized protein n=5 Tax=Chryseobacterium TaxID=59732 RepID=A0A2K2W2F1_9FLAO  ali  13  27................................................................KRRMFRPKITYVESPRTAAERQERKEKRQLADRMRARLEVDELYATNMLD-------KGFQCNKDFFEYCKEFIVRKAPHCEMRTYNAMVEKLKTFNK--RKKLHCSEINEEFLISFKDYLNST. 141
400 6.000e-07UniRef50_C3L3W9 Uncharacterized protein n=1 Tax=Amoebophilus asiaticus (strain 5a2) TaxID=452471 RepID=C3L3W9_AMOA5  ali  17  2......KISIILYKSKTLADGSHPL-------MVRISQLKAKKYFSTSLSCQASLWDFDKHTPKRSHPDRKLLEAIL-------------AQKKASYHTKLLELESEQKTLSLQQLVQAIEEPRQTSQELFPFLSEVCENLVQSGKIGRARLYKRLLTSLKEFTGKQLSFSDIDMPFLNSYEAFL.... 161
401 6.000e-07UniRef50_D5H6P9 Uncharacterized protein n=1 Tax=Salinibacter ruber (strain M8) TaxID=761659 RepID=D5H6P9_SALRM  ali  14  1....MATVSIELRSDRTDPNSWAPVRLRI-------AHRGTKRYISLGFKVLASKWNSDREEVTRSHPDQKEYSDDLSEIKSTAQSALRSENRARHVVTARRLEEEIQKRLGPPEEAAC---------DFLSFAEERLKEYRPREQISMFESYRLDPRKFRQFVEEELPCDAIDVELVESFRTF..... 169
402 7.000e-07UniRef50_A0A2G6LSS1 Uncharacterized protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2G6LSS1_9FLAO  ali  18  3.........VNLRV-KHLGNSKISKRKRPYKYQLDYILNGKRVRETIKDVVFEPTDTKDER---------------------------KQKERVVNHIKSQLEIELGNSKHGLVSRKLQ-------KGNFIDYFKQLGSKKTNK----TKIAWDNTLKHLIEFQGKKITFENISISWIENFIEYLKK.. 141
403 7.000e-07UniRef50_UPI0009E2F9EF hypothetical protein n=1 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=UPI0009E2F9EF  ali  12  2......KIKASIEKREPDKDGKQSLRLVYYFGTSIDPETGKRIRYK--------------------RREPLELYLFQKTKTPQQRQHNKETMRLAEAIKAKRLLESQSGKHGLDH.......................................................................... 90
404 7.000e-07UniRef50_A0A2T5YF50 Integrase-like protein n=1 Tax=Pontibacter mucosus TaxID=1649266 RepID=A0A2T5YF50_9BACT  ali  16  4.KKQTAKEPVKLREKKLK-NGNLSLYLDFYY-------EGVREFEFLKLYLIG------------------------KPKDKQERQSNATVLELAQRIKAKRTEELLTG-------ALNLSSKNQGTVDFVQYYQAYINQYTKADHR.......................................... 110
405 7.000e-07UniRef50_A0A2A4G572 Transposase n=1 Tax=Sediminicola luteus TaxID=319238 RepID=A0A2A4G572_9FLAO  ali  11  5.......ITLMLDKRRMKKDGK-------YPIIFRLTHNRKTTSMSTGFSILEIYWEERRSEVKSSYKEVESVRLLNHLLLKEKARVSNIINKLYEKGELQ---------YLSLQQVKQFITRRKNYDSFLEYGKYLVGELKAVNRFGTARSYDGTVKILKTFKGKDLKFNEVNYDFLLKFEKF..... 166
406 7.000e-07UniRef50_A0A239XV30 Uncharacterized protein n=2 Tax=Chryseobacterium taklimakanense TaxID=536441 RepID=A0A239XV30_9FLAO  ali  11  1....MATLKFILKTHQEDKSGKCPLYI-------RLIKDRKAKFISTGIKLEAQHWDEDKQKVKKNYPNSTRMNAVLASKLADASIQVLDEERKTKNVTAKKLKQALVGS---------------SSVNFFEYADKTLKNIRETISENTYTVYRAQVNKFKEFVGTD...................... 141
407 7.000e-07UniRef50_A0A257JZK5 Uncharacterized protein n=1 Tax=Flavobacterium sp. BFFFF1 TaxID=2015557 RepID=A0A257JZK5_9FLAO  ali  16  6......TVKAILRKDKIRKDGT-------CPINFRVTINKKSLKISSGEFIKEVEWNNKAGLVKGSKSSHLNSVLEN------------EISRIKDFLREQRSI-----GTYLNLEIVKAFLKTNDRDDFYEYYDNFCELRFLEIEEGTQRHYNLTRKRLKEF-KSKITFREINIDFIEKFDYFLRK.. 161
408 7.000e-07UniRef50_G1ULJ3 Uncharacterized protein n=1 Tax=Bacteroides dorei 5_1_36/D4 TaxID=556260 RepID=G1ULJ3_9BACE  ali  54  1MKKALPNTKVTVKLRRSNYKEEWYLIIESSPVYKRGSKRASRVVEGVSFITTH........................................................................................................................................ 53
409 8.000e-07UniRef50_A0A2U0DGC7 Site-specific integrase n=1 Tax=Chryseobacterium sp. HMWF035 TaxID=2056868 RepID=A0A2U0DGC7_9FLAO  ali  13  7.........LTLDMRRTKKDGT-------YPVIIRISHYNRSTSFTTGVSVLEKDWDFDKKIIRKTYTGTSSVTRLNNFLNKQRIKAMDIVNRLKEEDKLR---------FMSITQLKEQLTQSDKVHSFFSFAEKLIAEMKKQERFGNATSYQTTINSLKEFTGKDLYFEELNYDFLMKY........ 163
410 8.000e-07UniRef50_I3YJP9 Uncharacterized protein n=1 Tax=Alistipes finegoldii (strain DSM 17242 / JCM 16770 / AHN 2437 / CCUG 46020 / CIP 107999) TaxID=679935  ali  14  1....MATLKPFLDLRVQRKKD------ELYPLKISVSATRSIVFIPVKIYLAPENWNSQTCRIVKHKSKRLFNMALQEQLLSLEKKL--TVLEVSGQLANMSTREVKQ------YLVASQTVSCSARGDLIDYYEQYIDRIANASTRGTHEH---TLKKILAYDKGKLSFRDVDKAWLLGFERFL.... 165
411 8.000e-07UniRef50_UPI000680E403 site-specific integrase n=1 Tax=Dysgonomonas sp. BGC7 TaxID=1658008 RepID=UPI000680E403  ali  16  3.....TTVNVVCYRNKKLSNGES-------PIMVRVCKDRKTKYKSLGISVNPIYWDFDKNRPKTNCPN---------------RDYILKIIIDKEAELQKQILELKAEEKEFTASTLIKSKEERKVKTVHDFYSELIEEMELAGKIGNSRVYKDSLRSLESYYKDDIPFSDIDMEFLLSYEKWLR... 163
412 9.000e-07UniRef50_R6DCR7 Uncharacterized protein n=8 Tax=Bacteroides TaxID=816 RepID=R6DCR7_9BACE  ali  12  13.............................YPLVFQVIHKRRKKLLYTGYRIKEEAFDEQEERIVANGTDSAFSVTDIT-------KMNRELRKIRSTINARIRQLERTTDYFTVEDVLVPCVHKNVRQQFLRYIDTQIERKKTLKKEGMAAAYKSTRSSLAKFLNNDIRIPVIDLRFVRRYEDFLYST. 167
413 9.000e-07UniRef50_A0A2E6QSN6 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6QSN6_9FLAO  ali  14  3...........................................RYYFGSTRYTDKNGKVKYKTFKKD-EYPDIGWIKDPKNAYERQVNKKAETLLDQMIEAKNVDLRRGKLGMITEVSK---KANMIDDFKNYFQ------KKYTKKNTISGHISLLSHLTNFAGKLVPYSNVTPQFCKAFLDYLES.. 136
414 1.000e-06UniRef50_UPI000C078763 site-specific integrase n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C078763  ali  10  1....MASIKI--RFRESTVEGKMG------SCFIQIIHRRKIGVLATGIKLHAWEWDKASNDIRWTGGE---------PRRQVIVQAARERLRLVNELRDIIGWWEVNKEEYTVRMIVNEYNRRLTKGTLFSFMGGCIEELKGVGRERTSGTYCSTLKSFKDFRGQDIRLNEISASLVKQFENYLKS.. 168
415 1.000e-06UniRef50_B0N022 Site-specific recombinase, phage integrase family n=9 Tax=Alistipes TaxID=239759 RepID=B0N022_9BACT  ali  3.....TTIEAVLYTSKTLSNGQHPIML-------RLTKNRKRKYISLHISLALQYWDAEKCKPRRNCPDKERIEALIQQKTQ--------------ELQSQVMDFKTSDKEYTLNTLVEKASRKVVRQTVGEYLNGYIDRLLAEKRVGNAKTFQELRTSLTKFCRSDFYFIDIDAEWLKRYEQWLR... 163
416 1.000e-06UniRef50_G5HA85 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=G5HA85_9BACT  ali  1....MASIKLLLNKDQIHKDGT-------FPLVFQIIHRRKKKLIYTPYRIFADEFDTVNHKVCYVSDTRRSLREI--------RSINRNLGKQYRNIQSHIDALERRQTDYTVGDILSHYKVEHNPLSLLHYMDTQIRLKQNMGKDGTAAAYRSTRSSVATFIGQRVTLNQLDTTFLRGYEQFL.... 167
417 1.000e-06UniRef50_A0A0N8WAF4 Uncharacterized protein n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0N8WAF4_9DELT  ali  18  3.........VKLRKKKIKNGG-FSYYLDIYY------SKKNRKYETLGIHVYKNDSAETKKRKK----------------------------NIAEKYRAKRELELFDDIHGNRTRVY-------LNADFIKYYKKIADRKGKKN-----RYYISAFEKFADFTKGKIKFSDLNESLVNGFKDYLLD.. 134
418 1.000e-06UniRef50_A0A2E1BMB4 Transposase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1BMB4_9FLAO  ali  10  9...........LDTRRAKKDGS-------FPIIFRLTHLRKTTSISTGYSILEKYWDSQKCAIKKTYTKVEFIARLNTLLLKEEARANDIINKLYDSGKLN---------YLSITQVKSRINQNSNYVSFYRFGESLAEDLKTAHRYGTARNYTGIISVLRTFTGKDLKFNELNYDFIKKFERY..... 166
419 1.000e-06UniRef50_A0A1B6Y9T6 Uncharacterized protein n=1 Tax=Balneola sp. EhC07 TaxID=1849360 RepID=A0A1B6Y9T6_9BACT  ali  15  3.....ATINFEIREQKADANGDCPVYLRI-------TYDRKPAWLSVGFKVKSTDWNSEKQKVRRSHHRFDVLNGELLKLHSSAQDAIIELKTL-DKLNSKRVIELLKGY---------------DKKDFFTYSQNYIQDHIDKGSIRLAKNTKVIVNQIREFTNRNLPISEIDRDFIERFSTYLRN.. 162
420 1.000e-06UniRef50_UPI000D55E04F recombinase n=1 Tax=Aquimarina sp. Aq135 TaxID=1191734 RepID=UPI000D55E04F  ali  14  1....MTSVEIVLFKGKKNKEGKHPLALRI-------IKDRKPSYKFL-EYIHLKDWNAEKTRVRGSNRDYKLLNNLC----------DNEKTRASNLVRDY---DAKNKKYSSVQIINILKGKGDTIKTFFELTDLYLKEINIPSKYNHHRSEKIRFNNLKKYTNNDVHFEEITEGFLKRFIIYLKN.. 163
421 1.000e-06UniRef50_A0A1G6V8Z4 Site-specific recombinase XerD n=1 Tax=Mucilaginibacter pineti TaxID=1391627 RepID=A0A1G6V8Z4_9SPHI  ali  10  1....MITYKIVLDERRAKTDGK-------FPIMFRITFNRKTSNYSSGIALKKEHWNAQASLINSTCPNFKELNKSVASK----------FLKIQKLILKLDDEGTFSFETFKELLNDHFVPQTKSKSTFLAYANQLISEMIEEQRAGNASVYQTAVNRVINFSGKNLLIDHIDYTFIDKFKRQLVK.. 168
422 1.000e-06UniRef50_H1Y3M2 Integrase family protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=H1Y3M2_9SPHI  ali  12  1....MATIKFYLR-KTLLADGTSPLVL-------KVLKDGKPSISHIGVNLLHEHWDAQKRKVKKSHPNATKLNNYLLKKLAEANNTAIDASTVDEQISSRTLM---------------KKIKPKTGGSFFVQAEAFMNDLKATGNFNEYNANTPRIARFKEFNGNDIAFNDITVALLERYKVWLRST. 162
