current user: public

If you have questions about the server, please let us know.

Query: PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# E-value Template Links and tools%idFirst MKSRIISLGLVASLVCLLPQVAEAQIAASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIHKWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDVWNNVTAGMLDRDNGEAARMALSHWHRAAALVLast
1 3.000e-48UniRef50_A0A1I0SNK8 Uncharacterized protein n=4 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1I0SNK8_9SPHI  ali  15  3........TILMFLLAWPCFFVSAQTIYVDPLTSGAIAGHASVINGQLNRTNDNLSLISKGQLAVTGQLLIVNDLQERIYHGLTQVAAVMNNLVSVKEIGEIGLDIVGDVEKTVELAKSDPVLLLFA---EQGAREFKVRAVSLGTEVGAFILKGGKRNLMDAGERSKLLNNIANQMRILRGTVYGMHRAMYWAKMKGLFASLNPADWVNMDVRIANQVISEAKYLKK.. 220
2 4.000e-48UniRef50_H1Y3W1 Uncharacterized protein n=4 Tax=Mucilaginibacter TaxID=423349 RepID=H1Y3W1_9SPHI  ali  14  1.....MKTFLFLISGLLLSVALHAQELVVDPVTSGAMLANSAVINGQLNTTNNKLTAIQTAQLAVTGQLTIVNNLQNKIYKGLSEVASVINNLYSIRDIAETGSDIVTDVQKAVQTARGNPALLLFA---QQGAQDFEKRAVALAADVSAYVLKGGSDNLMDSSERGKLLNHIVTEMHVLRGLAYGMQRAMYWAQLRGIWASLNPSTWQSEDVRIANSVVNEAKYLHR.. 221
3 1.000e-47UniRef50_A0A1G9NIW5 Uncharacterized protein n=19 Tax=Sphingobacteriia TaxID=117747 RepID=A0A1G9NIW5_9SPHI  ali  16.....MKHILFLFLISTDWLTGFAQVMVFDPRHFAIVNENGAARLAAENTHNNYLTTINNRLDDINLNISSVVMVQTLIHNSLTQVNQALKSGLTVMQIGQISDEIIKESSNMIAIARTDPVLLLFA---EDVARQMKSRGVNLVSEVSGFILKEGDNVLMDFEKRDALLRKVILELRVMRALCYSMSRSMYWAKVNGVLKTANPRDFINQDTRLVNDILFKYNLLKK.. 236
4 3.000e-47UniRef50_UPI0003FC35FD hypothetical protein n=1 Tax=Prevotella sp. AGR2160 TaxID=1280674 RepID=UPI0003FC35FD  ali  58  589........ILILLMLLNFTVRSHAQAVTANPGEHTILAAGNSLINETVGKEADAQRGTAILQSTMAAEFTTMKGWEKKYNSYLKTANGYASALKAATHIYDDGLRILITLDKLRRAVNNNPQGIAATVSMNNLYIETTTEMVSVFTLLKDAVAKGGESNMLTGAERSKTLWELEDRLSSFSHKLRQLYLSIRHYRMADVWNRATAGMIERDRRDVALQSLSHWKRYAKEV 810
5 4.000e-47UniRef50_A0A127VEN0 Uncharacterized protein n=13 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A127VEN0_9SPHI  ali  15  1.....MKRSLLIAGLFITACPVFAQ-IYVDPTTAGAMAAHSGIINGQLNRTNDNLTLIQRGQLAVTGQLVIVNDLQQQIYRGLSEVSAAVRSLLAIQDIADISMDIVSDVNKAISIAQSNPVLLLFA---EGGAREFKRRGTALAAEVSSFVLQGGINNLMDSGERAKLLNRIRTELMILRGVAYGMHRTMFWAKQRGILNSLNPSGYINIDVRIANDIIRNAKYLKK.. 220
6 3.000e-46UniRef50_F0R8F6 Uncharacterized protein n=5 Tax=Bacteroidales TaxID=171549 RepID=F0R8F6_BACSH  ali  85  1MKSRTISIILAAVLALFLPHIAQAQIAASNPLEWVALAEGNELINGQIDKQIKGQTQTAVLQNSIAAEFNRIHQWEKEYNSYLKTASGFASSLKACTHLYNDGVRIFLTLGKLGKAIKNNPQGIIASMSMNNLYIETATELVSVFTLLNDAVAKGGTENMLTGAERSKTLWALNDKLSAFSRKLHLLYLSIRYYTLNDVWNNVTAGMLDRDNGEVARLAMTRWRRAAAL. 229
7 7.000e-46UniRef50_A0A1I0SNV1 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1I0SNV1_9SPHI  ali  11  10......LVLVTVLVMGALPFKGNAQRAVFDSRHFGIVNENFAVRSAAEMMHNEFLDRINTSLKQINLNCATVVAAQAMIYEGLSNVNSALTGGLMVKSMAAVCGDILNYSSRMTELAKSQPYLLLFAEEM---YREMNARAMRLFGEVSGFVLKSSNDILMDHAARDALLRKINTELHILSGLTYGAWKAMYYAKIKGVFYSLNPFSFINQDRSMVGDIIRNAKYSKR.. 229
8 2.000e-45UniRef50_A0A1G7JSD6 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1G7JSD6_9SPHI  ali  1....MKKLFLFFALSCWFLG-AKAQQYVIDPQYFSSVMANQAVRSSAEQTHNQYLGKIHNNIDDININVGSVVTAQAIIYNGLSNVNSALKDGLAVKNLAVITGDMVSYLNQALELAKDEPYLLLFASNIQN---EMRVKAAGLVSDVSGYILKSGDNVLADYNSRDQLLQKVTQRLQILDGLAYGTWRAMYWAKQRGIVASLNPQGYINHDKFFVQQIIQNAKYLQQ.. 221
9 4.000e-45UniRef50_I8ZWA1 Uncharacterized protein n=55 Tax=Bacteroidales TaxID=171549 RepID=I8ZWA1_BACUN  ali  98  1MKSRIISLGLIASLVCLLPQVAEAQIAASNPLEWTALAEGNELINEQIEKQIKGQTQTALLQNSIATEFNQIHKWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKDIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDVWNNVTAGMLDRDNGEAARMALSHWHRAAALV 230
10 4.000e-45UniRef50_A0A1X9Z9N3 Uncharacterized protein n=1 Tax=Sphingobacteriaceae bacterium GW460-11-11-14-LB5 TaxID=1986952 RepID=A0A1X9Z9N3_9SPHI  ali  10  1.....MMKNIILPFLLALAISGFGQRVVFDRNHFNIVNENGAVRLAAENTHNSYLNTINNRLNDINVNLSSVVLVQNMILSSLAQVDGALRHAIAVRQIGEICDDIFSESNELVQMARDNPALLLFA---EDVARQLKDRGVRLATEVSSFVLKEGENVLMDFEKRDALLKKIALELRVMRALVFSMKKSMYWARVNGILKTANPRFYINQDKWLVDEIIRKYN...... 217
11 1.000e-44UniRef50_A0A081PHE6 Uncharacterized protein n=2 Tax=Pedobacter antarcticus TaxID=34086 RepID=A0A081PHE6_9SPHI  ali  15  1.....MKILIFMMTCLCLAFSASAQ-VYTDPAVSAAILSSSSQHNNNLNKTNDQLTLIQRGQMAITSELAVANGIQRDIYTGLTEISGAVKTVMGVQRAADYVTKIFDNVRKSIEVAQGNPALLLFA---EKNARDFRKRSLELSTYVTEFALKGGKANLMDAGERAKIMRYIINELILLNGISYGMHRSMYYAKQNGIFRSLNPQTWVNRDAQIARETVRDFQYINK.. 220
12 4.000e-44UniRef50_A0A1G7IG78 Uncharacterized protein n=3 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1G7IG78_9SPHI  ali  17.....KLFITSLTLLLYGFSPVLAQAVVFDPQHFLIVNENGAVRLAAENTHNNYLGNINNRLDRINQDMGMVVYAQSLIYSALTQVNAALRSGMAAQQIAGVSSEIVGECNTMLDIARADPILLLFA---EDVARQMKDRGIKLVTEVSDFVLKEGSNVLMDYEKRDALLRKILLELRVMRALTYSVSRSMYWAKLRGILRSAGPQSFINQDTRIATDLMRNIK...... 233
13 8.000e-43UniRef50_A0A0N7IAJ2 Uncharacterized protein n=157 Tax=root TaxID=1 RepID=A0A0N7IAJ2_BACT4  ali  61  21.DSRWMIISAIALALFLFRLEGRAQLVSSNPMEYVALAEGNELINGQIKNQIEDQQKTALLQNTIAAEFTQIKQWERKYNSYLKTVSGYASTLKACSHLYDDGVRIFISLCDLKKAISQNPQGIMATMSMNNLYIETATELITVYSILKDAVAKGGASNMLTGAERSKILWELNDRLAQFNKRLSQLSISIRYYTMADVWNRATAGMIDRNTAEIAGQALDRWHRCARIV 249
14 2.000e-42UniRef50_A0A0I9S5P3 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=A0A0I9S5P3_BACFG  ali  85  1MRLRIISIWVVFVLAGLLPQLAKAQVAASNPLEWAALAEGNELINGQIDKQIKGQTQTALMQNSIAAEFNRIHEWEKQYNSYLKTANGYASSLKACTHLYNDGVRIFLTLGKLGKAIGDNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGGTENMLTGAERSKTLWALNDQLAAFSRKLHLLYLSLRYYTLNDVWNNITAGMIDRSNGEVARLAMS......... 221
15 3.000e-42UniRef50_A0A1I0TVL3 Uncharacterized protein n=1 Tax=Pedobacter suwonensis TaxID=332999 RepID=A0A1I0TVL3_9SPHI  ali  12  1.....MKRIFYIVLFGLSSFRLSAQRIVIDTRHLATVSENAVARNAAEVSHNELLNKINKSLDNINTNSSSIVIAQSMIYSSLSNVNSALKNGLALRDMYSVCEEIIGYGREMSKLAVNEPYLVLFS---EQIIKDVGTRSAKMMTEVSDFVLKEDQNILMDYNSRDNLLTGIRSDLQIIRGLAYGAWKAMYWAKVKGVMSMLNPQGYINRDRQIVADIISKTKYLKK.. 221
16 2.000e-41UniRef50_A0A2A2S8I3 Uncharacterized protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A2A2S8I3_9SPHI  ali  4.........LLLLVFSFCSCAAFAQEMVIDPQHLLVVQENQAVRMAAEGTHQDYLKKINDNVNTVNANESSVVAAQTLIYNALANVNSVLKDGLMVRQISRTTTDIIYYLNESMMLAKDDPLLLLVTMKIQN---DFGPKATAMVSDISGFILKSDGNVLADYNGRDQLLRKVVQQLQILDGMAYGTWKAMYWARERGVLKTLNPFNYINKDRAFAAQIIQNAKFLNK.. 220