423 1.000e-06UniRef50_A0A1F3IQC5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWE2_42_42 TaxID=1797339 RepID=A0A1F3IQC5_9BACT  ali  11  1....MSAAKVIFYPSKVLSNGESPILLRI-------TIDRKRVYKATPFSCTKEIWDIISNRKPKKNDPKKRIPKNDILKVEQIKIFISELETKALKAEVQCRADSI---PLTHEHLLNMIFPKTTNEWVFEYLQSRISDLKKTNNLGNADVYNNLFRELKSFRGKDLKFTDINVRMINDFEQFFR... 173
424 1.000e-06UniRef50_I3CAY3 Site-specific recombinase XerD n=12 Tax=root TaxID=1 RepID=I3CAY3_9FLAO  ali  14  1....MSSIKVLLWKKNKNK--------LLHPLAIRITKDRRTSYFSIGQYIEEKYWDSHNRKVKKSHPN-------------ADKINQLILVKLAEINGCMLDSEALNS--HASVATIKRKLTVANTMDFFSVADEYLQSLIDREKYNQYISQKGRIKKLQLFVGNKLNFKEITVPFLKKYETFLLHG. 162
425 1.000e-06UniRef50_A0A099Y0I3 Site-specific recombinase XerD n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A099Y0I3_9FLAO  ali  15  3.....SSIKIVLRKKSNKKGE--------FPLAIRITKNRKTTFVYTGYYLEEKNWDVRNKKVKKSHPNSTRLN-------------NLLIKKLAEASETVLELQAKNKDFSTKHIK-RSIVKPQGSETFNSLGKRFLDELQVNGKLSRLNSDKPRVNHVINFAKETLFFNEINEDFLRRFIIHLR... 162
426 1.000e-06UniRef50_A0A2A4N1M4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4N1M4_9BACT  ali  1....MATLKLILDKRRIKSD-------DTYPICVRLVHNRKSRTINIKHYVKEKDWNDITKEVKSSHQNSGRVNLRISEKVNMAKKELLDNENKLASMSMKAVQGLVQKAMFGEQEDYG-------DMQLLQYTNKIIDRLKEARKFGTASNYEGVVYSFKNYKKKDILLSEINYNFLIDWEA...... 169
427 1.000e-06UniRef50_A0A1M5DL60 Site-specific recombinase XerD n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1M5DL60_9FLAO  ali  17  1....MINTKIVIR-KKRLSNGQFPIY-------FRITKDRKTKFFKTLFNAFEKEWDSSSGKFKKSNSNYLQYNRLL-----------LNIEERALKLLAELEIE-KEGFTLEDFEKRFRIERNPVQRNFFNFWDEIIEEMLAAGRAGNARANKDSYRSVLLFHKRNLRFRDITPSFLDKYEVFLR... 163
428 1.000e-06UniRef50_A0A239F863 Site-specific recombinase XerD n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239F863_9BACT  ali  24  3.........VKLRLKEYKS-GTKTFYLDIY-------HNNQRTFEFLEIRIDKNATSNDR----------------------------KEKKELAERVRAKRELELENYVHGT-------IPKHRKKANFNDYYQEFLNSYTKKDKR----MFRYAYEKFLDYSGKSIAAYQIDFQLIEGYRDYLK... 133
429 1.000e-06UniRef50_A0A2D7MAJ5 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7MAJ5_9FLAO  ali  15  19.................................YEPIIKMNRGYVMRFYYGYDSDTKKTHKKDVYLDLDYYFT-----PSNAWERSQNKEDKKQANQI----LEALNTANREGKYPIAKTNPLSVSEHNFIDWLLK-ATQEDGKYSDNTKKSYKALINHLKKFAGNHIPFETIDKSFVAKFYDH..... 159
430 1.000e-06UniRef50_A0A1F3PYM2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_35_15 TaxID=1797364 RepID=A0A1F3PYM2_9BACT  ali  13  1....MASVNVLIRLNKQRTDGT-------CPIIIRITNNRSVTEKFIGYAVKPEEWDEIDSKVIKSHPNSTLINHLILKKRTEA---------------SAIVLEADSNDIHLTKKQIKHKIKHHNKSSFNTVADEHLSDLLKLKKFNQHSGEIPRVNHFKKFLDEDISFQHITIPLLKKFMIYLK... 161
431 1.000e-06UniRef50_A0A0N8W6A2 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. SDB TaxID=1732214 RepID=A0A0N8W6A2_9BACT  ali  20  20........RIKIRYRKLTN--------DLYSIYFDLIIHNTRQREFLKIYL---------------------------RGTNNSYKEDKQKLNYVVSLRDFRETELMQKQHGFE------LINTKREIVFLEYLSRLAEKKNK--------NWFSMLQQFKHFLNDNLTFSEIEPKLCQEFADFMLS.. 154
432 2.000e-06UniRef50_E4MC40 Site-specific recombinase, phage integrase family n=3 Tax=Alistipes TaxID=239759 RepID=E4MC40_9BACT  ali  14  52.........IILRQDKTNQKGVL-------PVCMRITHERRSMYVTL-IRVKPENWDASRGIVKKSDLQH-------------ERLNNELRRRIAEVNKVVVLCEAMEPERGIDAVRDRLH--KRTTADMFDYAQNYLSR-KENTSVRTYNKCHSHITKFKKFIGKDFSVSHLTYELLLRYENYLR... 205
433 2.000e-06UniRef50_UPI000DE347B8 site-specific integrase n=1 Tax=unknown TaxID= RepID=UPI000DE347B8  ali  14  1....MASIKILLRDKASKEG--------LFPIVLKIIKDRKPKMISLGMECIKKDWDEANAQFKKIHPNYVQRNRVLLKLKEKALKVIDEFN-------------IEEIDFTLTQFENKFRGKKDSNTSVRTFWEDKIADLNKAGRTGNARAYLDTMNSFYKFAKNNLKFRDISVEMLDKYETHLRAT. 164
434 2.000e-06UniRef50_R7HSX1 Putative bacteriophage integrase n=1 Tax=Prevotella sp. CAG:279 TaxID=1262924 RepID=R7HSX1_9BACT  ali  22  1..........................................................................................MMEKAEAIRCRRFEQLLN-------EQFGFLDKEKLRIDFLEYFRKKCFKK--------YQKWKIVYQHFYDFCDGTFTLAKINEDFCKKFQAYLLKG. 83
435 2.000e-06UniRef50_A0A1V2AUG2 Uncharacterized protein n=3 Tax=Chitinophaga TaxID=79328 RepID=A0A1V2AUG2_9BACT  ali  16  34..........................................................................TYTKPKNQTEKNHNKQALELIDVKKSQTIIEQQS-------IGSAYIPPHKFKGNFLEYYAEYVDKNKTDSNR----ALQNSFKQFKEFVGRSVSPVDITENLCKEFRKFLL... 135
436 2.000e-06UniRef50_UPI0009DAACA6 site-specific integrase n=1 Tax=Alistipes obesi TaxID=1118061 RepID=UPI0009DAACA6  ali  17  1....MASVKVKLRLSNPYEPGTI---------YYQLTHRRQVRRLPTSINVHPDRWDARGQRIASSGREDPAPD---------------QQRIDGDMLRLRRIIDMLEARPYTVQDIVERFRADSRRQTLQALFEARIDRLGAAGQFGTARNYRRAWNSFAAYIGDTVLPDDLTESLIDGYNAYLL... 162
437 2.000e-06UniRef50_X5E4E1 Site-specific recombinase XerD n=2 Tax=Draconibacterium orientale TaxID=1168034 RepID=X5E4E1_9BACT  ali  12  1....MASVKVKLKNDLLLKDGSKAI-------IIQVLHNRKKKVFHLGYSTLDHQWDDTTNLPNSKHPDHKIIKSRLKNAVLLLKTIITDFEN--------------RHVQFSLTDVENKYKLSGSKEMFFQYTDDIIQSLRKSGKKGNAIVYKNCLDSISAFRGKDISIENIDYHFIKRFQKYLE... 162
438 2.000e-06UniRef50_R7H2S6 Site-specific recombinase n=1 Tax=Prevotella stercorea CAG:629 TaxID=1263103 RepID=R7H2S6_9BACT  ali  15  3.........ITIRQ-KALANDNISLYLDIYDG-------GKRKFEFLSLYLLPE-------------------------VDAETKARNEETLQRAHQIRAERILEVGHLMIVKEIPNDESPEVLDWIQTYIDWMSDNTDYSKAIVDQSKYLKYLMS-EFLANKRRPHITLRKFDKEWFKAF........ 146
439 2.000e-06UniRef50_B3JPA7 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=B3JPA7_9BACE  ali  13  3.....ATVNVVCYTSKILSNGEHPLMLRIC-------KDGKKKYQSLGISVNPKYWDFKKNTLKACCPNKEYIQKIILNK---QMEFQQRMLQLICEQKDYTVATLLNKDCVTFTLKTVE-----------EFYCNLIEQYACEDKCGNRLIYKASLNSIKTFTKGNIPFSDIDTIWLTKYEKWLRS.. 165
440 2.000e-06UniRef50_UPI0008A3A608 site-specific integrase n=1 Tax=Weeksella sp. HMSC059D05 TaxID=1715139 RepID=UPI0008A3A608  ali  10  30........KFTLHNYVRKKDGKVVLYLE-------LSHDGKRVKEAIDVYINPNRWLEKKQRLRAVSREDVR--------------INEILDEIENKILSIKTKYSRDGNVLTLDKFIEEYKNYNSYIDFLDFMDREINGETKIMKPGSVKANRAVYNKLRG-WKSQILFYEIDEDFFKDFLNY..... 184
441 2.000e-06UniRef50_E5X3V4 Uncharacterized protein n=21 Tax=Bacteroidales TaxID=171549 RepID=E5X3V4_9BACE  ali  10  54...............................LYYQVIHNRVVRQISTGYKLFASEWDQRSEAVI-PCQHPAGMERDNYLLSVGERIR-RDKIRLEKAIRT-----LSQSGPFTADDIVIRFHDSGQEPSFNDYIRQQIVRLKRLGKIRTSETYTAALKSFSSFMKGDILFGELSSDLLMEYEAYLKN.. 203
442 2.000e-06UniRef50_UPI000C06F8B6 hypothetical protein n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C06F8B6  ali  10  3.....ATVNVLCYKSKTLANGEHPLMLRVC-------KDGKKKYISIGISVNPKYWDFEKGRPKRNCPEREKIENVISTHLKKYQQQILTFQ--------------VEDKDYSAQSLITFNHKQVTKKTVKEFYEQLLTSMENDEQLGNWRIYVSSYNSLLKFTKKDIYFSDIDVTWLNNYEKWLRK.. 165
443 2.000e-06UniRef50_A0A2A4N306 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4N306_9BACT  ali  12  8..KLMASIAVVLDTRKQKLDGT-------YPLKLRVTHNCISRDKSIKISIRINDWSFKKHKVKSSHPNYI--------------KINQLLQHKRVEIESRLLDLMLSSSEFKVYDILGKTSRFLEAPNFKDFGYQIVNEYRDKNKIGTANSYKTAIDQLCNRLHKKITLSEIDYSLIMMFENKLVK.. 171
444 3.000e-06UniRef50_UPI0009423EE5 site-specific integrase n=2 Tax=Hydrotalea flava TaxID=714549 RepID=UPI0009423EE5  ali  18  3.........VILRKRK-NADGSISLRLDIY-------NNGQRKIETL------------------------TNLKLSKVSNIGDREENKKLMQQAEAIKAARAAELEANNYNMVSDAGKKTIITAWMQTFID-------GYTKKDKRNMQGALNRFADYLIEIKKPGLTFGNLSALIIEDFIDYLE... 140
445 3.000e-06UniRef50_A0A239LGA2 Site-specific recombinase XerD n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239LGA2_9BACT  ali  14  1....MATVKALIRQNKVNSNGQAVIYLRY-------GHHQKVKDISSGVKVVASQWDEKNQKVNSTKGIRKTKLNEDLIESKRQSDLIKIEHAKSRILQIARKLQLNKIDPEVGLVKNKYFEKERVDLELIPLFEDFVKKTSK--SDGTKANYRTAIYHLEKYLKSPLRLSNISLDLIDDFRRFLHN.. 185
446 3.000e-06UniRef50_F9Z3S4 Integrase n=2 Tax=Odoribacter splanchnicus TaxID=28118 RepID=F9Z3S4_ODOSD  ali  12  2.................................LRIHKDGKRKLVSIGLSIHPQLWDFTKNEPKPKCPNKDLINKI-------------ILDKKAEYQKEILELNAEQKDYTASSLVENKKAKYEPK-TVIDFYKELIQNFKDAGKTGNKSIYTNSLNSLKAFTHNNILFSDIDVDWLKRYEKW..... 140