17 3.000e-41UniRef50_H1YI33 Uncharacterized protein n=15 Tax=Sphingobacteriaceae TaxID=84566 RepID=H1YI33_9SPHI  ali  11  2....KNRFLFILLCFAFHLSPCKAQQYVVDERYLTSVLANTSVRNSAETTHHKYLGNINSNLNTVNTNASTVVAAQTIIYNSLSNVNSALKDGLAIKNITAMTSDIIYYLGKTAEIARNDPALLLFVSQYQNY---MGPHITALVSDISGFVLKEGDNMLADYNARDQLLRKITQQLQIIDGLAYGAWSAMHWAAERGVLASANPFNWINKDKNFAAQIIINAK...... 219
18 4.000e-41UniRef50_UPI000D703CA8 hypothetical protein n=1 Tax=Pedobacter yonginense TaxID=651869 RepID=UPI000D703CA8  ali  14  1.....MKKLILLGLFCLGITGAMAQSLYIDPAVSAATAAHASIINTQLNVTKDKLTLVERGQLAVTGQLGIVNDMQNRIYRGLSEVNSILTNLSDVQEISRIAIGMTDDINKGLAIARKNPVFLVFAEEQANFFYQ---RATKLALEVSSFALKGGKDNLMDAGERSKMISHILTEVLILRSLTYGMYRAMYYAQMRGLWKSLNPQGYVNIDDQMLDGIMQRRKYLK... 220
19 7.000e-41UniRef50_A0A1G7Q7U4 Uncharacterized protein n=1 Tax=Pedobacter terrae TaxID=405671 RepID=A0A1G7Q7U4_9SPHI  ali  1....MKPYIIFVALLIFGTTKSFGQRIVFDRNHFNIVNENGAVRLAAENTHNGYLNTIHNRLDDININIGSVIMVQTLIRNSLTHVNQALKSGIAVYQIAEISNEIIRESNNTISIAGSEPYLLLFA---EDVARQMKTRGINLVSEVSAFVLKEGNNVLMDFEKRDALLRKIILELKVIRALCYSMGKSMYWAKMNGILKMANPRDFVNQDMRISSEIINNIKYLK... 222
20 1.000e-40UniRef50_A0A1H8SNE2 Uncharacterized protein n=8 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1H8SNE2_9SPHI  ali  11....MKLSLSMLLVSFNLDVFAQGYEIVVDYKHTAAVIENGAVQSAAEISHSNYLDKINKNLQTINKNTGLVVLAQTIIYEGLSNINSALKNGLVVKDLAVITVDILRYTNQAIELAKSQPYLLLFAESYAG---QIRGRATRLVGDVSKFVLKEGGNILADYNSRDELLNHVRQELQIIDGMAYGAWKAMFWAKERGIIASINPAGYINNDRNTVNEIIKNAKYLK... 231
21 2.000e-40UniRef50_A0A0T5VV38 Uncharacterized protein n=12 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A0T5VV38_9SPHI  ali  11  1.....MQIIFLAFVLALFQLQAFAQRAVFDRGHFNIVNENGAVRLAAENTYNSYLNNINNRLSDVNVNLSAVVSVQSIILSSLTEVDQGLKSALAVRQMGSLVAEIAMESSEMIRMAKSDPQLLLFAEAVS---RQLKDRGVSLFSVVSAFVLKEGENVLMDFEKRDALLKKIALELRVIRALVFSMKKSMYWAKANGLLRSLNPQGFINQDLRLGNDILVKSKLLKQ.. 221
22 7.000e-40UniRef50_A0A132HCC6 Uncharacterized protein n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132HCC6_9BACT  ali  46  4....QKNIVIILGMVLLFPMTASAQASQSNPDQYVIIAEGQKKVNDQIRNQTDGQQKTAALQGAIAAEFTIMKGWEGKYVSYLKTVRGYAESLKAGTSIYADGVEVLRNIYDLRKAIGHNPVGIAATLSLNDLYLEVGTEFVKVFKTL-QSVAKGEKTNMLRGSERTDLLWRISDQLADLNRKLRQLVISIAYHNMMDVWNRYTAGLIDRDKGVIASEALDRWRRASKV. 227
23 1.000e-39UniRef50_G0J7P4 Uncharacterized protein n=62 Tax=cellular organisms TaxID=131567 RepID=G0J7P4_CYCMS  ali  16  3........TLTFLLFIFTSGWLEAQ-VYVDPAVSGAQATHAAVINSQLNKTNEKLTLIEKGQLAVIGKLTVVNTLQEKLYAGLTEVSAILTNLANVREIARIASGISGDVRDIMELAKENPEFIVFAEQNATMFQQ---RATALALEVQQFALKGGKENLMDAGERAKILNTILNELLILRSYSYGMYRSMHFASMKGLFNSLNPQGYIEMDLAIMDDILRK........ 213
24 1.000e-39UniRef50_F0R8F5 Uncharacterized protein n=13 Tax=Bacteroidales TaxID=171549 RepID=F0R8F5_BACSH  ali  17  1....MKKLTMTLTCILLLCAASPKVRAQNDPVLAGMILLYTDKAQKELKSQEKVMLLQTTGHIWTKEEIEGTTDLQREFNNYLDSFRSIVCYAAQTYGFYHEISRLTDNLGDFSRQLARHPSNALAVARRNKIYRELILGSVEIVNDIRTACLS---DNKMTEKERMEVVFGIRPKLKLMNKKLQRLTIAVKYTTMGDIWIEIDGGSLVADKRDIVEAARRRWKQNGKNV 227
25 2.000e-39UniRef50_F0R972 Uncharacterized protein n=1 Tax=Bacteroides salanitronis (strain DSM 18170 / JCM 13567 / BL78) TaxID=667015 RepID=F0R972_BACSH  ali  14  1..............MFLGALKMVAQSIVIDPTLVGTLVYAHTEQQNVLNKIKDEEGRIRNFQILIQQKMGQIKDLQEKTYNYLSTVNAVVKNGKDIIYASNIAKDIVKYQGDAAKYAAGDPALVSVIAKSE---YELITRSVDLMIYINNIALQGGANNLMDNKQRIDLCIHVVNELRAMRAIAFSVCRQMKYAKRAGVLKTLMPGKYKDQSGQIVNDILKDFKFTKKG. 214
26 2.000e-39UniRef50_A0A1G7IFS2 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1G7IFS2_9SPHI  ali  10  2....KRALIMAACLCAGLIFTAHAQ---VNVVLLHQLVAESESEHERQQEARNKQAVVSTGEEVNRSEMSKLKSTYRTLQKRFQTVGLAITAAGIGLEAIPLVDEIVQQQGLIFQRVGQDPVLVALAYQTE---ADLSEQAYHLLNYIYGLALSYGDLNQMKASDRKMLFGRVVTELRRIAGASRGLAASLYYAAQ-DKNKALNPSQFINQDKQLVDDIMRRIK...... 215
27 2.000e-39UniRef50_J0V1T1 Putative plasmid transfer protein n=12 Tax=Cytophagales TaxID=768507 RepID=J0V1T1_9BACT  ali  12  1....MKKYLYTLSFMSLVTGHVLAQQVVFDPAVVSTLVVNHTAQQAALNDIKENEGKIAALQTTISLKMTQIKELEEKMYNSLKSVQSIIGQSKNIIYASQIAADIGRYQNQMMELARGDNELLLIAAKTE---LELLNRTSDLFTYIYQVAVIGTDVNLMNNADRLTLIRHVVDELRVMRGLAYSITRKMRVAKYAGLLKTMNPLAYPDNSQAIIRSLMDEYKAIKK.. 223
28 3.000e-39UniRef50_A0A239DU29 Uncharacterized protein n=1 Tax=Pontibacter ummariensis TaxID=1610492 RepID=A0A239DU29_9BACT  ali  14  1....MRKYLYLVSALVLGWTSSQAQQLVFDPAVVSTLVVNHTAQQTALNDIKDKETEISLTQQSINYKMIQIKELEEKMYNSLKSVQSIVGQSKNIVYASTIAQDIGKYQGQMMDIAQGDPELLIIAAKTE---LELVNRTADLFTYIYQVAVIGTDVNLMTNADRLSLIRHVVDELRIMRGLSYSIVRKMRVAKHAGLLKTMNPLKYPNNSQAIINSLMDEYKTIKK.. 223
29 9.000e-39UniRef50_A0A0Q4G6J3 Uncharacterized protein n=1 Tax=Pedobacter sp. Leaf216 TaxID=1735684 RepID=A0A0Q4G6J3_9SPHI  ali  13  1.......MKTILFVLLLLCHNGFSQRIVLDRGHLKSVVENNAVRISSELIHGERLEQINSGLGQIKLNMGAVILTEELIFRSLTQVDQGLKSAMAVKQIGEISLEIFSESRAVLKAASKAPHLLLFAQAT---CQQMADRGVKLAGEVSSVVLKERSDLFMDFSKRDALLGKISLELKTIRALLYSIKKCMYWARINGLLHTVNPGGFINTDKRMV.............. 207
30 1.000e-38UniRef50_A0A0Q5NH13 Uncharacterized protein n=6 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A0Q5NH13_9SPHI  ali  11  1.....MKSAAFFTAMIFISIAAHAQ---LNVGLLHQLVGNSKTEHGKQSDARDRQAGSTANEEANKTLMVRLKNKYRDIQSRFKTLGLAIDAVQIGIEAYPLIADITESQGMIFDLCKDDSILSVLAIQAE---LDMGDRAHALLNFLYGLALSMQDINQMKQSDRKMLFSHVLTELRLIAGASRGLAVTLQYSSRKKVFNQLNPFSFINTDKKLVDEILRK........ 212
31 1.000e-38UniRef50_A0A1H9N4E7 Uncharacterized protein n=9 Tax=Sphingobacteriia TaxID=117747 RepID=A0A1H9N4E7_9SPHI  ali  18  1....MKKLFFLTLPALLLINSASSQ-IYFDPATSAATAAHASIIDRQLSSSSEKLTLLQRAQLTVTGQLAVANTLQSQIYQGLSEVSSIMRSLLSVKEIYDTSVDVIQDLEKAGKLGVKNPALLLFAESAA---REIRTRASLLSSQVGSFVLKGGKDNLMDSGERAKLLNAILSQLLVLRGLSYGMYRSMYWADQRGFLRSINPAGYINIDKRIADDIILKTK...... 217
32 2.000e-38UniRef50_I8VP21 Uncharacterized protein n=48 Tax=Bacteroidales TaxID=171549 RepID=I8VP21_9BACE  ali  18  1....MKWTIWISILLLCLTGIGEVQA-QNDPVLAGMIAVYTEKAEKELKNQEKVMLMQTTGHIWTKEEVQATTDLQREFNNYLNSFQSIVCYAAQTYGFYYEVSRLTDNMGDFTKQLKRSPANTLASTQRNKIYRELMMNSVEIVNDIRTACLSE---NKMTEKERMEIVFGIRPKLKTMNTKLQRLTKAVKYTTMGDIWREIDEGARPEADKRIVDAAKRRWRQIGKNV 226
33 2.000e-38UniRef50_A0A1X9Z9K0 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1X9Z9K0_9SPHI  ali  10  14.....................VFPSAAQLNVELLHQLVAESKSEHQRQAEARTNQGLTTTNESVNKTALTRLKEKYRDIQSRFKTLGLAISTAQIGLEAYPIVSDIIVQQGIIFDICSSQPLLLPLAVETE---ADIGDRAYRLLNYLYGLALVAGDLNQMKSADRKMLFSFVVTELRAISGASRGLASTLSYASRKKAMDSLNPSGFINQDKAIIDKIMERAKQLGQ.. 218