447 3.000e-06UniRef50_A0A0P7YVM4 Phage integrase n=1 Tax=Bacteroidetes bacterium HLUCCA01 TaxID=1666909 RepID=A0A0P7YVM4_9BACT  ali  15  6......TFRLFLLKRKRKSNGEMPVYLRI-------TKDRKYRIVSTGVSVPEKQWNESSQTVRKSHPRHSSINARLDDILATAKETVWDM----------------PDEKKSITEVKSALSASGTALDFFGYANAFCDSLIQSKRISAYKNTKVTLRFFTSYLGKGVPFDEITADTLHGFQNFLQ... 163
448 3.000e-06UniRef50_UPI00036E2D7F hypothetical protein n=1 Tax=Segetibacter koreensis TaxID=398037 RepID=UPI00036E2D7F  ali  22  2.......IKVTLRA-KAITGDRKSLYLDIYPAIFNPKTGKKSRREFLNLYIY------------------------DQPRTLEQKRHNKKAWLQASEILINRQQLLEKGEYTDAVSNSVDLAKEKNK.............................................................. 96
449 3.000e-06UniRef50_UPI000D0F3B63 hypothetical protein n=1 Tax=Alistipes sp. Marseille-P5061 TaxID=2048242 RepID=UPI000D0F3B63  ali  13  2......TFKVICRKNIVYRDSTSPLCLLFF-------QGKRKKSIGLGVSVAPAHWDAEAQKVTDDCPDRDNIQFQITAKIKE---------------YEKRIQRLEIMELPVTFENLFGQNGKRVNCTVGDYLKQIIERLEALGKYASASKHRVLCSHLSRFRSLNIRFDEIDHTFLRDFELFLRK.. 160
450 3.000e-06UniRef50_A0A1G1T0F7 Uncharacterized protein n=3 Tax=Hymenobacter TaxID=89966 RepID=A0A1G1T0F7_9BACT  ali  17  2...........LRTKRADGDGPTALYAACFL-------EGKRKKIYLPITVVPSEWDATKQKFRRSRTNWSEDNTLLE---FLAKELDKAATKLAAQGTPATPDDLRA----LVGKLTGAAAPPPAPEGLLVQLAAWIEECRRDKTPSTIKSYRTLVGHLTAYAKINLQYTSVDADFVEGFKTYLLKT. 171
451 3.000e-06UniRef50_A0A1A7R2S5 Uncharacterized protein n=1 Tax=Gelidibacter algens TaxID=49280 RepID=A0A1A7R2S5_9FLAO  ali  18  1....MATVKTVLRKRKLAEG--------SYPISLRVCKDRKSKYFQTIFRAFPMEWNQAKGNFTGKNSNNIQNNRLLLK-----------FKDRALKILSDLEME-KSDFTLKDFENRFRIIHNPVQQNVFYFWNEIMEEFIFAGRTGNARANKGCYNSLKKFNKTQLNFKEITPSFL........... 155
452 3.000e-06UniRef50_A0A1Q6FS64 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:1060_57_27 TaxID=1896975 RepID=A0A1Q6FS64_9BACE  ali  10  2......NIKIVQRKDRIYANGNCPLFFRF-------TQKRQCKYISSGISIPQDCWNESEQRIIPSYPDSESLNYQLKEKLAE---------------YQKLIDKLTVLEIEVTFDTLFGQKSKYINCTVSEYFQQQIAYMKSIGKVGTASKYETCRHLLEHCNLGKKRFEQVDLQFLQDFEAYM.... 158
453 3.000e-06UniRef50_A0A2E2P3C2 Integrase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2P3C2_9FLAO  ali  10  5..........IVMRKKARSNGK-------YPLVLRVSHKGKARIITLQLEGKKSEWDSKASRFTPNHKF---------------KDQNFSINRIEAKAKDIILKAEVDGEQLTLDDFVASFSNKVSSNSLVHFIEQLIIDQKAIGKLGNAKAYKDTLNSLVSFAGDRIPFKEVTPLFLNNWELYLRK.. 161
454 3.000e-06UniRef50_A0A1F3BIZ6 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3BIZ6_9BACT  ali  12  23..............................PIYGRITVNGKRAEIALKIFIEPDRWDSSKGYVKGNKEDAKNINNSIDNFIIRVRKIYETLLNKNELITSEIIKNILIG---------KASEKVLLIEYFESYLKEMQDLINIDFAKGTIKNYKVTKNHLFNFSKKDISFSELEYSFVTKFEYYLK... 174
455 3.000e-06UniRef50_A0A0M9UG11 Uncharacterized protein n=1 Tax=Candidatus Symbiothrix dinenymphae TaxID=467085 RepID=A0A0M9UG11_9BACT  ali  15  28..............................................................................ERTPADKAKNDETLRLANAVKSQKIVELQNN-------AHGFSNVTRSKVNVIDYIKTLADKKRGGKERGLFQGYNALTYHLEQYSGKK...................... 112
456 4.000e-06UniRef50_A0A286FZA7 Site-specific recombinase XerD n=1 Tax=Spirosoma fluviale TaxID=1597977 RepID=A0A286FZA7_9BACT  ali  15  1MSKVISIRVIYNRRDELDKNGKAPISIEAY-------HNGKRQYESTGIRLTPAQWDSKKNEVKG------NPQLNRVIRESILEMENFIFNFSAKHNRPCTLADLKTMR--------QAVTPTREKLTFTTHFAQQLERDKPALGRFTILRRQLVLKRLTAFHKPHIEFDAFTLDFVERYTVYLRTS. 168
457 4.000e-06UniRef50_A0A1F3MR05 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_49_14 TaxID=1797354 RepID=A0A1F3MR05_9BACT  ali  13  1MKRTTFKTIFYLKRQKENAKGEVPIY-------MRVTVKGDRAEVCIQRYTLADNWNQKTGRTKARGTQATLLNEYLQQCENRVYEVQKELEHICRDVTAAAIKARYNG---------ADPDKRFLLKEFDTFITKKAELVGKEITQATIQKYRMCFSHLKDYLGKDIAMSSLTFEVIDGFDHYLRT.. 176
458 4.000e-06UniRef50_A6LEY8 Tyrosine type site-specific recombinase n=19 Tax=Bacteria TaxID=2 RepID=A6LEY8_PARD8  ali  1....MATLKIVLHTANLRKDGT-------YPVSLRVIKYMKTKYCSTGLYAHLSEWDERAERFVNN-----------KKICPMNKEYNARIIELVARAQAVILQFDRDGIDWTLNQFEEEFTHKTKKGKFLDYANKIIKNLKETGHNTTSKIYEAVIHNLSLFDPKSRLLQEIDIKYIHAYNSFMEK.. 167
459 4.000e-06UniRef50_C6ILM3 Uncharacterized protein n=16 Tax=Bacteroidales TaxID=171549 RepID=C6ILM3_BACT4  ali  13  1....MATIKVKLRP--------SSVVERAGTIYYQVTHRRATQQITTNIRLQPDEWDTIGEQVVVSVADKNIIQNRIDSDIALLKRIVKDLNN--------------SGVTYSVGDIVKRFKSPECHVLVLDFMQNQIRLMRNANRLGTALNYEKTMKNFVKFLGGNLPFSAMTEQVIADYNAFL.... 160
460 4.000e-06UniRef50_A0A1U7LFJ0 Recombinase XerD n=2 Tax=Butyricimonas synergistica TaxID=544644 RepID=A0A1U7LFJ0_9BACT  ali  10  22...............................PCIRMIQDRKASYVSIGFALNVEYWDFENQKLSDNCPVKEHYQQLIDEKL---KEFNK------------KIIYLEALGYEVTMDNLLGREGKNHNTVFV-YFRKIIDQLKEKGTIRTAGKYESCLQSLIAFKSLDISFLEINLQFLNEFEIFLRK.. 161
461 4.000e-06UniRef50_A0A1W1YMK1 Site-specific recombinase XerD n=1 Tax=Moheibacter sediminis TaxID=1434700 RepID=A0A1W1YMK1_9FLAO  ali  13  2..KNSYSVKVVIRNEEEKRKGNGT-----YPLYYQVIVNSKKTKFSSGHSLHLSDWDFKKSLPKGL-------------SNATLRKKLEQEVRKLENILLEIDISGKPMTRELIREKYLGTDDGKNTRDFYYHFDEFCNKKFLEISKGTSNHYALLKKQLKEY-KPNLLLEEMDYKFFKDFFHYLRT.. 167
462 4.000e-06UniRef50_A0A2N0VMB0 Uncharacterized protein n=1 Tax=Rhodohalobacter barkolensis TaxID=2053187 RepID=A0A2N0VMB0_9BACT  ali  14  9...........LRKDKERANGECPIYLRI-------TKNRKSRYNSTGIYVLPKHWNDEKEVIRKTHRNXXXXXXXXXXXXXXXXXXXXXLGVFGKDSAKTIQERLKQQESG----------------DFFELASTYEKELQERKKLSTVKTLGVVLNKLEAFEGDRLPLKHIDAEYLERFEGFLK... 161
463 4.000e-06UniRef50_A0A1I2L287 Phage integrase SAM-like domain-containing protein n=1 Tax=Salegentibacter agarivorans TaxID=345907 RepID=A0A1I2L287_9FLAO  ali  24  12....................................................................................................................KYGIKDKSKDRLLFLSYYDKLKEERY--ESKGNYDNWDAAQNHIEAYCGKKITFEDIDEDFVIGFKKFLNH.. 81
464 4.000e-06UniRef50_A0A1H4AFW7 Site-specific recombinase XerD n=16 Tax=root TaxID=1 RepID=A0A1H4AFW7_9BACT  ali  14  4........RVILRKDVIYKNNTSPLCLLFF-------HDNRKKSVGLGVSVSREYWDAEAQKITDDCP---------------DRDDIQFQITAKIKEYEKKIKKLEALEIPVTFETLFETIGKRMDCTVGDYFRQIIDRLEKVEKYGSASKHKVTLALMQHFKSTNMRFDELDLTYLREFEIFLR... 159
465 4.000e-06UniRef50_K1MZ69 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=K1MZ69_9FLAO  ali  14  39...............................VYMSITSQGKRKRVPVDIYVNPINWDDTKQRVKN--------------KTENAETINLLLDQMSARISDIRIHYRLSNLHLSIDKLLEELKSKTPNYDFLAFMQNYLDNC--VMKAGSYKKNISEINKLREF-KSFIPFSDITLQFVDKYKAWLSN.. 177
466 4.000e-06UniRef50_A0A1J0LK83 Tyrosine recombinase XerD n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1J0LK83_9FLAO  ali  17  3.....TTIKLVLDGREL-SNGKHRIYLRI-------IKDRKKKNISLGL---------------ESKKDHFKNESFTKQHLNYQIENELLLQFKARAFKIIRELQLSQDDFTLEFEDEFRGVKNNNRLKVIEFFNEIIAEMIKSGRTANGEAYKDTRDSLVKFRGKDLCFQEITPIFLEKYEVFLR... 161
467 5.000e-06UniRef50_A0A090Q138 Uncharacterized protein n=2 Tax=Nonlabens sediminis TaxID=319236 RepID=A0A090Q138_9FLAO  ali  17  3.....................................STGDRKRLPLDIYIKPEHWNAKSQLISKKCEHSVDLNLIL---DQVKSKANKIIVNY-----------RLSEQTFTASDVLDAITNPNARVCFNVFAMEHLNNNRELYTHGTYKAHKSVLKKIKEFQNP-LYFNQINNDWVNSFKKWCVKAP 139
468 5.000e-06UniRef50_A0A0E2AU17 Uncharacterized protein n=8 Tax=Bacteroides TaxID=816 RepID=A0A0E2AU17_BACFG  ali  12  1....MITIKVYLRKHNQN--------LTTGVVWVSFYINREKVNFSTKVTVEEKHWNDKKKCV--------------APGDKLCNDKNLIIENVLSRINNVLVKYRLRDKKLTRSSFLKAYHRPSDYNTFYEFIVDHQKKISSRMEMTTLATHLSVINKLKEY-NVNLSFDDITKDWLDDYFCYLRK.. 160
469 5.000e-06UniRef50_I3YPG9 Site-specific recombinase XerD n=17 Tax=Bacteroidales TaxID=171549 RepID=I3YPG9_ALIFI  ali  11  21..............................PVHLRLTQNRKLKHISTGVTLNINEWDFENQRVMGQTPELQALQLRIDTKIDELRRKIKRLEALEVEVTLDNLLE---------------TNGRKINCTVGEYLKQTIERLETLGKYGSASKHRSLLSRLSQFRSLNIRFDEIDLAYLHDFELFLRK.. 162
470 5.000e-06UniRef50_UPI0008722B72 site-specific integrase n=1 Tax=Crocinitomix algicola TaxID=1740263 RepID=UPI0008722B72  ali  20  4.........VHLRERKLK-DGVVGFYLDYY-------VSGTRYYETLDIKIRPEYDKKTQKALR----------------------------NKAESILLSKRSAILVNQHPEVFK----RDLERGRGNFFILFEEM-KELRKQTSPNTYSVWDNVEKLLEKFHGKQLEYRHVNLNFCQRFLAFLRK.. 141
471 5.000e-06UniRef50_A0A098S9U9 Uncharacterized protein n=1 Tax=Phaeodactylibacter xiamenensis TaxID=1524460 RepID=A0A098S9U9_9BACT  ali  13  26...............................IQLRFNINGRRTHFSTSINIETKHWNPKRQRVK-----------QVRGKEDVHRDINQRLERFAEIAQEIFVDYDYGRDLTPELFKEQIEDPNAKATNLFQFAEQFIEQTKPNAKRGTWKKYLTVFNHLREFAKDTLGFSDIDWQFRNDFINWLYSPP 185