34 3.000e-38UniRef50_A0A081PHE8 Uncharacterized protein n=2 Tax=Pedobacter antarcticus TaxID=34086 RepID=A0A081PHE8_9SPHI  ali  10  4.........LFIILFMLLCSKVSGQRVVYDKNHMNQVLANQAVRLSAEQAHQSNLKSIETSVKSINLNVASVVLIQDVIYRSLTEVREGLRDGLQVKNMAIYVSDVLKYSNQMIDQAKGEPYLLLFAEENMQWSK---RRLLALTEEVNKLVLTGGKEVMMDYVKRDELLDMINHELILLRASVYRAYRAMHYAKQNGLLKSLNPKNFIERDKDLVNEIFRNYNYLQR.. 220
35 7.000e-38UniRef50_Q64MC9 Uncharacterized protein n=23 Tax=Bacteroidetes TaxID=976 RepID=Q64MC9_BACFR  ali  11  2....KKLIFFSLTFLLIGTMGVKAQSLVLDPAMITTLTITHKEQNDNLKGIKSAENKISSWQILIQAEMNKINRLQEKTYKYLSTVNAVVKNGKDIVYASTIVKDIAKYQSQAANIAKGDPELLLVVAKTE---YELISRSADLMLHIYNVALADGEKNLLDNKQRLDLCIHVVNELRRMRANAYTVLRQLKSAKRNGLLKSLTPGTYINNCDRKVDQILKDLNYISKG. 225
36 7.000e-38UniRef50_UPI000558BE54 hypothetical protein n=1 Tax=Flavobacterium daejeonense TaxID=350893 RepID=UPI000558BE54  ali  13  1....MKKRVLIITLLFVGGVKGFSQTVYVDVLTAPAMIAYSNTLKTEQNKTNTNLSNIQKGQALVASQLKVANDLHDKVLKGLTQVSQTLNNALTIKEIYSTSVDIINDTKQTIDLAAGNPVLTVFAVNSAKTFKE---RAVLMTAEISRILAS-GETNMMDAGERQKLLNYIHTEIRLLGANVYMMKESMYWAKMNGIWNTLNPRAWINQDEMIIKSVMQRSKQI.... 219
37 8.000e-38UniRef50_Q64ME9 Uncharacterized protein n=31 Tax=Bacteria TaxID=2 RepID=Q64ME9_BACFR  ali  11  1.....MKKLLIILFFTVGVVGANAQKVVWDVACMEKLIANHKVQHKSFSEMKNKELEISALQQKVAEKMTVIEQYQSKFYNSLKSVEAILKTGKDIIYCTDIAKDIGKYQKQMMDLAKDDPQLLIVAAKAE---LELVNRTADMSKYIYQVAIVGTDVNLMDNKQRLDLLKHVISELRDMRSVAYSIVRQMKTAKRNGILQTLYPGNYKNNSDKIVDQVLKEYKVNPK.. 222
38 2.000e-37UniRef50_A0A1M6SGA8 Uncharacterized protein n=3 Tax=Prevotella TaxID=838 RepID=A0A1M6SGA8_PRERU  ali  45  8...KKQCRLLAMAVLMGMPASSLAQVGEANPLQYAAIAEGTYMLNSAINSQTKGMQKTAAFQGTIAAEFTKMKQWEGKYNAYLKTARGYAEALKAGTTLYADGVQTLQHLYEIQRAVNANPAGIGATLAMNDLYLETASEFIKTYRLLKVSVAKGGTDNMLTGAERTEMLWQLADELARLNAKLRTLAISIAYHNFTDVWNQYTAGMVDKSHGEIAADAYERWRRAS... 231
39 5.000e-37UniRef50_UPI000DEBE7B9 hypothetical protein n=1 Tax=Pedobacter sp. RS10 TaxID=2259170 RepID=UPI000DEBE7B9  ali  11  1....MRGFILLIHLVFGCYFGIQAQQKALNIPGIHQLVSDSKTENEKQREARERQGVNLLNEQANRTMLAKLKNSYREIQGRFNVIGTAMVAFDVDLKAVPIVQGITGDQVKFYELARANPALLLLVYETE---AEFLLRSKDLLSFLIGLTVSIGAVNQMKVSDRKILFDFFLAELSRLRALSSGLLNMISYGNMQALLMRLNPSDYINTDRSLIEDIIRNAKYLKR.. 222
40 6.000e-37UniRef50_A0A2E9FXY4 Plasmid transfer protein n=1 Tax=Thalassobius sp. TaxID=1979401 RepID=A0A2E9FXY4_9RHOB  ali  14  1....MKKTILLSLLAMLLAIGLRAQAIVWDPFVMSQLVTQHKAQQAELKKIKKNEGQIFAAQTYISGKMAEIKEIEEKMHTRLKNVTAVVKDAKDIVYATKISKDIGKYQEEMINYARDNPALLAVAYNAEKA---LVDRTADLFTYVYTNALIGGEINLLDNKQRQEIIEHVVNELRIMRGLAYGVSRKMRMASRTGVLEYLNPFKYPDQDLAIVNDILND........ 218
41 6.000e-37UniRef50_A0A0X8X5T5 Uncharacterized protein n=27 Tax=root TaxID=1 RepID=A0A0X8X5T5_9SPHI  ali  11  2....KRKLVLFLLPFAFYLSPCFAQQSTIDIAGMHQLIDQSKNEHTQQVNARNNQAAVNANEQANLTLLEKLKNMYRTLQQRYNTLGTAINIADIGIYATPMVEQIISYQGQVVKLVQKNPAIAFLGVQSE---IEFVEKAEGLLGYVAGLTLSFGDVNQMKASDRKLLFDYVIQQLSEIQELSGNLVNTLSYSNLSTLLRSLNPQNFVDMDKNMAEDIIQNAKYLKQ.. 223
42 1.000e-36UniRef50_A0A077XUT6 Uncharacterized protein n=16 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A077XUT6_9SPHI  ali  13  1.......MKLIFLILLLVPNLAFCQ---LNVELLHQLVEHSKDEYERQKDVRDRQAITSANEEVNNLGTGRLKKRYREIRERFNVLQTALQGLSMSIESTPIIERIIVHQKKIVELASDHPEYIPLALKSEQ---ETINKAVQLGRYITGLFLVLGDLNQMKSSDRRLLYAHILDELRQIEGVSRGLVSTLYYKARKKSLDGLKPGDFMDKDRRIVDDILRQLK...... 212
43 3.000e-36UniRef50_UPI0002690EFE hypothetical protein n=1 Tax=Bacteroides ovatus TaxID=28116 RepID=UPI0002690EFE  ali  14  2....KKIISIWILLLCIGIAKVQAQN---DPVLAGMIMLYTDKAEKELKNQETVMLMQTTGHVWTTEEVKGTTDLQREFNNYLNSFRSIVCYAAQIYGFYHEVSRLTDNMGDFTGQLSRHSTNALASARRNKIYREMILNSVEIVNDIRTVCLS---DNKMTEKERMEIVFGIRPKLQAMNKTLQRLTKAVKYTSLGDIWREIDEGARPAADKDIVEAAQRRWRQIGRNV 225
44 5.000e-36UniRef50_A0A085ZA47 Uncharacterized protein n=11 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A085ZA47_9FLAO  ali  14  4..........FSLFFLGLGNFLFAQNTYIDPTVTAAMILYSENLKAKQNEVIEETSKLKDAQTWVGTQMVAANDIQNKILKGLKEVSGTLQNGIQVQQIYTELNKCYDYSAQVVQLASQHPQYAIFGTKASQ---KTYEQSLKIVTDITDILAS-GELNLATAGDRYKILHNISGNVKNLKLWLLAIKLRLEKANLLGFWNSINPFGYINTDKGIVENIMNKYKRN.... 216
45 2.000e-35UniRef50_A0A2T5YVR2 Uncharacterized protein n=3 Tax=Pedobacter TaxID=84567 RepID=A0A2T5YVR2_9SPHI  ali  15  1.....MKIVLFFILSLLSCQLALAQ---INIALMHQLVGVSKSEHELQSKARDKQGASSLNEELNRSSMNSLKTRYRQINSRFSSLGNAVNFLQLGIEASPLITEIYQKQSLLLSLCSDDPLLIPIALSAQ---IDLVDRSEMLLRYLYGIILSVGDLAQMRQSDRKILFTHAVSELRSISGTLEGLLLVIRAAKEKRQLNKNPFSSFTGRDRTLATGILQKIKTLKK.. 217
46 3.000e-35UniRef50_A0A1I0TT71 Uncharacterized protein n=1 Tax=Pedobacter suwonensis TaxID=332999 RepID=A0A1I0TT71_9SPHI  ali  11  1.....MRALILSLASFFCIQISEAQQKALNIPAIHQLVSDSKNEHERQSTARDRQAVNSINEEANRTLLARFKNRYRELQSHFNSIGTAIDLLDIGTRAAPMVSQIAKDQYSLYELAGKTPELLPFVLQTE---IDLLEKSRNLLYYLAGLTASLGAVNQMKSSDRRILFDHIISELSNLRNLAVGLVQTFNYGNIFASIRKANPSGYVEMDRAIVKDILQNAKYLKK.. 221
47 3.000e-35UniRef50_A0A1I0SNL3 Uncharacterized protein n=3 Tax=Pedobacter TaxID=84567 RepID=A0A1I0SNL3_9SPHI  ali  1....MKGFIMIIYLVVGCFFNSKGQQKALNIPGIHQLVSDSKAEYEKQQAARDRQRVNLINEQANRTMLARLKNSYREIQGRFNLIGTATVAMDIGLKAVPLVQGISDDQVKFYEIAKSNPALLLLVYQTE---AEFLSRSKDLLSFLLGLTISIGAVNQMKVSDRKILFDFVLAELSKLRALSGGLVNIISYGNMRALFMGLNPSDYINTDRSLIEDIIRNAKYFKK.. 222
48 7.000e-35UniRef50_A0A1A7KEE7 Uncharacterized protein n=24 Tax=Chryseobacterium TaxID=59732 RepID=A0A1A7KEE7_9FLAO  ali  11  1.....MKKIFFSGVLFFSVASVKSQQIVINDKLLSQITVNHGVRLGSEQTFLDSYEKQKELYDDINNKITQIIAIQEYIYQQLKNVSSTLTQSKKLIYLYQYLGKIVTNSNKMLDLSAQHPEYSVL---ISKYYIETGKQTMKLQQEVTQDILSEDKDFLMDAMDREMLIEKIFTRVRNINGNILYINLRLENAKKIPYLYQVPLRNYINIDKAIVGDIITKYHYL.... 219
49 1.000e-34UniRef50_A0A2T5ZBK8 Uncharacterized protein n=2 Tax=Pedobacter sp. YR016 TaxID=2135719 RepID=A0A2T5ZBK8_9SPHI  ali  10  18........IVLVILFIVSYMPVFSQKKALNIAGIHQLVADSKSEYDRQNNTRNNQTLTTANEQTNKTMLARLKNKYRELQQRYHALGTIISAANIGIQASPMISRIVNHQMEIYRMARDNPVFIGMAYQTE---RDFVDRSQSLLNYLIGLCASFGTVNQMKLSDRKMLFDHILLELNTLQELSAKLVNAMQFSQTSGMIRSLNPQNYIDQDKEIVQDIIRNAGYLKK.. 235
50 2.000e-34UniRef50_A0A1M6R4C1 Uncharacterized protein n=1 Tax=Prevotella ruminicola TaxID=839 RepID=A0A1M6R4C1_PRERU  ali  16  1....MRRIQYTIIMLLMAVTNIHAQ--QTDPALTAAVTTQTFTLKSLFDARHSTQEKILAATGIENVQLQQLHDIEKKVLDYMANVSGLMQNLYQVKRTTELVTEIPKNINEVTKACKGHLKGTAIALAVSDVYTEIASLSALCTSLVKTKTVDGNKVNLLNAAERYWLCEKIVSSLEDINSALYILSWQIQYLSWEDLWRGLDPETWCNQGRWMAESCIRDWDDLLK.. 229
51 4.000e-34UniRef50_A0A1M6SH24 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1M6SH24_PRERU  ali  17  4.....RYFILFIIVLLLSTKPAFAG---IDPGRVAAIELASDQAKKALKSQEKAQLLMTTGHAWIKEEVEATTDFQREFNDYLDKFHDVLSIAAEIYGIYYEVTQTSKNVKALGEVLSDSPSNALFSTRRNVVYRNIVRTTLDVIMDIRKVCF---EKSKMTEEEKNKVISSIRPKLRTINKQLRQLTLTLRYTSFLDVWNELMDRAYPATKHDIITRCRRQWWNNAKSV 228
52 5.000e-34UniRef50_A0A081PHE7 Uncharacterized protein n=2 Tax=Pedobacter antarcticus TaxID=34086 RepID=A0A081PHE7_9SPHI  ali  13  1.....MKRLIVIPIFFLLVQLGYSQ---TNVVGIHQLVDANKDEFERQKKARDNQALVNANEAVNRTQLEKLQVKYAEIQDRYSTLGTAISAARIGVDAYPLINNIINNQKAIIKEAGDNPILYAVAFESEKQFVQKANR---LVNYTIGLVATIGDINQMKAGDRTILFNHVIVELRQIAAISRNLAMTMAFNTWQNQLKNATPFGWVNKDKAIVEDIMRIWKS..... 215
53 6.000e-34UniRef50_A0A1H5W3I5 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=A0A1H5W3I5_PRERU  ali  18  5MNGKIKHIILVLSFLWMMPSLSHAQ---IDPTLTAMILEYTHKAKSQYNSQLEVMAVETEGHVWLKQEVEATKNYQEQFDRYISTFRGIISYAAQVYGFYYEINHLAENMGRLSHQIGDTPVNAIAVAHRNDIYVDIINQSIGIVNTIRQVCI----DTKMTEKQRIELVFSIRPQLQQMNRKLAMLTKLVRCTTMAQVWYGIEQRSLPHRKAGIVEECLGMWRVNGRSV 232
54 7.000e-34UniRef50_E5X3X8 Uncharacterized protein n=11 Tax=Bacteroidales TaxID=171549 RepID=E5X3X8_9BACE  ali  12  186...................IKGLAQSIVIDPAMIGTLVYSHQAQQGVLKDIQSEETKIRNFQILIQQKMSQIQSLQEKTYNYLSTVNAVVKNGKDIIYASTLARDIAKYQSEAAKYAVGDPKLLTIIAKTE---YELISRSVDLMIYINNIALQGGEKNLMDNKQRIDLCIHVVNELRRMRGLAYAVCRQMKSAKRAGVLKTLVPGKYVNSGKQKVDNILNGIKWISKG. 394
55 8.000e-34UniRef50_UPI00029A2630 hypothetical protein n=1 Tax=Pedobacter agri TaxID=454586 RepID=UPI00029A2630  ali  1.......................................................................MVTAQELIYTGLSNVNGALRNGLMLKSMFSTCDQIISFSNAMVEMGRKEPYLLLFA---EDMAREVALRSGRLISEVGDFVLKQGGNVLMDYNARDELLKRISDELHIISGLCYGAWRAMYWTGQRGIIRSLNPFGFINSDQRIVEEILLKAKYLKK.. 155
56 1.000e-33UniRef50_A0A2E9FXX5 Uncharacterized protein n=1 Tax=Thalassobius sp. TaxID=1979401 RepID=A0A2E9FXX5_9RHOB  ali  12  1....MDRLIKLTFILLFFAYQTHAQTMVVDYRLGAAIATNNVATMSALKPMREDTDDIKEYQQNIAIKTGIIHEVKDRMYQSKFNVAEEVKSGQNVISAAKLVKDIGDYQLQMVNYSKENPALLVVAYKAQSA---LIDRTANLMTYIYQNALKGGDENLISSKQRLELIRHVIKELRVIRGIAYGVNRRMRFAARVGVVKAVNPFGYPNRDVQIIKDILNDF....... 221
57 2.000e-33UniRef50_U5BZQ5 Uncharacterized protein n=1 Tax=Rhodonellum psychrophilum GCM71 = DSM 17998 TaxID=1123057 RepID=U5BZQ5_9BACT  ali  13  1................MLLNGAVLGQIYTDPAVAAAQAAHAAVLNNQLGTTNEKLTLIERGQLAITGNLTVVTTLQDKLFNGLSQVSSILTSLANIKEIARIATGIQSDVQDIMDLARDNPAFLVFAEQNATLFQQ---RAISLALEVNNFALQGGLENLMDAGERSKIIHSIMTDMMILRSYTYGMYRAMYFAKMKGLFKALNPQGYIEMDLAIMEDIIRKRNVLSR.. 210
58 2.000e-33UniRef50_A0A1G6WYL0 Uncharacterized protein n=2 Tax=Pedobacter TaxID=84567 RepID=A0A1G6WYL0_9SPHI  ali  10  12.................FNIQAIAQRIVFDRQHFAIVSENNAVRLSAELAHQSDLRAITSQFKQIQLNLAGVILTEQLIYASLTQVENGLKSAQALRQIGQLSAEIITESNAVLDAARSSPALLLFA---QGSCEQLRNRGLRLVEQVSAVVIKEGENLLMDYASRDQLLKKISLELKTIRALLYSIKKCMYWVKVNGMLKTINPKGFINTDKRMVENLLFNLKTLKR.. 220
59 4.000e-33UniRef50_A0A1V3QYH1 Uncharacterized protein n=9 Tax=Algoriphagus TaxID=246875 RepID=A0A1V3QYH1_9BACT  ali  11  1....MKYFWLLPFVFLATLGISFAQ---TNVALLHQLVEESKSEYNLQKEAKENQGRNAVNEEVNTNLLKSVKEKYRAVQDRFAKLSIVIDAFGIGAAADPLVNSIIDNQQQIVFYCSQNPELVLFAVESEKVFVE---RSYSLLNYLFGLSASIGVVNQMKVSERRILFQHILDELREINGLSYTVSKSLQHYLERK--RGVNPLQYVATEMALVEEIIQNAKTLTR.. 217
60 7.000e-33UniRef50_D7W901 Uncharacterized protein n=56 Tax=Flavobacteriaceae TaxID=49546 RepID=D7W901_9FLAO  ali  11  1.....MKKILILGVVALSSILVKSQQIVINDKLLSQITLNHGVRLASEQAFLDSYEKQKELYDEINNKTTQIIAIQEYIYQQLKNVNSALTQSKKLIYLYQYLGKIATNSNKMLDLSAQHPEYAVLV---SKYYTEIGKQVIKLQQEVTQDVLNEDKDFLMDAMDREMLIEKVFTRVRNINGNILYIILRLENAKKIPYLFQVPLRNYLNVDKAIVGDIIQKYK...... 217
61 9.000e-33UniRef50_A0A1Q3JZF4 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 41-5 TaxID=1895836 RepID=A0A1Q3JZF4_9SPHI  ali  15  1MKSKIAFMIIFFFCSIIFSNQADAQKLVIDPVMAGIATANAIIENNSYDKIKDNQKAIEKLQAATVVTTEFINKWQRKIYDGLLYVSSTVNNAYQVYDAARILANIYDLEKKIMQEARKEPLALIFAVKYQ---REMILHAIEYYIQIHQLILKTGDELLMNAGERTLLLNQVLESLRVIESYAVSSYYKVRYAVMNGILKTLNPGNFVNRDARIVKDILGRWKY..... 224
62 1.000e-32UniRef50_A0A1H9N568 Uncharacterized protein n=1 Tax=Pedobacter rhizosphaerae TaxID=390241 RepID=A0A1H9N568_9SPHI  ali  12  15....................RAFSQQVVLDKAHLSAVMANGAMRSASESLHHSYLQGSMDHFDQIKMRLAPLISTQELIFRSLSQVDGVLRDALIVKEIIALTQQNLTEAMALLNDARQNPQLSLFAESSTRM---LLNRSSALYTQLAEFVLKESPQALINHESRDALLKKISLELKVIRTLLYSARKSMFWAQVNGFFRTVNPRGFIARDKQLADDILYHLKTIKK.. 220
63 2.000e-32UniRef50_UPI0008E4DD0F hypothetical protein n=1 Tax=Prevotella ruminicola TaxID=839 RepID=UPI0008E4DD0F  ali  16  1.....MKRIYSILTLLSLTLCIYAQ--QTDPALTAAVTAQTVTLKSLFDARHSTQEKILAATGIENVQLQQLHDIERKVLDYMANVSGLMQNLYQVKRTTELVTEIPRNISEVTRACQGHLKGTAIALAVSDVYTEIGSLSALCTSLVKTKTVDGNKVNLLNAAERYWLCEKIVSSLEDINSALYILSWQIQYLSWEDLWRGLDPDTWANQGRWMAESCIRDW....... 223
64 2.000e-32UniRef50_A0A1V3QXY9 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A1V3QXY9_9BACT  ali  4.........LLFLFMCIVAVESYAQTVVFDKAHFSIVNANAAVRNASEIGYHQTLNIIRQNTDDIILNSSSLALVQTMIVNSLTQINEGFKDAIQVRMIAETVLDISSISAEAFQFAGDNPILFLFV---EEYTVQAKKRSLNLATEVSSLILKEGDNLLMNYNVRDELLDSVQKELQVILALVLAAKNSIYWAKTNGIIRSLNPQAYINRDLGLINEIIIKQK...... 216
65 2.000e-32UniRef50_A0A1H9N550 Uncharacterized protein n=1 Tax=Pedobacter rhizosphaerae TaxID=390241 RepID=A0A1H9N550_9SPHI  ali  11  1.....MKTPVLFSLLFFLPVCLCAQ---INVALLHQLVSDSKREYNAQNIARDQQARSSGTSVMNASQMERLKSLYRTNQSQINMLGTALNVVQISAQGIPLIEEISSLQTQIFSLCAHQPLLVPLALSSQ---LSIADRAAQLLRYCYGITLSIGALNQMRQSDRAMLFSFVIAELRSISGSLKGLEMSIRGVMTRFGSNSVNFSNFSSRDKTLVDEIIFKIKQLK... 216
66 2.000e-32UniRef50_A0A0J7LTJ3 Uncharacterized protein n=89 Tax=Flavobacteriales TaxID=200644 RepID=A0A0J7LTJ3_9FLAO  ali  15  4.........FSISVLLMVGSFAFAQNTYIDVTTTLALKLYSDNLENQQEKTLEQQTKLQQAQTWVSTQMTVANNIQNKVLKGLNEVSGTLKNGVQVVSIYNELDRCLQYSSDILELTRDKPQYSVFGVKATQ---KAYEQVIKLTTDVTDL-LKPGELNLATAGDRYKLLFSVSQNVIMLKIWLLATKLNIERAIRLGWFQSINPQGYINTDRSIVENIMWTYKNR.... 217
67 6.000e-32UniRef50_A0A1T4NZZ0 Uncharacterized protein n=18 Tax=Prevotella TaxID=838 RepID=A0A1T4NZZ0_9BACT  ali  40  7.....LRRVFALIALSVGTIPASAQLSSSNPLEYAAIAGGEELIGNQIKKQSKAMAAIAVEQGAMTVANTKMKQWEQKYNSYLKTASGYASAIKSATSLYADGMQTLTALWEVHTACRINPQGIAASLSMNNLYLETATEFIRTYRALKNVIAKGGEGNMLNGAERTQMLWNLTNNLERLNRKLRLLSVSVTMHSLDDVWNRAVTGKINKSNKVLAKESSKRMCRAISNV 232