472 5.000e-06UniRef50_UPI000D6B6EED hypothetical protein n=1 Tax=Dyadobacter jejuensis TaxID=1082580 RepID=UPI000D6B6EED  ali  13  14................KKKDGTHNL-------QIRITQNRKSKRITTGLSILPNNWNPEKCEVRKADPQY--------------RQKNALLKSKMLELESTYLEASIQDKALHPEKLILQLRREVVGSNFFEYAKTRIARM---SSPSTRKGMSSVVKKLYEYRKSDLFFSQINYEFILNYERYLKK.. 161
473 5.000e-06UniRef50_A0A2S7SQR9 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium RB1R16 TaxID=2077091 RepID=A0A2S7SQR9_9BACT  ali  14  6........KLFLDERTAKGNGQYSLKL-------RVTYNRKHKVVPLNVILQKEDWNSTTQKVKPSHPNAKLINI----------KVNQTLNEIQE-----KALKYETLEKVYTVDDLSCTNNPNTLTTFNAFAENEIASLMNAGRVGNANAYRDASNKLIRFANKPIRFENIDYKFLEQFTQSMLS.. 163
474 5.000e-06UniRef50_A0A1Q3WGJ0 Uncharacterized protein n=3 Tax=Candidatus Amoebophilus sp. 36-38 TaxID=1895716 RepID=A0A1Q3WGJ0_9BACT  ali  15  2......KISIILYKSKTLSDGSHPL-------MVRVSEFKNRKYLSTGLSCPAELWDFDKHTPKRSHPNRKLLDAIIAQKKAMY------HTKLLELESEQRKLSIQQ------LVQAIEGPKQVTQGSF-PFLSEVCQNLIQSGKIGRARLYKRLLTSLKEFTNKQLSFTDIDAPFLNRYEAFL.... 161
475 5.000e-06UniRef50_A1ZTI2 Integrase n=2 Tax=Microscilla marina TaxID=1027 RepID=A1ZTI2_9BACT  ali  13  8........................................KPYRLSLGYSAFPNEFDTTKGRFRKSHPNAKAKNLNIRKHELHASEIIEEFIRQGERFDYQKFKKLFKGE-------------KDDTRTFYQFFEEMIAEKKSLGKAGTLKAYKDAYNTIKKYHPKDFSFDKLNYNLLKGFET...... 137
476 6.000e-06UniRef50_UPI000DAD86BB site-specific integrase n=1 Tax=Spirosoma sp. HMF3257 TaxID=2183553 RepID=UPI000DAD86BB  ali  17  13............RAGKLGKTGKAPVVIEAY-------QNPDRRYFSTGVKLKPSEWDKKKNEVKGNPAYNATISKQ------------KAVLEDFELRFPSLYGRAFSLDDFDLMKNQDMVIKPKKQQSLTAFMLEQIEKDKSKLSYSAYTRYKRTVSNLIDFNQGQVLFIDLDYEFVENYERYLRDT. 170
477 6.000e-06UniRef50_A0A223VAL1 Recombinase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A223VAL1_9FLAO  ali  14  18.............................FPIAIRITKDRRSSYLFTGQYIESKFWDDKFKRVKKSHPNSKRLNSLVAKKIAEAND---------------RLIDNENQNNSQSAKKIKKKIIGKTKMDFFEASKLFLSNLLKRKKFNQHYNQEKRLDIFKTFLGKKLFFTDLDVTLLKDFKAYLL... 160
478 6.000e-06UniRef50_A0A0C1XDE1 Uncharacterized protein (Fragment) n=1 Tax=Aphanocapsa montana BDHKU210001 TaxID=1574475 RepID=A0A0C1XDE1_9CYAN  ali  15  1MATHFKKIKFSVRNNILNQDGEALIQVRAYSPAEQ-----RTRFFSTGIYIEPDHWDTTHRRVSESHISELHLNDLIHEQIKGYKKRELELL----------QRFGAAPLRLLENPAAEDAPDLNPYLTFTEFFEREIE--RPELQESTKRQHRVTLRYLKRFHG-NVLFSDLKYSFLSSFNKFLLS.. 172
479 6.000e-06UniRef50_A0A0U2XPM9 Uncharacterized protein n=3 Tax=Myroides odoratimimus TaxID=76832 RepID=A0A0U2XPM9_9FLAO  ali  15  31........KVILKKENRRVDGTCPLYIQVFL-------NGERKLIPLRICVVEDCFDKIKQRVKRKHKEYL--------------DLNLIIEKVLAELNEIEVAYRLSKRLLTLPLLMNEYENPSAQYDFLTFYESELEKEKKVLAPASYVQQRAVLRKLRRY-KERILFHEFTEDFMQEAIHYFKT.. 187
480 6.000e-06UniRef50_K1M2N1 Uncharacterized protein n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=K1M2N1_9FLAO  ali  16  14.KLEAMKYSFFLKKSYVNKEGKCPLYLNLY-------IHKQRKRIPINLFITPSEWSKSTQRISKKCENHF--------------DYNLILKNIESRINEIEIQFRLSNQILTVDKCADLLKRPDLTIDFISFVEY--EMSLKLMEENSIKNHESVLKKLKKY-KQNILFADINELFIAKYRQYLAT.. 175
481 6.000e-06UniRef50_A0A255SMP0 Integrase n=24 Tax=root TaxID=1 RepID=A0A255SMP0_9BACT  ali  13  1....MTSIKLKLRTSSVEKEGR---------LYYQVIHNRVVRQIHTEYRIYSSEWDAVHSSVILPSSATPRQTYLLSLKDTLDADRKKLQLVIARLDK--------EGQSYTADTVVGNFHEGKELHGIIGYTQELNEKLRRIGKKRMVARYTTTLNSLQRYKGDDVPLEEIDGTMIQGYEQWLKDS. 170
482 6.000e-06UniRef50_A0A2N5Z685 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z685_9BACT  ali  14  1MRRSL-KYKILLRKDWIRADGTALLYI-------RLTSGSKVKYINLNYAIDPKKWDFQK---NYPKTGLKNYELICNYIDKTQIKVDKAILNLN-----------IKDKALTFSNFENEFFGNSKDSCFYEFAEQEIQLMKGKIQNCTIRNYNCELTKLKKFR-PDILISEIDTDFLSKYESYMRN.. 164
483 7.000e-06UniRef50_A0A016FU38 Uncharacterized protein n=1 Tax=Bacteroides fragilis str. Korea 419 TaxID=1339269 RepID=A0A016FU38_BACFG  ali  21  1....MSKCKVTLRLRKVKNGTQYSLCLDYYPGYRDNITMKVITREALGIYIFAKPANQQERDFNARMMKKRRY.................................................................................................................... 70
484 8.000e-06UniRef50_A0A1S2VAB8 Uncharacterized protein n=1 Tax=Arsenicibacter rosenii TaxID=1750698 RepID=A0A1S2VAB8_9BACT  ali  14  1MKTSM---KVIIKDDYVKKDGTSPLYLQVF-------INQEMIRFPLDISWPPPFFDKSAGRLKARSKTDKDLSDYQIIIQSKQGRVNEIFK-----------YYRLSEKPLTVEILKKEFYNFRLKQDFLDFWNREMEDRYRRRKKGTYVCHSASLSKLKEFRST-IAFGELTPKLLENYRAWLKT.. 167
485 8.000e-06UniRef50_S0GSH3 Uncharacterized protein n=4 Tax=Parabacteroides goldsteinii TaxID=328812 RepID=S0GSH3_9BACT  ali  15  7..KNKTTISVNLKRRQGTDNNRET------ALYLQVIYRRKVRQISLPYKLHEDEWDENRQLAIVPPGCLPERYLYL-------MEINQKTSEEKQRMQTVITRLPKNKEITADMIIESYKALLRGN-TFIAYIEQIIKQFAAEDRNASVRHYRSLHNSFLKYLPENILLNDIDEELIKKYESWL.... 176
486 9.000e-06UniRef50_D0TH75 Site-specific recombinase, phage integrase family n=22 Tax=Bacteroidales TaxID=171549 RepID=D0TH75_9BACE  ali  13  1....MATVKVKYRPSQEEKEGTI---------YYQIIHNRVIRQIRTDYRIFREEWDNGKHAVVITTGDREAFLRTV-------REGVARDLKRLNAIIGRLEGD---GGNFTADDVVKKFQEPADEPCFFSFMEEVIARLKRLGKTRTSETYTAALNSFMRFRGRDILPDEIDSDLIEEYEVYLK... 165
487 9.000e-06UniRef50_A0A2A4N9U7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4N9U7_9BACT  ali  18  3.........VIIRYRKVK--------------RRNGRAHGENYRVYLDIY----RRGMGREYEYPENLYVSKDYTKCDNILAVDRD----SMDFALRLKTTFNLEILNNRYG-------FISNSKRKTKFYSYAKQVSEE------KGKVVCYKSPLNKFKEFAGEDITFDDIDRDVIKKFMIFMRT.. 145
488 9.000e-06UniRef50_A6LBG2 Integrase n=86 Tax=root TaxID=1 RepID=A6LBG2_PARD8  ali  13  1....MATVKIKFR--PSSVDGREG------TVYYQVIHGRVARQINTSYKLFPAEWDKRHSRIVIISPDKDRQQYLL----SLDKKITEDIDRLENVIT---VLERKGGAFTADGVTSAFHGEHRGLF-FLVFMREVINGLKYLGKVRTVETYNSALNSFMRFMGKDVPLRDMDFDLIIAYEAWLKS.. 168
489 1.000e-05UniRef50_R7JI56 Phage integrase n=1 Tax=Alistipes putredinis CAG:67 TaxID=1263036 RepID=R7JI56_9BACT  ali  14  1....MASVKVKFRPS-TIEGKEGTIY-------YQIIQNRVIHQLKTDYRIFTDEWNEAGSCIIVVSSERSNLLLSLQERMEWD-------LKRLDMI--IRQLD-NRKAAYTADDIVASFQNNTEGQSLFNFMQGIIARLKQMGKIRTAENYSCTLKSFMQFRGEDVLLSEIDSDLMQLYEAYL.... 164
490 1.000e-05UniRef50_A0A1V5W554 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W554_9BACT  ali  13  13.....TSIKVILYTSKTLKNGEHPIML-------RVIKNRKSKYISVGHSCDLRLWDMKNERPKKSHPNKRLLDILIETKIQ-EAHKNLLSLEI-------------NQGHFSVESITKKIRNDIPNKNVYEFIDSIVEQKRLESKLGTSGVYKQTKAMLIAFTKNNLLFSDITPSFLHKYESFFR... 173
491 1.000e-05UniRef50_A0A0P7AUB0 Integrase family protein n=21 Tax=root TaxID=1 RepID=A0A0P7AUB0_9FLAO  ali  13  11............................CFPIILRLTHFRKTTSIKTGHYVPEEYWDNHRCKVKRNFPDVDSVHLLNTLLLKKQLKAQEVINRLADNDQLDRL---------TAKDIADKIVNRKRLNSFYEFGLQKAEELIREKRIGTARNYSGIIGRLKVFTNNDLKFNELNLEFLKRFERHHLSKP 163
492 1.000e-05UniRef50_U5Q8H9 Integrase n=24 Tax=Bacteroidetes TaxID=976 RepID=U5Q8H9_9BACT  ali  15  1....MISFKTVLKKKKLSTGK--------YPIYLRITKERKSVFFRTPYTCLEKEWNKKQGKFNKNAPDYL--------------KRNRILLKFIDRATDVVTELEQKKGFYTLTDIESRIQSNPVYKNIFAFWEEIISDMIKAGKTGNARVNSDTLKSVKNFHNKSITFEQITPAFLEKYEVSLR... 163
493 1.000e-05UniRef50_A0A1H5HMC7 Site-specific recombinase XerD n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1H5HMC7_9FLAO  ali  12  25........KIAMKKDYVRKDGTCALYIQLFL-------DGKRKKIPLDIFVQPKMFDERKQ--------------LIKGTSQTVKDYNLYINKKKADINKIAVRYRLSETYLTFERLIEDLTNPTSKIDFIKFCEKEIEKQKDILKPGTYRQQFSTLTKLKKFR-QQILFNDINEDLITELIVY..... 178
494 1.000e-05UniRef50_A0A2V3PKH0 Site-specific recombinase XerD n=2 Tax=Dysgonomonas alginatilytica TaxID=1605892 RepID=A0A2V3PKH0_9BACT  ali  10  105...........VKKDYDSKSGLTPLYVRYNYDRT------KRTLISTGFSIKYEHWDDKKKCVKRVCPEY----------DEIEVVLNKIYMRLSNILAFANENDLDPTIDFILKEVEREYEQKQARINMFDLLEKYIVEKTPMVSIDQVKDYKTLRKHLKEYSSQPVTFRNLNMKFYNEFMDYLSN.. 269
495 1.000e-05UniRef50_D4INN9 Site-specific recombinase XerD n=5 Tax=Alistipes TaxID=239759 RepID=D4INN9_9BACT  ali  14  2.................................LRISKEGRRTMKSLGVSVDPKFWNFDTNQPKPNCPN---------------RQLIRQIVLKYETEYNGKILTKEINEEEFTPQTIVAEQKERIKQTVEEVYKAIIAELKERGSAGNAYAYLNSYNVLKSFNRDKFTFSRIDADYLEKFEEWMR... 143