68 6.000e-32UniRef50_A0A1V3N481 Uncharacterized protein n=8 Tax=Sphingobacteriia TaxID=117747 RepID=A0A1V3N481_9SPHI  ali  14.................ISSYGHAQ---LNVELLHQLVQHSKDENERQTTSRNRQAITSANEEVNYSKMDELKQKYRKLQNRFHALGLAIDASQIALQAAPLIAEIIENQDKIIGLASADPILIAMAYQTE---IDIAEKTYMLSRYLYALAISLGDLNQMKASDRKLLFGHVITELGLIAGVCRGLAVNMFYSSRKKMLSSMNPFSFINRDRQLVNDILAKLKQIKK.. 219
69 8.000e-32UniRef50_UPI000699D201 hypothetical protein n=1 Tax=Riemerella anatipestifer TaxID=34085 RepID=UPI000699D201  ali  11  3........VIFLTLSFFIGTNLISSQVVINEKLLFQLSKNQTVRLASNKSFFKSYEKQKELYDDINKKLTQVVTIQDFIYDRLTRVNQTILQGKQLKYLYKYLGEVGQHSQKLLQLTAKNPQYAILLTEH---YQAIVKEALLIQKELKEEILKEDKSVLMDAYDREHLISRIFDRVRILHGNVMFINLMLERARDTPYLYQVPLRDYINADKSVVEDIMRKYQYLK... 219
70 1.000e-31UniRef50_L1NT87 Uncharacterized protein n=9 Tax=Capnocytophaga TaxID=1016 RepID=L1NT87_9FLAO  ali  15  1.....MKNKILLSTLAILPFTTIAQNVYVDAATSLTLEIYANSIEKGQEKIEKEQNKLQKAQAFIATQLAAANKIQDKIYHGLSEVSGTLQNGMQIKRIIEETKECLEYHKEVNDMIRKHPQYAPFAHKAIKGAYE---QALQLGAEIAS-VKTGGKEHLATAGDRYMLLSSIESKVIGLKLWLLSIKLAMENVIRIGVIRALNPQSYIDTDKDIIQNILERYKN..... 217
71 3.000e-31UniRef50_A0A1M5HVR7 Uncharacterized protein n=1 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M5HVR7_9BACT  ali  15  1MNAKQ--LMVLMGVGMLVASRGNTQELVIDPTLSTMLAINGEVERKSMNEIKERQVMIQNLQTATAATVDFINRWQQKTYEGLTLISDNVKNAYQLYECAQVMKSIYESESAMIREAKKNPLALAFAMQMQK---EMVTRAIAYYNQIRTLVLKENDRNLMDAGERTRLMREILMDLQVINGLAYSSYLKVRLVVQQGLIQTLNPFSMVNRDAALVKDVLRTWK...... 221
72 3.000e-31UniRef50_G1WAE5 Uncharacterized protein n=99 Tax=root TaxID=1 RepID=G1WAE5_9BACT  ali  15  1.....MKLRIVSCIILLGTAFGHTYAQQTDPALCAAVEQQTLMLQSLYNKRNKTQQKIIAAEAAVTVAMDRVHHVENKMLDYLSNVQGAMQNLYQIKRAGELVAEIPSNIKLVRQSIPGHLKGTAITALVSDRIKDVTMEMTSLLPFMKQLVTSGSKVNLLNSAERYYVANNIVSKLESINLSLYLMAWEIRTYSWMALWYGLDPDGWIMSGKNIVEGLINDWKYL.... 241
73 7.000e-31UniRef50_F0R7G5 Uncharacterized protein n=159 Tax=root TaxID=1 RepID=F0R7G5_BACSH  ali  16  1.....MRHIVIMGLLLVCSLQLKAQ---IDPTLAGMVYLYTEKAEDQLKAQERAMLMQTTGHIWTREEVEGTTDIQRKFNDYLDSFRDIISYAAQIYGFYHEVGKLAENMGSLNDQLRSHAGNAIAVANRNRIYQELILGSVEIVNDIRQVCLS---DTKMTEKQRIELVFGIRPKLKAMNRKLRHLTLAVKYTSLADVWATIDEGARP..................... 201
74 1.000e-30UniRef50_A0A1R4KVA0 Uncharacterized protein n=1 Tax=Sphingobacterium sp. JB170 TaxID=1434842 RepID=A0A1R4KVA0_9SPHI  ali  13  7.......YTLTILCLLLVSHTLHAQ---LNVELLHQLVQHSKDENSRQNTARNKQALTTANEKVNMDKTGELKEGYAALQSRFNTLGEVMQVLSLGIEAAPVVRSITHTQQQLITLASDKPFLLPVALVGQ---REIGRKATRLARYLTGIFITMEDINQMKQSDRRMLYSYALEELRALSGISSSLVRSMYAAAEAKSRGAVPASDFINQDTPIAQEILEGLK...... 218
75 2.000e-30UniRef50_A0A077ECW3 Uncharacterized protein n=82 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A077ECW3_9FLAO  ali  11  13LKKKIFLRLFIPVVYVVLTSSGGGSTPAWQKENMNIEINATMKEHDRQKEMRKNQALNAGIETTNRSEWNSFKDKVTKVQDRLRIVSFALQAIPTGVAMSREVKKITQNQASIIDELSTAPYSIITVLPSGVQYVDDLQMVTRL---ITGIILSYGAINQMEKSERKILLDYALGEVKTLSRNSTHMLLKIRDIKAKVLRNKRAFQYYVNRDRQVVENIMKNIKS..... 239
76 2.000e-30UniRef50_A0A1G7JQV7 Uncharacterized protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1G7JQV7_9SPHI  ali  10  1....MRKLLVLIFPLALYLSPSFGQQSTIDVVGMHQLIDQSKAENKLQVQARNQQAAATANEQANLTLLAKLKNTYRTLQQRYNTLGTAINIANIGIYATPMVDQIIRNQAQIVQLTAKNPAIVVLGLRSQ---IEFVDKAQSLLGYVTGLTLSLGDVNQLKASDRKLLFDYVISELSSIQELSANMLNLLQYNNLAAVIRALDPQNFISQDKAMIDNILSNAKYLKQ.. 222
77 3.000e-30UniRef50_R5UMJ2 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:702 TaxID=1262747 RepID=R5UMJ2_9BACE  ali  18  1....MNIIRYRLALIVMLIMYAANSSAQFDPTLTTMIAVYKNKAEKQLKSQQAAMGMETAGHMWVAEEMETTTEIQRLYNDYLDSFKDIVCYAGQIYGFYVEIEKLTKNMESLGKALDRHLEGAFASLRKNEIYRNLLLNSVEIVNDIRKSCM---GETKMTEKQRIEIVFNIRPKLAKMNRDLRRLTLSVKYSSFAEIWADINQGNRPHPDKSIVKDCIEQWKRKGRL. 226
78 4.000e-30UniRef50_A0A1M5HW40 Uncharacterized protein n=1 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M5HW40_9BACT  ali  11  4.........LLFPLALALSSVATAQRVVIHQDLIQQSTANTAFKVALHGQYRDKLAQVEENRRGILTHVTTVEEVHRKVFNTLTNVDGALRNGRTLWYIGQKVPQIFTNLKTAAVLAKDKPYLVHLLAGHSQL---IMGRVGRLRQYLQELVLQNDPQVLINPIQREKMVHEVYTDISIIHSVSNSMVSMFKLYNLQDAVEKIVPKMYYNMDRTLVQDIMRKTK...... 216
79 4.000e-30UniRef50_G0J7P6 Uncharacterized protein n=7 Tax=Cytophagales TaxID=768507 RepID=G0J7P6_CYCMS  ali  10  4.........LLIFFLLANSFPLFAQTVVFDREHFLIVNENAAIRNVSEIGYQESLTRIWENTDDIGLNVSSLALVETMIYRSLSQVNEGLKDAIQVKQIGKTLQRIYSLSDETITIAYENPVLLLFA---ETYIRQAKERSFLLVSEVSAFVLAEGENLLINPNVRDQLLVKIQNEIDLIASYILAVRNSMYWANVNGVLKRLNPQADIDQNLNLINQIL.......... 212
80 5.000e-30UniRef50_UPI0007610A8B hypothetical protein n=3 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI0007610A8B  ali  14  4..........FLLVLFLLPIHGFAQVYVMDVEYMINSTKSDALLSSYQGFTNNHLGETKDYTGKSSERLAAVTAMTTVVYETHRTVKSVMKDSKSIAEVSKILADIYKYQAEVYKIAKGNAQMMLIA---ADLEQKSAGRIIDLLDYVNSFVLKEGKENLLDAKERASFIRYVIQELRVIRGVSYGVARRMKTARYGTLWDYIGVGPSIKDYRQIAKEVISEWKR..... 218
81 6.000e-30UniRef50_UPI00047B137A hypothetical protein n=1 Tax=Flavobacterium daejeonense TaxID=350893 RepID=UPI00047B137A  ali  11  1....MKKFFFLFLFFGWKCFSQQYLQPYYDEKHYKAVTENNVMRMTAEVALEKQTNKINENVNSINKNLAKVVATKNLIYNSLYEVNEVIKDGKEVKYIAQLLLDIKNEADGLFALTKDSPQYNVFAVSYGK---RIYTTSLTLYEDVRTMVLTSNKDILMNYNSRDELLKKVVYKLQLLRAELYGARTSIYWAKMNGMWNSLNPKSWINQDMYLINSIIINSKQL.... 220
82 8.000e-30UniRef50_A0A1U7PXZ8 Uncharacterized protein n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A1U7PXZ8_9FLAO  ali  11  1....MKKTHLFIAFSFWGCINVFSQDVAINEKLLAQITKNQTVRLASNQAFLDSYTKQNELYNDINKKLVQVVAIQNHIYTNLSNVNSAIKQSKRLVVIGELLIKVGKNSAEMLSLTAQYPQYSVLLYE---IYAKILDQSLALKNQITQEVLNEDNDFLMDQYDREKILQNIYTKASIVNSDILYIILKIKNRKVIPYLYQVPLRDYINLDKHIINTIIRQY....... 217
83 2.000e-29UniRef50_UPI000837AF84 hypothetical protein n=1 Tax=Vaginella massiliensis TaxID=1816680 RepID=UPI000837AF84  ali  13  5..........IFLIVLLCGIISNAQTIVINDKLLTQMTKNHSVRMASEETFLNSYEKQRKLYEDINGKIAQAIVIHEHIYRQLRNVNAALLQSKKLIYIYQYLERIKKNGSVMLSATTRRPQYAILV---SKYYNNILIETQKLFTELTAEILNENNDFLMDSMDREYLIENIYMRLRHINGNILLITWRLQSANEIPYLYQVPLRDYISLDKLIVDDIIRKYNYI.... 218
84 6.000e-29UniRef50_UPI00029B45EB hypothetical protein n=1 Tax=Pedobacter agri TaxID=454586 RepID=UPI00029B45EB  ali  12  3........MLFISLLVLIWTGSLAQ---INVALLHQLVDNSRSEHSRQTELRGKQAISSATEEINRSQASQLKTTYRDIQKKFSAVGMAIEGVQIGMEAIPLVDKISADQQKLIQLLRASPGLSLLAISSE---IDFADRSQMLLRYLYGLILSAGELNAMSRSDRQMLTSFVISELHSISLNLSGLVNALTASKRKIKPAAKLFSDAGMRDKQLASSILSRLKQISK.. 216
85 6.000e-29UniRef50_UPI000760CB91 hypothetical protein n=3 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI000760CB91  ali  14  3INSRKMKGVLTLFFTLTIVA-GFAQAPQFDVLQRNALIDLHWDLTKKLEEFTVSTGATALIEKENSRDYQAYVQKLQAIQNSRKLTVSVIEDITEVKYAFSIAEDIYEYQSKAIKAASGNSQLIQFVTEVNF---KMGKRINDLSLYIAGVIALQGDMNLMDAEQRNEVMSHIIRELRVLRGVSYGLYRSAVRADLNFKFKAVNPKPVSDHRKRIAQEVIQEWYNN.... 226
86 8.000e-29UniRef50_A0A1G6ZCK8 Uncharacterized protein n=1 Tax=Riemerella columbipharyngis TaxID=1071918 RepID=A0A1G6ZCK8_9FLAO  ali  15  1MKKRIILGQLVISIYLVICSHGPRPKPPWEKENMNQEIRHSMQENERQVDMKNKQVSNTALENTNKTQWEKLEKKVKKIQNRLRFVDFAMQGTPTGVKIYRKGLKIKEIQEAIIREVKSAPYTIAWAGEKELHFID---DFQMTLRLLVGIVASYGAINQMEKADRKILLDYALSEVERIERESEMTLFMVREVKRRMEFSLFKIKFWKNQDKEIVKEILSNI....... 225
87 1.000e-28UniRef50_A0A1Q3JZA2 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 41-5 TaxID=1895836 RepID=A0A1Q3JZA2_9SPHI  ali  10  24..NKMDGMLGVLFFICFFIPRPAASQFVTWAFHTFTQIKNSVFKCSWNYAYADKLKEVKENREKTLEYLVFVEQVQRKILNTLTNVDGAVKDGKTLWALGKKMPEIFTNLEKSVALAARKPYLLTITYNMYNIFYQ---RCLNLSTYLKEVILKSDEQLLIDPVRRHKLVYDVYSEVNVLYHLSKSILDQYRLKSLQDAIDKVIPSTFYNVDKMMVQDILRKMK...... 246
88 1.000e-28UniRef50_A0A239XYN8 Uncharacterized protein n=13 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A239XYN8_9FLAO  ali  1.....MKKILLTALFFSGFCLFQAQFIVINDKLLAQLTKNQGVRLASNQAYLDSYEKQRKLYEQANQKMIQVVAIHEFIYDKLSNINSSIRNGKQLVYFYKYLGDILTHSQEMMQLSAQNPEYAILLT---KYYNQIIRESVLLKQEMVSDIMNENKDFLMNAYDRDLLIEKMLARARAIDGWILYINIILKTAKNRPYLYQIPLQDYINLDRILVQDILTKYRNL.... 222
89 2.000e-28UniRef50_A0A073IA78 Conjugative transposon TraJ protein n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A073IA78_9PORP  ali  10  2....KRIMAVCLAGLLCPIMAVKAQWVTFDPSNFAQSIVNTTRNVVQTTTTAENMVK-------NFQETVKIYEQGKRYYDALKAVNNLVKDARKVQQTVLLVGEISDYVNSFQKMLTDENYTPDELSAIASGYAKMLEESSGMLNEMKTVVTSTSLS--MTDKERMDVIDRVYRDVRNQRNLVYYTNRNIGISYLRAKRRTIPEGCWTCTERTI............... 205
90 5.000e-28UniRef50_A0A1N6X020 Uncharacterized protein n=16 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1N6X020_9FLAO  ali  11  1MKNKVFLSVLLFTIYIVGTSSGGSSTPPWQKENMNLEIRHTMEEHDRQKEMKNRQVANLASENVNKKQWEKFQETTAKIQDRLRIVDFAMQAIPTGYVIYLESQKISELQSQILAEIQTAPYAIASILPAE---IKFVDDMQMIVRLLTGIVVSYGAINQMEKAERKILLEYALQEVKQLTLDARIMLMKIRDLKQKIAWVKFQILNYINKDKQIIQEIINHF....... 225
91 5.000e-28UniRef50_A0A1H4A2J0 Uncharacterized protein n=1 Tax=Prevotella sp. tc2-28 TaxID=1761888 RepID=A0A1H4A2J0_9BACT  ali  22  2...RKIAILILFLASVFRPTEVLA---LIDPARAAAIDVASELEKKALNAQYKVQMLQSTGHLWVRQEVDAVTDFQKEFNDYVSTFNNLLTYAAEIYGIYYDVNSLANTLQWLGREIDNHPENAFASTRKNNIYMKVMKSGVDVAMDIRQFLMSTKG--KATEAQRMKILGAIRPKLRQLDKEIKILCKYIRYTSINDLWREITGRHYPTSKKDVAIRCHQDWMSSAKN. 226
92 6.000e-28UniRef50_A0A174NT58 Uncharacterized protein n=2 Tax=Prevotella copri TaxID=165179 RepID=A0A174NT58_9BACT  ali  14  2..KKSNILILAVIAILMFPYPAHSQNGP-DPVRAGMFKLYAKTATKALVAQDADLTLNGGEHIMSKEEVDKINNFQNQFNKYLTSFDDILTIAAEIYAIYFEVDHAVKNIKELKSFTFSCPANTLAVASRSHIYSDIIDNGIQIAADVEKLLKDEDKNSKMTEKERIDCISRVRKSLQSMNYKIRKLNRLLRYTTLMDSWYELRGKYYPKSMYTISTECQKRWARKARGV 235
93 9.000e-28UniRef50_W6NZ48 Conjugative transposon protein TraI n=65 Tax=root TaxID=1 RepID=W6NZ48_9BACE  ali  17  137MRTRI---TMIICLCLLFAGRASAQWVVSDPGNLAQGIINA-------SKNIIHTSKTATNMVSNFQETVKIYQQGKKYYDALKSVNNLVKDARKVQQTILMVGDITDYVNSFQRMLRDGNFRPEELSAIAFGYTKLLEESNEVLTELRNVVNITTLS--MTDKERMDVVERCHSKMKRYRNLVS------YYTNKNISVSYLRAKKKNDLDRIM............... 334
94 1.000e-27UniRef50_UPI00029B3369 hypothetical protein n=1 Tax=Pedobacter agri TaxID=454586 RepID=UPI00029B3369  ali  1.....MKKWILLLLAAGLSGSSSAQMIVFDRDHFLTVNENGMVRISAEMATHNYYDSIHERLSDIKINIGALVLTEELIYRSLTQVDQGMKSILAVKEISTLIAEIFSETDQMIAFASKHPHLLLFAEQVSS---QLRQRGAALVENVSSVVLSEKSDLLLNFEKRDALLKKISLELRVIRALVYSMRKSMYWASQRSLF.............................. 192
95 2.000e-27UniRef50_A0A2T4T3H7 Uncharacterized protein n=823 Tax=root TaxID=1 RepID=A0A2T4T3H7_9BACT  ali  15  1.........MLMACGCLLAGNAHAQWVVTDPTNLAQSIINTTKEIVQTSKTVKNT-------LDNFKEVEKLYNESKKYYDALKKVNNLVRDAQRVKETILMVGEISDYVKNYKKMLSDPNFRPEELVAIANGYTKLLGESNNLLKELKQVVN--NTTLKMTDKERMDVVDRCYKEVRDYRNLVR------YYTNKNISVSYLRAKKQQDTDRVL............... 192
96 2.000e-27UniRef50_U5BYX0 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=U5BYX0_9BACT  ali  1....MKKYLLIFTLSLSLNAFGQ-----INIQLLHQLVENSKSEHEQQLEAKGNQAKNAFHEEVNRNILGEVKQGYKTLQERFAKLTLVFDAVGIANSANPLIRSIIDNQQQILFYCQRDPALLPFAVETEKLF---VSQSYSLLNYLIGLAASIGDINQMKMSDRRILFGHILHELKAVHQLSLGTSRTLQFHLKRKT-GGNPYQDYVQTEMGLVDEIMSNIK...... 211
97 2.000e-27UniRef50_A0A1M5HVV7 Uncharacterized protein n=1 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M5HVV7_9BACT  ali  12  1.....MKAPVLLILSFASVLPAAGQQDTWDVAATEVMIKTNKRHYSDHKEATTNQLASQASVATWKVGNNRLKNLADLLDSRLTSAAIVAADATTLYNIYRAVDEMITLQQQALRIAYKYPWLAPMVVQHE---RKIIDDAQDLASYITLLVLTYGELSKMKVAARKTLFHEIDLQLRELTGRCHSLYYSLKAFDAGQQIKNTRAGILVNRDAQLVKDILNKLK...... 216
98 4.000e-27UniRef50_A0A0J7J1W0 Uncharacterized protein n=4 Tax=Chryseobacterium TaxID=59732 RepID=A0A0J7J1W0_9FLAO  ali  11  1....MRNILLFTLAIFCSNLKLCAQTIVYNDQLLMQITKNQAVRLASNDSYLNSYEKQKKTYDEINQKVAQIVAIQNFIYDKLTNVNSAIKQGKQLYYLSITFAQIGVNANDVLSLTVQYPEYAILL---NRFYIGAAQELLKMQSELTNDILLEENDFLMDPYDRQVLIQNLSTKAQMINGYLVCIKIRLKNAKKIPYIYQITINTYVNLDRMIVKGIIEKYK...... 218
99 4.000e-27UniRef50_D7W5H0 Uncharacterized protein n=4 Tax=Chryseobacterium TaxID=59732 RepID=D7W5H0_9FLAO  ali  13  1..............MVFIMSFYKTQTPYIDVLTAPAMILYANQIKSEQEKTVDEMNKLQQAQAVVSTQMVLANDLQNKLYKGLKEVNGTLKNGIQVQNIYNNLSKIITNVDGIYNEVQDAPEYSIFATKSIQL---VTNKATDIYTDVADL-LTSGELNLATSGDRKRLLYNIENNTRLLNVYLINVKMTIRRAKRKGFWKSINPQTYVNTDRHIFQQILNNA....... 206
100 5.000e-27UniRef50_L1PBC6 Uncharacterized protein n=7 Tax=Capnocytophaga TaxID=1016 RepID=L1PBC6_9FLAO  ali  6....QLIVLFFFSAITTLQAQSSYYETVINSSLLAHISANHVTREASLANFNSIFKKQKEFYEESNKKIVQVLAIHEKIYQNLYNINSLFKQSKQLKYIGIYLGNVFENVQKMNRIAMENPQYAFWVKKQTD---EVINKATSLSNDLYTLTKKENRKLLMDSADRDALIDRIYMKVRLLNVSILNVINIIEFNKSRAYIYSIPFNNFVEHDKQLAEEIMQKYRRYKH.. 227
101 6.000e-27UniRef50_A0A1Q3JZA5 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 41-5 TaxID=1895836 RepID=A0A1Q3JZA5_9SPHI  ali  14  1MIKKSLYRFLFIAFYVLHIGDCLAQTQYWDAALTQILVETNKTNYKDNKEALSNQYVSHATVLAWKKTENDFKKIVDKIDKHLTTAFIVAADVTSLYNVYKSLDEMVDYQEKSFKILYKYPW---AAGWFFDKQADVYKSAKDMVSFILIIVFSYGDINKMQVSSRETVFRELNTLVAMLRAKCYSLYNKMKQVELAQLYKNTRPYKFYNKDKELVKEILKNIK...... 221