496 1.000e-05UniRef50_S0GI81 Uncharacterized protein n=1 Tax=Parabacteroides goldsteinii dnLKV18 TaxID=1235789 RepID=S0GI81_9BACT  ali  13  8.............QKRVNKHGEAPVYISFY-------INREKIEVPTRISVPPTYFDKESGIIKKSYEF--------------ASDKNLIISNIKATINDILVCYRLRKERLTPDLFWKEYNSPRNHQDFYEFCEEYQRLRFQEVASATQKKHRSSINKLKAFQQE-LSFDQLTTDLFRRFVLYLRN.. 159
497 1.000e-05UniRef50_A0A1M5C7F1 Phage integrase family protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1M5C7F1_9BACT  ali  10  3.....ATVSAILYTSKTLANGEHPIMLRVCY-------NGKRAYKSIKISCLSKDWNKEKEEVRSKHPYS----------NTLNSIINKELSLLKEVVLDYERTEKPYSAKTLVEEISKPLPSRKTLLELID--DRVQYFKIEKGEYNTSTGYRTLYNLIKKFSPKDYELFEINRDWLREFETFLRKT. 167
498 1.000e-05UniRef50_A0A0J9G941 Uncharacterized protein n=3 Tax=Parabacteroides TaxID=375288 RepID=A0A0J9G941_9BACT  ali  20  7.........VTLRTR-PLKGRMMSFYLDYYPGYRDKETMKVIRHESLGIYVYANPRNKREQSKFFIYHFFCHLITLSNPSISLTRQHFQEAL................................................................................................. 91
499 1.000e-05UniRef50_A0A174IZ74 Integrase n=12 Tax=Bacteria TaxID=2 RepID=A0A174IZ74_BACUN  ali  11  1....MSTVRVIQNKQRLTKEGNAPLYITFYLG---------------------KEKLMLPCKVSVPAAKFDEKSGLLKGNSKEAKDINLIVSNLKARVNDILVKFRLRNQALTKDIFMREYNNPSDYKTFHDFVKEHMKTYSRRIEMGTFKHHLSCMKKFKAY-NELLQFQDLTPDYLTDYLIYMKK.. 161
500 1.000e-05UniRef50_F8EEF7 Integrase family protein n=1 Tax=Runella slithyformis (strain ATCC 29530 / DSM 19594 / LMG 11500 / NCIMB 11436 / LSU 4) TaxID=761193  ali  15  19...............................IQIRITHNRKLKRIALEYAIPLADWNPEKKEVRKSNPLHLPINAAIKIKVLEAQQ---------EALRSHIQ-----DKPLTATQLKKRLKKQISGDSFIEYAQKRVDETVNPSSKSN---LQSTLNKFKEFLKEDLLFPELDYDLIKSYQRHLKK.. 158
501 1.000e-05UniRef50_A0A1M5K1J4 Site-specific recombinase XerD n=1 Tax=Aliifodinibius roseus TaxID=1194090 RepID=A0A1M5K1J4_9BACT  ali  12  4......TINFTLLKRRQRDDGTIPIYLRI-------TENRKSSYRSTGFWVKQKDWDNKEQEVKGSHRRYKHINIKL-----------RRLYREVETVRD----DLEINGNLSKDTLLDAISEDKDNRSIINQGEIYRTYLQDEDRYWARRHFKVVLGNLKSFIKDRKKPDQLDSQWIEDFQDYLLT.. 165
502 1.000e-05UniRef50_Q64VF0 Tyrosine type site-specific recombinase n=54 Tax=Bacteroides TaxID=816 RepID=Q64VF0_BACFR  ali  13  2.......TSITPRLNRSREGRDGS-----YPLVIQIIRHRKKREIYTPYRFWEAEFNTRLEMVENVGGNRHRL--------PIVREANEYLIYIKKELEAIRSLEADKGSAYTVDDIVHVYNYHNDLTQVLVYADSVIAGLENKEHQGTAANYRSARRAFEMFLGGPFSFEELTPEVLDRFVSFLR... 169
503 1.000e-05UniRef50_A0A1G9WZ03 Phage integrase family protein n=9 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G9WZ03_9FLAO  ali  10  21.....TNITLSVDTRRKRKDGM-------CPIIFRLSHHRKTIAIATGLAVPPEYWNQKNREVKRTY----------NGVSSVARLNNLLVKKKTELRDGINELEENGQLKGLSITELKYRTKPTITISFFDFTEQLISEMEEANRFGNAKAYRCALGALKNFNKKELRFEEMTYTYLKRFETHLKKG. 189
504 1.000e-05UniRef50_A0A1J5KRG2 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1J5KRG2_9FLAO  ali  10  3.....TTIVLSLDKRRKRKDNTFPLVL-------RLSHKRKTIAIPLHYFLEEKYWDEKNRKIKSSYKGTQSVTWLNNFYQKKRVDALDTVTKLEETTELDRL---------SVTQLKERIINVYQKASFYSFTEKLIARLVETKRLGTARSYKDTLRVIKKHKKEDFPFEELNYDFLQKFDNYFLRS. 170
505 1.000e-05UniRef50_A0A2D0NCF6 Uncharacterized protein n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NCF6_9BACT  ali  13  2......SLKKILWKYDPHKDGRCDIKIYVY-------QKGKQRHYSTGLAVLPKEWDERNGIVKRSHPNHKVYNTR------------------------IRKLYLELEEHFFSGGNFDNFGQEEQKASLLSFCEEVADNGQYNLAEGTLKGYRGLLRRMKEYCQQDIYFEDIDMAFYRKFSDYLTT.. 158
506 1.000e-05UniRef50_A0A174FIW3 Site-specific recombinase XerD n=4 Tax=Bacteroides TaxID=816 RepID=A0A174FIW3_BACUN  ali  13  9....MATFKVLLHSSNRRKDGT-------YPVSLRIIKNMKAKYISLGLYSKKEEWDVIGERFRCDKRVCPNYKEFNA----------RIVQLLARAQEVERHFEFDRIDWTLNQFEDAFLYKDK-KGKFLDFALLCIKDMKETGHIGNAKVWEKVICNMKLFDKKTRYFQEIDIKYV........... 166
507 2.000e-05UniRef50_A0A2A4N9Z0 Recombinase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2A4N9Z0_9BACT  ali  14  1MERTTFSILFYIKRSKLLKNGDAPVYVRI-------TINGVSDEVSLKRSIEPKLWDTKRNKAKGSSEEARQLNDYLNSVRGQIFYHHQQMQEKGKTITAKL---LKNTFLGIGEKQWTLVELFAEHNN------EMRNLIGREYAPLTLQRYNAALKHLRIFMKDDLPLTEINHKFISGFEFYLKS.. 176
508 2.000e-05UniRef50_H8KL46 Site-specific recombinase XerD n=2 Tax=Solitalea TaxID=929509 RepID=H8KL46_SOLCM  ali  14  1....MATVNLCVRPEMKDNNGLMPIYMIF-------QHRGKRFKHFTGLKVPQESWDAKKQEIIEFNGNTEKWNHTL--STQKIKLLNATYHILREHEDADVQE----------IKEAFYKDLFKGGSEFFEELAEYIEESKKTKKESTVFVYETLIKDLKLFADYHISFNNLNTEFYVQFTGFLEKT. 168
509 2.000e-05UniRef50_A0A1I1NW06 Site-specific recombinase XerD (Fragment) n=5 Tax=Flexibacter flexilis TaxID=998 RepID=A0A1I1NW06_9BACT  ali  19  17.....ATIAVAIDKRRQKVDGTFPLKLRI-------TFRKERQYISIDESVSLADWDK-----LKTASVRGEQLKKLKIKITAIEHKAQLILSTMGVFTFRRFIELYNGKSANAAVSRK----------VINYFQTFIDNLLDEGRIKSAWGFNGALNSLRQYAGKNLYFEDITPSFLRKYEDALLK.. 177
510 2.000e-05UniRef50_H1Y5R0 Integrase family protein n=4 Tax=Mucilaginibacter TaxID=423349 RepID=H1Y5R0_9SPHI  ali  15  43.....................................................DLWDATKQQVKKSHPHHMRLTNFLIKRLA---EINEKILEFETDRKRYSAEDVVNA---IKPKPIQEPPPAPKPPLFKDVADNYLQEQKGLGNYDVWKSDRSKLKRFYEFAGEDVTFPKITVEYLRRYTLFLRTG. 171
511 2.000e-05UniRef50_R5URA9 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=R5URA9_9BACT  ali  15  10...........IRKDKILKNGK-------YPIYLWVRVMGEAIRVPSGYEIEECLWDNKEKLPKKNPLRTVIGNIKSDLETFLLTEQGMGGELSLNLVRDYF---------------GGKKKIKPENGSFYDYYLEFVENKKKAGKDDTIRIYNNTYAMLKEFAPK-LKICDINLKFIEKFDAFLRD.. 163
512 2.000e-05UniRef50_A0A1V6E9T6 Tyrosine recombinase XerD n=1 Tax=Spirochaetes bacterium ADurb.Bin110 TaxID=1852908 RepID=A0A1V6E9T6_9SPIR  ali  23  3.........VKIRQKKN------HLYLDVY-------EHGRRSWEALGLTVPKDTTGR------------------------------REVMALAEEYRRKREMQLFAQRHLLT-------DPIRIKIKLIDYAEEKASAYDKQ------AHLPKSLKYLRSFAG-DVLLKDVDETFVDSYRAYLL... 122
513 2.000e-05UniRef50_UPI00094BAE7E hypothetical protein n=1 Tax=Algoriphagus marinus TaxID=1925762 RepID=UPI00094BAE7E  ali  13  3....VTTANLILQKWRPAKDGKFPVVIRVY-------SDTKRRYFRTGVSIPEKDWDEESASITGR---------------ARDNKKIQGLLEKAKEIIKKILVLQDEFDFDRFSLEFSDASPLQSGENFISFWESVIKELRAEKRMGTAASYENALNKFRKFMKDRIPIRMISQHTFEKFRIFM.... 162
514 2.000e-05UniRef50_UPI000A007550 hypothetical protein n=1 Tax=Cellulophaga geojensis TaxID=935699 RepID=UPI000A007550  ali  23  2.......................................................................................................................LKIIRREKTLLLDYYKKIQEERY--ESKGNYDNWEAAFKHLKRFSKFNIAIKDIDEDFLKGFKKYL.... 65
515 2.000e-05UniRef50_D4INW2 Uncharacterized protein n=1 Tax=Alistipes shahii WAL 8301 TaxID=717959 RepID=D4INW2_9BACT  ali  14  11.............KSKTLANGAHPLMIRLC-------KDGKKKYVSLGVAVLPQFWDFEKNKPKRNCPNKIVIDKLIASKMAEYNVLVVDMMA--------------ERKEYTPRSLAQAVEQKTQGRTVAEMYGRLFAEMKKMERLGNLAVYKYSFNSLMSYTRNDIPFREIDCVWLKRYEEWL.... 163
516 2.000e-05UniRef50_UPI000C150DDE site-specific integrase n=2 Tax=Parabacteroides sp. Marseille-P3668 TaxID=1944636 RepID=UPI000C150DDE  ali  10  10..........IIQKGKPKADGRV-------PIMARITINGKMSHFSTKFDILPERWLPKECKTLGQTPDEKIINKSLNDLMVLVKGRYNEMVRIGETLTADK---LKNSVMGLDTNATRLLE------YFDTYNNDYAQTVGKTSTQKTYSRYLLTRNRLEKYRVNDILLKDLTLRFIKEFDIWLKT.. 175
517 2.000e-05UniRef50_UPI000380BA91 site-specific integrase n=1 Tax=Rudanella lutea TaxID=451374 RepID=UPI000380BA91  ali  14  13............RANRLDTQGKAS-------VIIEAMMNGRRRYFKTGIRLKPAEWDKRKNEVKGNPSY-----------NTLIRDRIRELETFELRFPAIFGRPFTLDDFDSSTDNQSSSDSKAPALTFTEFVIRQCEQDKHKVSEDTTQRYLRTNEYLKLYNKDPVQFKDITYDFVEGFESWLR... 169
518 2.000e-05UniRef50_UPI000B93F0BA site-specific integrase n=1 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=UPI000B93F0BA  ali  15  5......KINVLLRTDKVNSRGER-------PIIITLSVANQLKKINTSFSVFPEQWDKAKKQVVYLNKANASKDSDTLPLKQEVNCINGDLLKIKNDINDIIKLKIIQGDEYKNKRGGKLAKKEEATNLLFEYIDKYIFENSLSRVKGSLSVYKSLKTHLQSYQNEKVKFSEMTHDFVQDFQNFLFT.. 195
519 2.000e-05UniRef50_UPI00068026BB site-specific integrase n=1 Tax=Dysgonomonas sp. BGC7 TaxID=1658008 RepID=UPI00068026BB  ali  10  14...........VKKSNALRDGKVPIYLKI-------TVNKRVAAVSLQATVLPNLWDPAKEKSRAKDKSAIELNNYINSAKAKITTMYRELELDGKHITAQLLKDMYLGNHEDEEKGKTLVEVHSDHN------ERCRKLLGVEYSQSTIYKFDTSLKYLKEFMSEDIPLKDINEDYIRKYELYLKT.. 181
520 2.000e-05UniRef50_A0A1M3FZW0 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3FZW0_9SPHI  ali  12  4.....TNVVIALDTRRKRFDG-------AYPLIMRLGHFRRTTSLPLGISLKEKDWDDKAKVVKRSYTGTETVSRLNNIIQKKRADAMDIILKLHES---------GILSTLSVAELRSRIDQKDQSPSFFDFASEQIAALRKANRIGTAKSYEGTVAALKTYNKGDLKFSEITYRFLMSFENY..... 189
521 2.000e-05UniRef50_UPI000782B6C7 recombinase n=2 Tax=Aquimarina longa TaxID=1080221 RepID=UPI000782B6C7  ali  11  1....MASVKILLYKNKQNSKGK-------YPIVLRITKDRIPKYKFL-EYIDLKDWNEEKTEVRQSHHSYKLLNNLIDNEYVRAKNLILDFEAKDKNFTANQLMTILKG--------------NRDSMNFSKLAKEYLKEKKSSNKRGYSSCVSRVEKFKEFLKGDDIHFENITESLIKRYEVYMK... 160
522 2.000e-05UniRef50_R6VQ56 Uncharacterized protein n=1 Tax=Alistipes sp. CAG:268 TaxID=1262693 RepID=R6VQ56_9BACT  ali  16  5.KSKFPTGNIVIKNKKPNKEGKVALYL-CYNINTTPVT------ITTDIFVKPDDWDSKTQTVKSKNPAAVRLNNQLKLQRE---KVDEQIMAYEGHLTADIVRKMLKGEF--------AQQNDPKKIDFIQYATEYNQQRYEKLSYSTYYNGDRYIKKFQRFLSEQIYLTDLTIDLIEKYKTY..... 176
523 2.000e-05UniRef50_W6UB27 Uncharacterized protein n=1 Tax=Pedobacter sp. V48 TaxID=509635 RepID=W6UB27_9SPHI  ali  19  266IKKEGFVRKVTLR-KKAISKGRSTLFLDIYPPVPHPETGAPIRKYYLKMYVF------------------------DKPHTEVERRSNKETLMLGELIRAQKQIEILQLQFSF............................................................................ 353
524 2.000e-05UniRef50_A0A286IR87 Site-specific recombinase XerD n=1 Tax=Cytophagales bacterium TFI 002 TaxID=1945892 RepID=A0A286IR87_9BACT  ali  11  1....MASIKVVLFTSKTLKNGEHPIMLRI-------TKDRKTKYSSIGHSCLLDHWDKAKSLPKRKHPQFKELTILIE-------------HKKSEATKKLFALELDDQ-HKTLDEIQKHITNKRETITIYNYLDTIIVDLEAAGRIGNAKVYKDLKRVLKTYLKKDVSISSITPSFLKKLEQH..... 160
525 2.000e-05UniRef50_A0A1C4EXF7 Phage integrase SAM-like domain-containing protein n=1 Tax=Chitinophaga costaii TaxID=1335309 RepID=A0A1C4EXF7_9BACT  ali  16  39...............................................................................KDQIQKNHNKQALALLEIKKSQLIIE-------QQAIGSAFIPTHKFKTNFLEYFDEYVKLNTRKGNR----HLTNSLSQFKLFQKGDIAPIDIDKNFCKRFRQFLLD.. 137
526 2.000e-05UniRef50_A0A2G5KET7 Transposase n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2G5KET7_9FLAO  ali  11  3.....TNITLSIDTRRKRKDGM-------CPIIFRLSHHRKTIAISTGFAVPPEYWNEKNREVKRTYKGVSSVPRLXXXXXXXXXXX---------XXXXXXXXXXKQLESLGITDLKRILTKTTKKVSFFEYTQQLIDEMEEAQRYGNARAYKSVLGALKNFRKKSLRFEEVNYAYLKKFET...... 165
527 2.000e-05UniRef50_I8VN48 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=I8VN48_9BACE  ali  16  9.........VIRREKLSKSTNEAPVCLRI--------TKDRRVMYKTLFHVSPEFWDDKNRCIKKQHPNAEILNTTINQK-------------KAELEKETLFLTLADSSISMATIRNK--INNRTSFDLFEYANKYIEQLYKDGKHATYKKYKSVVKKLRFYVGGSLPIKSISLDFIKGYENYLMN.. 164
528 2.000e-05UniRef50_E4MCS3 Site-specific recombinase, phage integrase family n=10 Tax=Alistipes TaxID=239759 RepID=E4MCS3_9BACT  ali  15  1MLKTMRNTKVLFYIKK-----NAPLRNGWAPIMGRITINGQRTQFSTRLSVTPASWDTAQGRVCGRSNMAVQINEKLNIRFHIERCYNKLFYEQA--------------FVTPVMVKEMYFGGNHKQETVVAFFKQHNDEFKRSRSMTTYYKYRCVCRHLAKYNRKDLMFKELNREFLTGFHSY..... 176
529 2.000e-05UniRef50_A0A1F3LNQ5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_40_14 TaxID=1797347 RepID=A0A1F3LNQ5_9BACT  ali  12  1....MATFRLEL-SNKPTRNRTFPIYL-----VVTIKGERKRIKTSIAVNRKSDFNSKARQ-------NNWIRTTEPNAKAWNESLANEIETVRKEYSLQKALGQVSSLSIISDLKAYEKSGKNIKSMSFIQFAKERTRETLEAGHISTWKTYNGFCNKLEGYLAKDINLEQITPSFLSKFHAYLTT.. 174
530 2.000e-05UniRef50_UPI000A1C9346 hypothetical protein n=1 Tax=Massilibacteroides vaginae TaxID=1673718 RepID=UPI000A1C9346  ali  16  23......KTSIDLHHRSSTRGKNFSGSL-----FVRIIRERKSASITLPYTLFPEEWDRNRKRVR--------WEDAPKSRLDYLSRVERETVQVLSCLRQLADRLALKGAFSSLELVAAYRLKTSG-CSFFSFASSLCEEMRAAGKISSVRSYTTALLRLKNFTGGSLSFSDITPRLISSLEEHLQK.. 190
531 2.000e-05UniRef50_A0A0C1KQL0 Uncharacterized protein n=1 Tax=Flavihumibacter sp. ZG627 TaxID=1463156 RepID=A0A0C1KQL0_9BACT  ali  14  1....MSTIRFEYRKEKAEKSGLAPLRLVY-------QQHGQRLYYSTGEKLLGGNWDEKTQQAVYDKNLSLTAKEXXXXXXXXXXXXXXXXXXXXXYRINEYTIEDVISELKAKRDGKQMVKKAATSKEVYAFIDNYIADHTTQRVKGSLSVYKAVKEHLEGFKGYKVTFENIDYSFFQKFQNYL.... 179
532 3.000e-05UniRef50_G0J1Y1 Integrase family protein n=2 Tax=Cyclobacteriaceae TaxID=563798 RepID=G0J1Y1_CYCMS  ali  13  4.....ASLKIIINSSRIKKSGLAALYL-------RVIINREILKIPLKIDWYPDYWDKKNQVCKPRNKKDCNCNDLNLIIGDALAKANEILVDY-----------RLRRKSISVAIFSKEYACNLNKDDLIVFMEQKINERVKEISLGTKKSHTVTLNHLKA-WKKKIAFADLNEKTGEQFERFLK... 167
533 3.000e-05UniRef50_A0A221UVI9 Tyrosine recombinase XerC n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A221UVI9_9FLAO  ali  14  18.............................YPVCLRVTKERQCRHYKTPFNAKLDEWIDSTGSFNKRNPNHVQFNRLLVKFKERAYQI-------------ITDLEIENPDYSIQEFDSRYRVTFNPSNDVFAFFDEIIQEMTFAGRIGNAKSYKDAKTSVQIFHKKKLNFREVNPAFLSKYDAFLRS.. 164
534 3.000e-05UniRef50_A0A1M4UPR4 Site-specific recombinase XerD n=1 Tax=Aliifodinibius roseus TaxID=1194090 RepID=A0A1M4UPR4_9BACT  ali  13  11.............KRKKRNDGTIPIYI-------RLTENRKSRYLSTGVSILPKYWNSTKQKVRGTHPRSNVLNYRLRELRYNAEDKRNELQRKGKLDINTLKAEIKENDYN----------------SLIKVARRYHDSLEGTERHHEWKKVGVLINNLEAFLGDRMDVNQVDAAFIEDFQQYLL... 161
535 3.000e-05UniRef50_A0A2E6VE02 Uncharacterized protein n=1 Tax=Winogradskyella sp. TaxID=1883156 RepID=A0A2E6VE02_9FLAO  ali  16  49.........................................TERLPLGLYINPKDWNKKKQLALES--------------SQELIDLNLTLKRELGKINDLQIFYRLSDIRPSIERVVRDYQSNLGFQDFNVFFKRILDERKPTINKSTYAKEQAIHNKLKAFRRK-IPFSDIDRKFFFDFRNHLAS.. 179
536 3.000e-05UniRef50_A0A2G2F186 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2F186_9FLAO  ali  13  3.........VKLRERKLK-NGDVSLYFDFY-------INGKRFTKTSDYRLYQNEP---------------------------------KSLRKEKIASATREGYLKESHYLKHGVTELNSLELKRNALFNEFFCDF---SNTKLNPSTKSIWINCIKHFEKCFGSKVMFKRIGSELCQHFLDYLKS.. 136
537 3.000e-05UniRef50_A0A098S2T5 Uncharacterized protein n=1 Tax=Phaeodactylibacter xiamenensis TaxID=1524460 RepID=A0A098S2T5_9BACT  ali  19  2......TIKAVLAYRK-RQDGTKAIRIYVY-------HNGQKSYVPTDLNILEKDWNARRGEVKKTHPLSKAYNRKLN------------------AIKHEIESGLLKG------SSVRQLNKSTIDNDFLAYMAQYI-KREQSLSEGTLRIYKSAHRHLSNYRKEMLTPYDFTPAFIHEFRNYL.... 151
538 3.000e-05UniRef50_A0A1H3VEP9 Phage integrase SAM-like domain-containing protein n=2 Tax=Porphyromonadaceae bacterium KH3R12 TaxID=1855397 RepID=A0A1H3VEP9_9PO  ali  13  1....MATIRVKLRIS-TVPGKAGSIY-------YQVIHRRQHVQLTSSIKLYSHEWDTQNARVRINGEKVSFL-------LAAQRAINADLAVLHDIISRK---EAVGVPYDVADIAFAFRALIPAEEDFFLYMEKRIGRLEEENAHGTALNYRRAYRSFAAFLGKQLPFPACTEILISEYEQWLR... 165
539 3.000e-05UniRef50_UPI000986EA72 hypothetical protein n=1 Tax=Chryseobacterium sp. JV274 TaxID=1932669 RepID=UPI000986EA72  ali  21  17........KVTLR-HKPIGKGRKSLYLDIYPPIQSETTGKLLRKFYLKLYIY------------------------NRPKSEFEKLHNKQTVSLAQHVRAQRQIDL................................................................................... 89
540 3.000e-05UniRef50_A0A0C3REG7 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A0C3REG7_9PORP  ali  11  1....MTSIKFKLRLS-TISGKPATLYI-------QLIHKREVKTITLPYKLYPYEWNNLHEEVIFFQAVPHRYHYLK----EIDKQVIKEKKTLFSIIRQLCE------QKSYSMEDILRLYNNRHNEGLFPFIQKKIEELQKRGRFHTARNYRTTSRVFYSFCRSKLQFEELNSGLLKDFEEYLKT.. 166
541 3.000e-05UniRef50_A0A2P8FRS4 Site-specific recombinase XerD n=3 Tax=Chitinophaga TaxID=79328 RepID=A0A2P8FRS4_9BACT  ali  11  13...............................................KIYLYYDYGRAKGDRVKTGMFLYAR------PANAVEKQHNKQTADLLLVKQGQQVLE-------QQAIGTGYIPEHRFKTNFLDYYSDFVE----NNKRDNNRHLGCCFSKFKTWTKRRLAPIEITYDLCFRFRRHLLDT. 137
542 4.000e-05UniRef50_A0A291QTD6 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A291QTD6_9BACT  ali  13  21.............................YPIYLRAFLKGKKIETATPVAIPLRDWSLRNQRVKSQNKHHERYNMIL----------DAIDKKSIKLLVDNFLNEEYPLSLVQFKDRLLALNHYSVEQSFTDYILGYLEENKTKFKIETWFGYKSQISKMLKFRKE-ILFSDINERFINDYRQYMLNT. 168
543 4.000e-05UniRef50_B3QW06 Integrase family protein n=1 Tax=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) TaxID=517418 RepID=B3QW06_CHLT3  ali  26  63.....................................................................................................................ENFAQTFKRRSNFVAYFEKHAQEKPK-----TEKAWRNTLKYLKQFSS-QISFAGIDEEWLEKFKAFLL... 125