102 7.000e-27UniRef50_UPI000C251128 hypothetical protein n=1 Tax=Prevotella intermedia TaxID=28131 RepID=UPI000C251128  ali  27  12....KTRFTIFLFTMLFVSLSLSAGVTISNPSEYAVIKGGEDQLQSTTQKQLEALKKIDVKIATLYGINYKIRVYEKKYNKYLSAVSSFMTGIKAGSTIYLEGMEVLLALKDLKAAIKHNPNGVLVSISMNRLYLDIGAEFLRTFNIMSKIVDKGGDGNMHTGAERVMFLWDLSQGISHLRSKIEQLTLIIGVSSYEDLWNKAIAGKISKTNKVLAKESMKRMRK..... 233
103 5.000e-26UniRef50_L1NSP6 Uncharacterized protein n=9 Tax=Flavobacteriaceae TaxID=49546 RepID=L1NSP6_9FLAO  ali  10  1....MRKYSYIIGIFLLACGVSSVQKKGTSINNISQEVKATMDEHERQKRMNNKQSANTTSEAVNNKQWKKLKETTTKIQDRLRIVDFALQAIPTGYVVGTKSKEIKETQQRILQELQTTPQAIKKVLSSQ---IQFADDLQMVMRYLTGLVVSYGAINQMERKERQILLNYALDEVNRLANESFYTLMLIYDYKARLEYRKNMFKYYIERDKNLVEDLMKNIKSL.... 232
104 7.000e-26UniRef50_A0A2W5SI64 Uncharacterized protein (Fragment) n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5SI64_FLAPS  ali  13  1............................................HDRQKEMRQNQTLNAGIETINKNEWNSFKDKVVKIQDRLRIVSFALQAIPTGVAMSREIGKITQNQAAIIDEISAAPYSIVAVLPSEVQYVDDLQMVTRL---ITGIILSYGAINQMEKSERKILLDYALCEVKTLSRNSTYMLLKIRDIKAKVLRNKRAFQYYVNRDKQVVENIMKNIKS..... 178
105 2.000e-25UniRef50_UPI0004837C58 hypothetical protein n=1 Tax=Chryseobacterium caeni TaxID=365343 RepID=UPI0004837C58  ali  13  1MKSRILILCALSIIILITTSSSGNGSAYVSFPMMDVEINNAMKENDRQVNMRNKQISNTSLETTNKEQWSKFRETKVKIQDRLRIVSFAVQSISVGVAISREINMIKDYQSKTYEAIQSAPYSVVVALPAEINFLDKLQMNLRL---ITGIVLSYGAINQMEKAERKILLDYALGEMKDLRNEAFWTYSKVRDLINQVEWKKNSLKAYVNLDKQIIREIINNI....... 224
106 4.000e-25UniRef50_J6IUI9 Uncharacterized protein n=2 Tax=Capnocytophaga sp. CM59 TaxID=936370 RepID=J6IUI9_9FLAO  ali  10  1.......MLILIAFLYYQKTHAQYFTWTTNPRLLAQVTANNGVRLTSLEVFKKSFEKQKKWYEDAKKDMTKILAVHEFIYEQLYNVNSLFKQGQKVKYINEYLKKILKELQNLLDKGNKNIKYIHVVI---KYYIKVLQRIEDLGEGLKKIVEK-NKELLIDPYDRDELLDNHLFKIRMIYIELLNINNMLEFSSNRAYIYSIPLGTWVEMDKDLTKDIIRKIKTLK... 217
107 2.000e-24UniRef50_UPI0007618321 hypothetical protein n=3 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI0007618321  ali  11  1.....MKRVIIFYVMIMLPVVVMGQKPVTDVAVTGVLKLHDNDQNNLMDDSNDSQKGLAALGTAMQTQVDTMRTILVRLYNAKTKAQEVVKNLYDVAYAFEIIEQISDYQKQVYSYAQGDAELLLMAAILEK---QVVERITMLSTQI-TLALTGGSKNMLDNKQRDNLIKNAVKELKYIRGIMYGVRREIKSASTAKKFKNPKPLQLTDNRKQIAQELIKEFKQ..... 217
108 2.000e-24UniRef50_A0A1G9U348 Uncharacterized protein n=1 Tax=Catalinimonas alkaloidigena TaxID=1075417 RepID=A0A1G9U348_9BACT  ali  10  1....MTRALFIFLIMGIGGRSALQAQKVFDASVVSALVITHRQTQESLKEIKNNEGKLSGMQTLMARQMEEIKTIEEHLFHRLDQVNGLITTGKDLLYATTLVQHIGVYQKEMVDLAREDATLALVAARTE---LALLKRTKHLVLYLSTLFTQEGSFVLMDPGKRMALTRHVLDELRLMRGMAYGVVRRMRVARRASHLQQLTAGAFPDRGGDHVRQLLQQ........ 220
109 2.000e-24UniRef50_D7W5G9 Uncharacterized protein n=3 Tax=Chryseobacterium TaxID=59732 RepID=D7W5G9_9FLAO  ali  11  6.KTKVCFLILIFSNILKGQLTGGNYICYY---LINSEIQKTMDENEKQKEMRNKQLTNLSLESANKEQWSKYRDVTEKIRGRLNNLSFAVQAIPTSVNIVREIDKIYEIQSKIYTELSDAPIWIPVAL---NGQYEFINSLQLYIRLMAGIVLSYGTINEMEKAERKILLDFAQSEIKTLRQQSYSTLQKIINVKRKIKLRNNLLQNWVNRDKKIIQDIINNAN...... 222
110 3.000e-24UniRef50_A0A0P0M0P8 Conjugative transposon protein TraI n=2 Tax=Bacteroides vulgatus TaxID=821 RepID=A0A0P0M0P8_BACVU  ali  13  112MRAKS---LLIGTVLALCGTAADAQWVVTDPGNLAQSIIN-------MSDNIAHTSKTAVNTAESFAETVKIYEQAKRYYDQLKAVNNLIQDARKVRDIILMVGDVSDYVTNFGKMMNDGNFSPRELDAIAFGYARLLEESNGVLQDLRQVINVSTLS--MTDKDRMDVVDRCYYEMRRYRNLVS------YYTNKNIAVSYLRARKKNDLERVM............... 309
111 9.000e-24UniRef50_A0A2T4TB50 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 313 TaxID=652722 RepID=A0A2T4TB50_9BACT  ali  34  20..................GIKAQVSLEENNPTQYVALELGYDSIGKNIKSQIRKQVAIAALQGAIYREQRRVRKWKGSYQDYLSNERNVGKAMAAGKNLYIQALRILDNLLLLKKAIQNNPQGIAANFPMNDLYMEVTAEFISTFRILQTTVSKGGKEYKLNGTERVLLMWTLSDKLTKLNDKVQTLAECINHYTLIHVWDKVVAGKVGWTHGQIAERQRKEWIKRQK.. 229
112 1.000e-23UniRef50_UPI000761D877 hypothetical protein n=3 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI000761D877  ali  14  19.......................AQAPVTDVAILSQKTAAYVGQTNLLKTKKKTMSNMVTNNTAKLAEYEIVKSIESNFDKAKTTVKAVIRNSKDVVRITQIIDDIYQVQSQIMNHGQGQAELFVVAYDIEKA---VIRQIVELTKYLNDFALKGGEKNMLNNAERAKVIIHVLTELQEIRGELFAAERLMRRAKNAHKFNKSPNKPFQDKRAVIALDIINEYKQ..... 217
113 1.000e-23UniRef50_A0A2T4TBC7 Uncharacterized protein n=1 Tax=Prevotella sp. oral taxon 313 TaxID=652722 RepID=A0A2T4TBC7_9BACT  ali  18  3...KIKTLLLFICFSVCFPWEVQAG---VDPARAALFLELKQRQERWYKAQAAAIAANVEGHTFVAKQVKGITKLNKEYDDFLTDVDSVLNYVGTSYGLYIQVKESIRAIRDLKTALRKHPTGLLASARKNGLILDVSDTTGKLINDIRDVFLR--KENRISKKSRITLLEGIRENITTLNKKMWMLSRAITYTSLVDDWNELATSYKKKSKEIICKEAMHRWSRAAHM. 229
114 2.000e-23UniRef50_A0A2D0A6A3 Uncharacterized protein n=1 Tax=Chryseobacterium haifense DSM 19056 TaxID=1450526 RepID=A0A2D0A6A3_9FLAO  ali  13  38................................MMNIEINSTMKEHDRQKEMRKNQLANATVETANRTQWNGFKDKVTKIQDRLRIVSFAIQAIPTGIAVNREITKIIQNQTAIVNEIETASLSIIAVLPSQ---VQFVDDLQIVTRLIIGIVASYGAMNQMEKSERKILLDYALGEVKTLSRNSTHMLLKIRDIKAKVLRNKRAFQYYVSRDKQVVENIMNQIKS..... 227
115 2.000e-23UniRef50_F9DDI6 Conjugative transposon protein TraI n=135 Tax=Bacteroidales TaxID=171549 RepID=F9DDI6_9BACT  ali  16  1MKTRI--LMLLMGIVLLFSGKAHAQWVVTDPGNFAGNIVNSVKEIATASKTVKNT-------LDGFKEVEKLYNDTKKYYDALKKVNNLIGDAYKVKECILMVGDISEYVTSYKKMLSDKNFRPSELAAMASGYAKLLEQSGESLKELKSIVKSG--VLSMNDHERMQAIDRIYTTLRENRSLVSYYTRK........................................ 180
116 2.000e-23UniRef50_V8CKS9 Uncharacterized protein n=25 Tax=Bacteroidetes TaxID=976 RepID=V8CKS9_9BACT  ali  13  2....KTRVFTIIALCLLFAGRASAQWAVIDPSNIAQSIINAGKNIAQTTTTAQNMVK-------NFRETVKIYEQGKKYYDALKSVNGLIKDVQKVRKTILMVGEITDYVNSYRRMLHDSNFSPAELSAIAFGYTKLLEESNDVLKELKQVVNITTLS--MTDKDRMDVVDRCYMRMKNYRNLVN------YYTNKNISVSYLRAKKRNDLDRVMA.............. 199
117 2.000e-23UniRef50_G0J7P5 Uncharacterized protein n=2 Tax=Cyclobacterium TaxID=68288 RepID=G0J7P5_CYCMS  ali  13  3........VLLILLVISFSFPVAAQ---VNIALLHQLVEDSKNEHEKQSDAKANQAKNAINEEVNRNLMGQVKNKYRAVQERFAKLQLLVEAVGLAVSADPLLRAIIGHQEQIVFYCQSDPSVIPLALETEKLFVK---HSYSLMKYLIGLMASIGDLNQMKVSERRLLLQHVLHELRSINRLSLATSQSLESYIRQKSGMSPYPEFLLEGSAT-VDEILENAQLIKK.. 215