544 4.000e-05UniRef50_A0A2T2TMC7 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium QS_1_65_9 TaxID=1919104 RepID=A0A2T2TMC7_9BACT  ali  12  8......TLKFVLRTTNARDDGRAPIYLRI-------TANRKSRFKTTGILVRPKHWNEERQEVRKSHELASAYN---------------------DKLRRIWLTAEEAALSASSAAEVKAAVEG-TRGSLTDYFEAYIDRLDRRDQFWQKRKFKTTLRKLESFGRKGINWNDLNRQALEAFEDH..... 157
545 4.000e-05UniRef50_A0A173YAU2 Site-specific recombinase XerC n=9 Tax=Alistipes TaxID=239759 RepID=A0A173YAU2_9BACT  ali  13  1MKIAKATITALLYTSKTLANGEH-------PVMIRVCYNGKRKYKSTGLSCPAKLWNTAKQEVRGRHPLSMNMNALIESELMCLKNKVLDYERQGMAYSVQSLLEASGRKPPSRKTLDDLFEER------IAYFRDSMQKHNTAAGYQTLRHIIGRYSQ-----NRTVELFDVDKAWLQDFEQHLHT.. 169
546 4.000e-05UniRef50_UPI0003FFC079 hypothetical protein n=1 Tax=Rikenella microfusus TaxID=28139 RepID=UPI0003FFC079  ali  10  1....MASVKPYFDTRSPRKDGTCPLKL-------ALTHKGNTVLVSLQIYLLPKCWDSRKQEVVKDKRKAVYNDALRRRLVLAE----NVILKLGEKGELKTLTASALKKRIEAGENPDPTPAETSRPLVRDLFLQFIDTCK---IEGTKAIYRHTLERLGRFADPDLTFEDIDASWLRRFEA...... 166
547 4.000e-05UniRef50_Q9ZAD1 ORF6 n=2 Tax=Bacteroidetes TaxID=976 RepID=Q9ZAD1_PORGN  ali  100  1.........................................................................................................................................MYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAP 52
548 4.000e-05UniRef50_UPI0007C5B08E site-specific integrase n=1 Tax=Dokdonia donghaensis TaxID=326320 RepID=UPI0007C5B08E  ali  11  1.................................MRITIDGKRASMGISRTIDPNKWNQRKGRAIGNHKESAEINSHIDKLTYNVRKIHQELMDRNELVTSKKILNILNGKGEKARLLLDVFREHNQEAD-----KLIGISMSKSTVKRYWTSYEHTKQFIEIYKEDDFPLQDINYDFIKKFEVFLKT.. 150
549 4.000e-05UniRef50_A0A0P0LI83 Integrase n=1 Tax=Bacteroides vulgatus TaxID=821 RepID=A0A0P0LI83_BACVU  ali  3.....ATASVILYKSKTLANDEHPIMLRICY-------NGKRTYKSLKMSCSPRLWNEERGEVRSKHPYSVNMNSIITNELSKLKNLVLDYERRGEPYSAKTLANEISKPLPSTKTLLELID------DRVRYFKE------EKGEYNTGTGYRTLYNLIQGFSPQDVELFELNKMWLKEFEDYLRAT. 167
550 4.000e-05UniRef50_A0A1H7IBY9 Phage integrase SAM-like domain-containing protein n=1 Tax=Pseudosphingobacterium domesticum TaxID=407022 RepID=A0A1H7IBY9_9SPHI  ali  21  3........KVKLR-KKPISKGRMTLYLDIYPPVPNLNKKKFIRFHYLRLYIYQS------------------------PKLKVEKTHNRETLNLAKNICAKRQLEIQN................................................................................. 77
551 4.000e-05UniRef50_A0A095U4P2 Integrase n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A095U4P2_9FLAO  ali  1....MASIKVVLYPR-AKKDGTFPLALRI-------TKDRKSSYIFTDYSIKKEDWIEDEQRVKTSHPNSKRLN-------------NYILAKKAEA--SDTSLEVETHKKEVSTRAIKQKLKPKGGSTFFAQAHIYLKNLEKTGNYNCFIAEKSRVKIFQLFVSGDIAFSDITMGLLARFK....... 176
552 4.000e-05UniRef50_A0A2E3R1D2 Uncharacterized protein n=1 Tax=Rhodothermaceae bacterium TaxID=2026787 RepID=A0A2E3R1D2_9BACT  ali  12  1....MATATPVLWTYKKHDDGRADIKLRF-------TDENRSVYLSLGIAVRENQWNPRLQRVRKNHRDAD--------------EINSLIAAKLAAAESAKIALLANGQRPSAQALRDAVAPGRKKTSFLAYVDSFLDSLELTGKVARVDRERVVVGKLREHFGEPLPFDAITPEALRSFEGYLIGT. 166
553 4.000e-05UniRef50_R9I5D8 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=R9I5D8_9BACE  ali  12  11.............KSKTLSNGEHPLMIRVC-------KDGKKKYQSLGISVHPAHWDFKKNKPKNNCPNKEY--------------INKIIADKSNEFTEQVVKLKSEHKDFTANSLIDNTSKKVKPRTVGDVFLEQLQRLADENRRGYMLSTKQVYNSLMEFNKHNIYFSDMDVTWLRRYETYLRK.. 164
554 4.000e-05UniRef50_A0A267TF94 Integrase n=4 Tax=Cytophagaceae TaxID=89373 RepID=A0A267TF94_9BACT  ali  12  1....MASIDVLLYTSKVLKNGEH-------PIMVRLIKDRKPKYISVGMSCSKAMWDDKKNLPVKKHPLATEM-------------IIKIEKTKTDARRLLMQLEDEKASFTAEEFTKKLKNQSK-RITVLQFLDEVITDLMKADKVGNANVHKNLKKVLERFRNKDFTFSELDGSFLRRFE....... 158
555 4.000e-05UniRef50_I3Z7V4 Site-specific recombinase XerD n=4 Tax=Cytophagales TaxID=768507 RepID=I3Z7V4_BELBD  ali  13  21.............................YSIKLRVTFNREQKYYPLNISLTPEDWEKTNIQKPRNEAKERRIY------------FNKIEQRAIEIIKELHPFSFQSFEK-------KFNQKTDRSKDVLSYMESYIKQLSKDGRSGTADSYKCASNSFSKFIKKKLQFADITPDWLKDYEKWMVDT. 164
556 4.000e-05UniRef50_A0A2A4TEY2 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4TEY2_9FLAO  ali  11  25.......IKVRIKSDYKRMDGTCAIYL-------QVRLSGEGKKMPLNINVTPSQFNEVTQRI--------------KGKSKQAKDWNIIIEKALAEIHEIELDYRMSNRVLTLKKLVKEYINPIPKFDFLQFMDFELEVQKGFIKKSTYNQQRSSYRKLLRF-KRHIPFSDIDDNFIKELKMWMKNS. 183
557 5.000e-05UniRef50_A0A1F3IW62 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWE2_42_42 TaxID=1797339 RepID=A0A1F3IW62_9BACT  ali  11  26..............DRANKDGTFNLYLRITQNRKHRKLKLDIRLEKARYFLKKAKYGKWITEHPKAKAYNDSIEQEIEKAKQHQRDIKKSGIATPEVIISRI--------------------AGSDSDSFFQYANMRAQYFYDSGGYRNYKKYKSFISKLQAYKGKDLTFAEITLKLITGFESYLKKQP 181
558 5.000e-05UniRef50_UPI000761366A hypothetical protein n=1 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI000761366A  ali  15  10...........LRKKPITNGKRYSLLLDI-------HMEGVRYKEYLKLHLY------------------------AQPKDKMERAYNKQIMRKAEAMRKERVKALK--------EAMIVDKPKKRDILFLEYFTEQMMKRQTPATNKSWESALGTL--LQIQWVHDILLIHFGYEELTKVREYLLN.. 144
559 5.000e-05UniRef50_A0A017ND84 Uncharacterized protein n=2 Tax=Bacteroides fragilis TaxID=817 RepID=A0A017ND84_BACFG  ali  11  1....MTSVKLKLNKTRALKDGN-------YPVVFQLIHQKRKKIIYTKYRMKEEDFIIIAGNVVSGCHTGCKIS--------------RELLRIYKQLTARRRLESRGEEYTINDITTVMFSKATGKFLLLPYIDTQIEWKKSIMKNGTAAAYQSTYASLAKYIGKKVKISQVNHRFVTCYRDFL.... 162
560 5.000e-05UniRef50_R7CZY3 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=R7CZY3_9BACE  ali  15  12........KFYLRKRKPDANGKLPIYLEYVMGTKHARTE-------TGVWIEEAYWDEANKAVSRKHPQSARLNNQLEQKRRSIDEQIYEFTQKNSRLTIDNLRAIVQGRP----------NGKSAKTDFVNYAIETIEQEYKLGKVGVYCSLHKFRQFLMDYQKEDIYVSEVTVDLIKEYI....... 176
561 5.000e-05UniRef50_A0A1I5YZM9 Site-specific recombinase XerD n=2 Tax=Siccationidurans arizonensis TaxID=1227077 RepID=A0A1I5YZM9_9BACT  ali  13  1....MAKVSFLLKESKADRPTSIFAYVAF---------DGQRVKVYSGLKIHPKQWVKAEQRQLRGYPANGLLNDALDLLEEKLLDSYAERRATGDTPTTKALRKLSQPT-----VEEKPAAGAAKKMTFWDYYEEWVALARGHGKARSAMVYETTARHLRAFAKTSVSFDSITPAFGDKFTLFLLD.. 173
562 5.000e-05UniRef50_A0A0P7C4E5 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=A0A0P7C4E5_9BACT  ali  13  1....MATTKLRLRPDSKNRGGKLGIYVQVC-------IKSDVKLFSTGQRIEKENWDAKGQKVKRLTGSHDH------------KQINLILEKKHQEIKEIIQKEVNGEEVSFDSITDELKPEEKVPSNFTGLFDKFYASKSMEYGNGTTKSYRVLKNQILEFRKGDFDISKLDYNFYDGFKNWLL... 165
563 5.000e-05UniRef50_UPI000C08180D site-specific integrase n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C08180D  ali  12  3.....ASISVICYKYKTLSNGENPL-------MVRISQNGKRKLVSLGISVNHKFWNFEKQKPKPNCPNKEQIEILITNKL---NEFNNQIIEFKSENKDFTAKTLIEK-----------VSKPVKRMNVNDLFLQEIAQLKKEERIRYAECHDYVYKSLLKFNKHDIYFSDIDVQWLKKYEAWLRS.. 164
564 5.000e-05UniRef50_UPI00094EA80B site-specific integrase n=1 Tax=Parabacteroides timonensis TaxID=1871013 RepID=UPI00094EA80B  ali  13  1....MSKISVKIKRKKSVKPAHPM------PVYLQIIYCRKVARIPLGIKLSDNEWDEQEGCIRIPPGTPPEQVLHLYSLDTQIKERQQYLFNL------IRFLERNNTLSVANLLSACKENEDKR--SLYSFMEQLSTQFAREGKKATSRHYRSTLNTLTLFSGKDMRLDDIDETKVKQLETWL.... 168
565 6.000e-05UniRef50_F2IGJ6 Integrase family protein n=2 Tax=Fluviicola TaxID=332102 RepID=F2IGJ6_FLUTR  ali  13  1MKRTTFSILYFIKRNKMLRNGEAPIYLRI-------TVNGKSVELSIKRSIRPELWDTTKNKCKGASEPAKATNDYLDSIRGQLYTHQQTMQERGKVIDAKTLSQAFLGVGEKQWQLLELFQDHNS---------QMEQLLNKDFSPNTLQRYLAAFKHLVQYNCSDIYLNELDHAFVTRFEQYLKT.. 176
566 6.000e-05UniRef50_A0A1F3E552 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWC2_33_15 TaxID=1797324 RepID=A0A1F3E552_9BACT  ali  14  20...............................VYIYTHLMNEKVRFNTGVSVNPDNWDPIKKRI--------------KGTSKTVKDDNLIIDNCKKRITDAFVRYRLQGKELTPDLLRKEYKIPSTYIDFYDFVEKTILEQKGILSPNTIAMHESVLNKLKLY-KKQLMFSEISVEMINDYKKYLK... 159
567 6.000e-05UniRef50_A0A0D3LKM7 Transposase n=1 Tax=Flammeovirgaceae bacterium 311 TaxID=1257021 RepID=A0A0D3LKM7_9BACT  ali  14  5.......IKIFCHKHKVRSDGTSPIY-------YLVRMEGEEIRIAAKKYVVAKHFDNKAGVVKPGANNSIRLNTWLSSE-----------KSKLEKIILDIENE---GRPLSLELIKEDYLGGDDNKSFIQFCRDEIRNLKGIQASSTLKENGYCINNLEKFAPG-VTFAQIDYKFLQNYQHYMAN.. 162
568 6.000e-05UniRef50_A0A1Q6IU42 Uncharacterized protein n=1 Tax=Bacteroidales bacterium 43_8 TaxID=1897039 RepID=A0A1Q6IU42_9BACT  ali  14  13....MPTFKIYISKDQKRKDDK-------YPVSIRVTQDRKHSYLKTDFYVVSQQLNKNFEIKDKTLLKLLLEKIEDC----------------EDIIVRGLGNDMSNYSAKDIVEFIKKKQNEVSCIDFIAFAKKHVAKLFEAGREKRAKHIQTTINALVDFSGQELNIVKVTSKFLEKFEEFLRS.. 172
569 6.000e-05UniRef50_A0A2T5C108 Integrase-like protein n=1 Tax=Mangrovibacterium marinum TaxID=1639118 RepID=A0A2T5C108_9BACT  ali  11  4......TVNFSLKKSKSRTDGKCPIYLRC-------TMHGQRFELSTGIFIDPVIWNEEKQQV--------------KGRTEEIKILNSRLDKTVSRVQDIYNQLESKGEPFSAMHVKNKLLGVNGEKGVLEILDTLINRIGNDYSEGTLKHYKTTYSRLSEFIKTDLLLSMIDFNFLNSFDLYLKT.. 172
570 6.000e-05UniRef50_A0A1H1MLH4 Site-specific recombinase XerD n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1H1MLH4_9FLAO  ali  11  3........KANFKLKEPNSKKETLIYLNFYYNY-------KRFKYSTGEKILPKYWNDPAQRVKETKQFPEYPEFN----TRLNKIENGIKTAFRKLLNDGTQPNNTNLKEELEAFLSDNILQAK-RTTLLKFIEDYIEESKAHKKEGTVKVYTTTYNYLKKYSNKEIDFHSINLEFYNQYIAYL.... 170
571 6.000e-05UniRef50_A0A2E2XYI0 Uncharacterized protein n=1 Tax=Lentimicrobiaceae bacterium TaxID=2026756 RepID=A0A2E2XYI0_9BACT  ali  17  4........KIVLR-RKLLANGE-------YPVCIRLSIKSATYIRISGLSCLEKEWNKEMARYNRNRADQKKLNTILNE---------------AELKVGNIMTELLAHKNFTYKRFKEYYNFKPSDNNVIPFWQNHVNALINQKRYGSAKAYKTYMNSFKKFAPNSISFAEVDHTFVDSYRKYLLK.. 161
572 6.000e-05UniRef50_A0A0C1L2G7 Uncharacterized protein n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A0C1L2G7_9BACT  ali  15  5.......IKLIARKGKVNKNGVTPVSLQYC------HSADKRVVLSTGISIPFQYWNKKTGRISKDLPSEFGDVQILETTLTQKLRKAEDMVSYALKRRNKFLKENFNRNDKWGLEQMSDEKKSLDVFCNIDDYSKNKEGSVKRCTINVINAMKAHLRLFEEYRKEPITFDSFDAQFYEDFVSYL.... 180
573 7.000e-05UniRef50_UPI000401A6B2 hypothetical protein n=1 Tax=Runella zeae TaxID=94255 RepID=UPI000401A6B2  ali  18  34.........................................RLVYSTGQFLSPEHWDAKTQRPTTSTKNFSRDRKNELKEIETHLNRMADTIEKAENIEPTQAFYRAELDKVFNRDKPRKVAKQPEKLSFIPWIEKFIEESGKRYSESSTKNYRKALNHLKAFEKETVDFDKIDLHFHKKFISYLNK.. 198
574 7.000e-05UniRef50_A0A1F3NBT2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RBG_13_42_15 TaxID=1797355 RepID=A0A1F3NBT2_9BACT  ali  13  1MERNTFNIIFYVRKNKVKKDGDASLF-------MRLTINGRRWDSALKIKIDPSKWDAKRQVAISDNDEKDLNLINETIESLRFRIH-----------KIKLKIEDEGKLLTIESVRDKLIDKEKFNRTILKLFQNHNDECKLKVTQATYGRYLTCYKHLKEFINKDLSVSEINRRFYERFEFFLKK.. 178
575 7.000e-05UniRef50_UPI000CF5F6DA hypothetical protein n=1 Tax=Apibacter adventoris TaxID=1679466 RepID=UPI000CF5F6DA  ali  14  42................................YLSITQKGIRRRLSLDIRIEPNKFDPISQKVI--------------IKDKVDKDIQLILDNIAAKITNIKTYYRLADQVLTVDKLVEELKNNVPRGEFISFFQYELNKDKILLKPGTFKRHQSILNNLKKYKNE-IYFTDINVNFISDYKRYFIKT. 182
576 7.000e-05UniRef50_A1BI54 Phage integrase family protein n=2 Tax=Chlorobium phaeobacteroides TaxID=1096 RepID=A1BI54_CHLPD  ali  19  62.......................................................................................................................FDRKVKAADDFIEFYRRYAEKD-------NYPKYANVLPILRRFSLGVIHFASLNSAWLERFKFYLLS.. 122
577 8.000e-05UniRef50_A0A1V9FP61 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1V9FP61_9BACT  ali  16  8.........LIVKKGKVRKDGTSIVFLQYCY------SDKQRPLLDTGVAIPPAYWNKKSRKISDSLPAEYGNVEALETILTTKLRKAEDMINEALKRKVSPVEFLKINFPLADNWLLSQLKENKDELNVYSQFDNYKEERRTEVSKATLNVIGMVKHHLKKYSGKAITFDSFDFDFYREFVKFL.... 180
578 8.000e-05UniRef50_A0A1S9ARY7 Uncharacterized protein n=2 Tax=Hymenobacteraceae TaxID=1853232 RepID=A0A1S9ARY7_9BACT  ali  11  16....MAKISFHLKDTKADRPTAVFILL---------TADGKRTKIYSGYSIHPGQWNSEDQQAKTRGYPAANGELNRGLKRMGEKLQTFYAEQRADGV-------IPSAEALKAVVEPEEEVVAKAAGTFSELFEQWIAASALTKSPNTIRTYRTTLRHLQAFEKAKLSFAALNADFADKFTAYLIET. 187
579 9.000e-05UniRef50_A0A1G7SN05 Phage integrase SAM-like domain-containing protein n=1 Tax=Chitinophaga filiformis TaxID=104663 RepID=A0A1G7SN05_CHIFI  ali  15  4..............................................................................PGSQTEKKFNKEALALLETKKAERTLDAL-------AIGSAYIPSHKLKKNFFEFSEEYVKTHKTDGNR----YLQGSLNHFKEFTGVS-TIAPIDITECE.......... 92
580 9.000e-05UniRef50_A0A1G9QII0 Site-specific recombinase XerD n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G9QII0_9BACT  ali  15  19..............................PIKFRLHIGNKSKYFATDYVCKPEQWSKETRLLITTLPKKEKHPQAAYINSFLQDQEDAVAIITRLQTKQALTLERFAEEFLSKDKKVEVNPPPDHRTNVGAYFTRREAELKSEGRIEYGNTHRYVRNSLLRFHNKDFSFTQIDVSFLETYLRWLRTS. 188
581 9.000e-05UniRef50_C6Z291 Site-specific recombinase, phage integrase family n=4 Tax=Bacteroidales TaxID=171549 RepID=C6Z291_9BACE  ali  13  1....MATVKVKFRPS-TVADREGTIY-------YQIIHDRKVRQLLSDYHVFPNEWNENRSSVAISPSN--------KRSSFLLSIRERIRWDVERLVKIDRKLD-ADGLSYTADDVIDEFNKYVNDYSLFNFMESVIAKLKQNGKIRTAETYRVTLNSFKKFRDEDIMLDSLTSEIMEAYEAW..... 164
582 9.000e-05UniRef50_UPI000B521BE1 recombinase XerD n=1 Tax=Geofilum rhodophaeum TaxID=1965019 RepID=UPI000B521BE1  ali  11  6........RFKLRADRADENG-------ACPIIMVITKNRKRQFISLKFSVLPEYWDNESERLVILDNSADK---KEKAENQKRKEYNATIDDYANRALAEFEYERENNTHWTPGQYKEKLKTQSVKSKVEPFLKEHIQILKETHRPGTASTFYVLYRKLLSFDPDSLSFNAITITYINRFNESMEK.. 177
583 1.000e-04UniRef50_C7XD21 Site-specific recombinase, phage integrase family n=8 Tax=Bacteroidales TaxID=171549 RepID=C7XD21_9BACT  ali  13  3.....ATIKIELRKDYATKEGKQMVCLRY-------TAYRRSTLISMNIAVLPKHWNKVSNTVRSSEPRCYYYNKAIS-----------EVYQKADSI----VMENFFTPLPIPQFLERLKDKHHGNTDFYVFIENEIEQLKQSRAAGTISNYYKLINTMKE-WKPTLSFGEITLDFIQQFHNH..... 158
584 1.000e-04UniRef50_UPI0009FE2F16 hypothetical protein n=1 Tax=Crocinitomix catalasitica TaxID=184607 RepID=UPI0009FE2F16  ali  23  1..................................................................................................................................MDFFEEQTNKRY--GSKGNYGNWDGVHKYLLKFCPEGIPINQDDTKWLNTFKDYLQNT. 56
585 1.000e-04UniRef50_A4CPX3 Putative integrase n=2 Tax=Robiginitalea TaxID=252306 RepID=A4CPX3_ROBBH  ali  1....MVQGKILLDTRSKGKKGH--------PIKIYISGNGSKKYISTGYFSMQEHWRDGVTRKHPNYSHLSTWIKRREFELQQQLNYNEHGYTLREAVQYIKGKSSPQDEIEMLEKRLREL-RGQPTVSLFDFWQQITHERKLASKST--RAFDQTLSQIRKFT-DDIPISDITPGWIEGFKAF..... 169
586 1.000e-04UniRef50_K1T881 Site-specific recombinase XerD (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1T881_9ZZZZ  ali  13  2.................................LRFIHERTSKQLSLGISIEPHYWDKDAEMITADCPDRAALQSQIDSTLATYRKKIQRLEAL------DMEVDFTNLFDQTAKCTPQLVDG---------YFERQIAAMKQAGKINTAIKYTATRTSLVKFHPSKLRFEEITPNLLGNFETFLR... 139
587 1.000e-04UniRef50_A0A1Y3VG18 Uncharacterized protein n=1 Tax=Alistipes sp. An66 TaxID=1965650 RepID=A0A1Y3VG18_9BACT  ali  10  1....MASISLKLDRRRANVRG-------LYPIQFLLSSKGKVTTIGTGINILPEHWNGEV-------------NKAVVPKCPNARAINENIETLFFR-YTNTLRELDNSGKLAGKSVSEIKKTTSNKESLSDYFHRYADSRRTENSR---LACLYTLKTIEAFDKSDPSFEAITVIWLKAFDAYLEK.. 165
588 1.000e-04UniRef50_A0A2P8CH31 Site-specific recombinase XerD n=1 Tax=Prolixibacter denitrificans TaxID=1541063 RepID=A0A2P8CH31_9BACT  ali  16  9...............KVRNDGTAPVYIVTY-------VNRDRVQFLTHVYCHPDKFDKVKGRVKGRGKRV--------------NQQNLIIENCRSRLNKVFIDYELQNKKLTPKLLKNEYNNPALRIDFHKFLEEAIKERKDESAPRTIARDEVFQRRLKEFRKE-IAFSEIDAEFIELFRRWLKK.. 158
589 1.000e-04UniRef50_K6A7R4 Uncharacterized protein n=122 Tax=root TaxID=1 RepID=K6A7R4_9BACT  ali  12  1MKRNSFNVLFFIKKAKLLKNGEAS-------VCMRITVNGARVENNIRMSIEPALWNQAKECAKGKSRKACELNLYIEQAKIKLRKLFDELEERNHSITARILQEKFFGANEEVKEVRTLIQTIQEHND------QCRELVGKDYALITVRRYESCKRYLAKYDKEDLPLSEINGELVRAFEFYLKT.. 179
590 1.000e-04UniRef50_H1YHT5 Integrase family protein n=1 Tax=Mucilaginibacter paludis DSM 18603 TaxID=714943 RepID=H1YHT5_9SPHI  ali  13  4......TTKLMLRINKTLPSGEH-------PIMFRITENRNNYEVSTKVSSTKENWNKASQCVLDSHINHKSINALLNNI----KVKATFYFANVPDDRSPRVSEIKS-----LVEKLTGAVKTTPKLMLLEFFDSEVARLKSMERYGYAGVHIVTRSRLNKFMKKDMNFEDIDVNFLRRFEDWLIK.. 169
591 1.000e-04UniRef50_UPI0003B41E2D Tn5520 integrase (transfer factor) n=1 Tax=Flavobacterium antarcticum TaxID=271155 RepID=UPI0003B41E2D  ali  13  4.....ATIKLMLDG-KPMADGKHAVYLRI-------LKDRRQKKISLGLNCKKENF--VNESFTKAHPLYHDENEILLMLKTRAFKIITEFKRN------------ETDFTLEEFEEAFRDDKKQKEMSVIDFFNEIIEEMMRSGRISNAKAYLSTRDSIIKFKGKSIKFKEITTTFLDKYEVFLR... 162