118 4.000e-23UniRef50_UPI00097F7D93 hypothetical protein n=1 Tax=Bacteroides bouchesdurhonensis TaxID=1841855 RepID=UPI00097F7D93  ali  15  3....KLRYTLILVFVITASTQAFAGWVVIDKNCLKIVASNTASQKLIEDKHNQRLDSIAFKKKKVELYSVSMATIKELYKLSMENVSGFGAESRYYKEIGLCAFDIVRNVPELVKTVSKAKFSLLCLNELGNLVAETQQLVGNFVNIVNTAEKKNDGYNLLDRYERMSLANGIYTNLMEIRYKVEGMLLMARYATMNDLFFAIDPEGWANTMRNSVDGLVMDWNRL.... 241
119 5.000e-23UniRef50_D7NCE3 Uncharacterized protein n=17 Tax=Prevotella TaxID=838 RepID=D7NCE3_9BACT  ali  17  1MNS-IRRTAISVILGFSLSISLFAQNGP-DGVRAGMFATYAKQAKKALKAQDILLAGNLTGHKYLKEEVAATTNFQRQFNDYLNSFDDILTVAADIYGIYMEVDEAMKNVKVVKGIVVRQPANVLAVASKNNIYTDIIENGLKLAADIEQILKDQDKNAKMTQYERLKVMDNIRLNLRTLNRKLRTLSRLIHYTTIMDSWYDLKGEYQPRKMGSITKDCLKTWMKHAKGV 237
120 9.000e-23UniRef50_A0A2V1IUH2 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IUH2_9BACT  ali  15  4.....LRYILPIIAVTLMAESGYAQWIVIDPKTIEQVGINMASQKAIEDEHNKRLDTIASKQKKLEQYTISMATIKEMYKLTMENVSGFGTESKYYVEIGRCALDIILDVPELIKVVNGAKFTLLCLNELGNIVTETQQLVADFVNIVNTAETKSDGYNLLDRYERLTLANRIYSDLMNIRYKVQGMMAMAQYATMNDLFFAIDPEGWANVMTNQVNGLVNDWNGLHK.. 243
121 9.000e-23UniRef50_UPI00047B8FBC hypothetical protein n=1 Tax=Flavobacterium daejeonense TaxID=350893 RepID=UPI00047B8FBC  ali  10  1....MKKNLLLLLFFCFYVNTAKASYISY--YLIHTGIDHQLDENKRQIKIKDNQAGVLALEQNNKEQTTTLKTKYAKIKSRLNSLGFLFDAVMVTPSAIPAIKNTIANQDKIIKEVQNDPLLIPIALKSEK---DFVYKIQMISRFITGLAISYGDINQMKSGDRKMLLNHAIDEINILESISGNLLSIIQNIKMEKLIAKHNWNNYINREKDIIKEIMNNSKQI.... 217
122 1.000e-22UniRef50_D4IQ28 Uncharacterized protein n=18 Tax=Bacteroidales TaxID=171549 RepID=D4IQ28_9BACT  ali  12  9..........LLAAMLLAGHPLRAQWVVSDPSNLAQGIVNSTRQV--VEASRNGSTLLQSFQQTV-----KIYEQSKKYYDALRSVHNLVKSARRVQQTMLLVGDISDYISNFRSMLDDTNYSAEELTAMAAGYTKLLSASADLLNDLKQIITPSGLS--MTDKERLDIIDRIYYEMLEYRNLTEYYTRK........................................ 180
123 5.000e-22UniRef50_D4VNL4 Uncharacterized protein n=1 Tax=Bacteroides xylanisolvens SD CC 1b TaxID=702447 RepID=D4VNL4_9BACE  ali  16  1....MKWTIWISILLLCLTGIGEVQA-QNDPVLAGMIAVYTEKAEKELKNQEKVMLMQTTGHIWTKEEVQATTDLQREFNNYLNSFRSIVCYAAQTYGFYYEVSRLTDNMGDFTKQLKRSPANTLASTQRNKIYRELMMNSVEIVNDIRTSV.............................................................................. 150
124 1.000e-21UniRef50_F0ICQ6 Conjugative transposon protein TraI n=11 Tax=Capnocytophaga TaxID=1016 RepID=F0ICQ6_9FLAO  ali  13  2...KKMLLTGLFAITMLASPKLSAQWVVTDPTNFAQSIINTTQQIVQTSSTAKNMLN-------NFREVEKLYNQGKEYYDALKKVNNLVKDARKVQETVLLVGDISKYVTNFKKMSQDPNFSSQELSAIANGYSKLLGESSKLLKDLQQIVNSSSLS--MNDKERMDIIDKVHKEVKEYYNLVR------YYTQKNISVSYLRAKKQNDAQKVL............... 199
125 1.000e-21UniRef50_UPI000C2444F2 hypothetical protein n=1 Tax=Prevotella intermedia TaxID=28131 RepID=UPI000C2444F2  ali  18  1.....MKIPHQYILLFLFLFVGQMVYAQVDPIRAALFLKLKKESNKNINATQGALGAKWASHRFVKSEQEKITKFQRKFNKYLSDLDTAFTYAADIYALYNEVQTAKESLSFLKKTVSVCPQNVAAVASKNSIYKQLIQETFDVLSNIKVIYVNDKNITKMSVYERFEMCDKVRGQLRQINRKLRALAILVRSTSLLDIWYETTGKVYPKAMKEIADLSFNRWKSRLKSL 262
126 1.000e-21UniRef50_L1NT23 Uncharacterized protein n=1 Tax=Capnocytophaga sp. oral taxon 332 str. F0381 TaxID=1127692 RepID=L1NT23_9FLAO  ali  10  1....MRIFVLLIIFLSAVQIKAQDIAVAINPTLMAQLAINQYVRERAVDNVKDMYEKQNDWYKKAETKMAQVVLVHEQIYQALYNINSLFKNAKQLEQIHRDLNICKINTYKAVSLGIKK---TPYSVWMKKYFLYDLSLRINELRKIFSDAL--NKKLLMDAYDREMLLDNVNFKIQMINMSALNIINIIKYNESRAYIYSIPFGDYIEQDKMIVEQIMQQYDNLYK.. 220
127 7.000e-21UniRef50_A6L5N6 Uncharacterized protein n=57 Tax=root TaxID=1 RepID=A6L5N6_BACV8  ali  13  1....MVKLRFLLMAVLMLAASTQMYAVVVDKNCIKIVSSNLAAQKLIEKQHNARLDTIAAKQQKVELYSVSMATMKELYKLSMQNISGFGTESLYYKEIGSCALDIIRNVPELIKTVSKAKFTLYCLTELGGLVMETQQLVGNFVNIVNNAKIKSDGYNILDRYERMSLANSIYTNLNEIRYKVDGMMLMAQYATLNDLCFAINPEGWANTMRNQVDGLVSDWN...... 239
128 9.000e-21UniRef50_A0A077KLF9 Conjugative transposon protein TraI n=252 Tax=Bacteroidetes TaxID=976 RepID=A0A077KLF9_9FLAO  ali  12  2...KKVMYLVCTALMLAVAPSAKAQFVVTDPANLASGIINSANEIIQTSSTVSNVIK-------NFNEVKKVYDQGKEYYDKLKAINNLVKDARKVQQTVLLVGDVSEYVQNFGKMMNDPNFTPQELVAIGNGYSALLNESTELLKELKQIITSSSLS--LNDKERMDIIDRVYKEVKDYHSLVR------YYTNKNISVSYLRAKKKNDAKRVL............... 199
129 1.000e-20UniRef50_I8UXW8 Uncharacterized protein n=18 Tax=Bacteroidales TaxID=171549 RepID=I8UXW8_9BACE  ali  12  2....KRKIFSALCAFLLTVPAMHAQWVVTDPGNLAQGIVNSVNEMVETSE-------TAQNAMSTFKEASKIYEQSRKYYDMLKSVNSLVSGSLKVKESVLMLSEISEYVTNYGKMLTDGNYTQRELDAIAFGYNNIMKKSSASVAGLKDIINPTGMS--MTDKERLDLIERVYREMRHYRTLVNYYTRK........................................ 179
130 2.000e-20UniRef50_A0A2D3LAL8 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A2D3LAL8_PREIN  ali  17  2.........................................AALKQIYSKREKTQNKTIAAEGAITMALDRMHKVEDKILGYMANVQGAFQNLYQIKRAGELVKEIPSNMNNVRRAVHGGFQGTFLATVAGSELRDMTMEMTSLYPFLEQLVTSGNKVNLLNSAERYYICNTVVSKLENINTSLYLLAWEIQTMRWRDLFFKLDPEGWVMSGKNIVEGVVSDWNYNLR.. 209
131 2.000e-20UniRef50_D7W5G8 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=D7W5G8_9FLAO  ali  10  28........................YQLYYNLELQAQVTANQAARVASEKLYQNSYEKQRKAYDDIKEKAVQVVVIKNHIYNQLRNVNSALKQGKQLEAIYYDFTKLIGNMEKMLELSAQKPQYAVLIM---NYYSKLYLHAMNSYENISESVLNEENDFLMDSYDRQKILSKIQHEIKIMNGWTVHIINYLRNAEKKPYFRHIVFNSWYIRDK................. 214
132 5.000e-20UniRef50_F8X438 Uncharacterized protein n=65 Tax=root TaxID=1 RepID=F8X438_9BACT  ali  12  2....KRIFMCLIVALSMFSFQAKAQWTVVDPTNLVQ-----NVRTAIQGTT------TATNMIKNVQESVKIYQQGKEYYDALKSVHNLIKDARKVQKTIAMVSEITDYVTGFNKMLGDPNFTPNELAAISTGYARLLEEGGALVTDLRNIVTGSNGLSL-SDKERMDAIDDIHNKMLDYRNLTK------YYTQKSISVSFIRAKEKGDTDRVL............... 195
133 9.000e-20UniRef50_A0A1N7K154 Uncharacterized protein n=1 Tax=Chryseobacterium gambrini TaxID=373672 RepID=A0A1N7K154_9FLAO  ali  12  2...KKVLYLVCTALMLAVAPSAKAQWVVTDPANLASGIINSANEIVQTSSTVSNVIK-------NFNEVKKVYDRGKEYYDKLKAINNLVKDARKVQQTVLLVGDVSEYVQNFGKMMNDPNFTPQELTAIGNGYSALLNESTELLKELKQIITSSSLS--LNDKERMDVIDRVYKR...................................................... 166
134 3.000e-19UniRef50_A0A0P0F390 Conjugate transposon protein n=40 Tax=Bacteroidetes TaxID=976 RepID=A0A0P0F390_BACT4  ali  14  1MRKRIISM-LFVLSAFIVPASVQAQWVVSDPGNLVQGIVNSV--NEIVETSETAQNALSTW-----KETSKIFEQGREYYDKLRKVNDLISGSEKVKESVLMLGDISEYVNNFGKMLTDKNFSQRELNAIAAGYNTIMKKSSRSITELKNIINPTGMS--MNDKERIDLVNRVYREMTHYKELANYYTRK........................................ 181
135 4.000e-19UniRef50_UPI00097F6E2D hypothetical protein n=1 Tax=Bacteroides bouchesdurhonensis TaxID=1841855 RepID=UPI00097F6E2D  ali  16  1MKHRNIKVSWVLALSFVLPAKSFAYVIPKDLPTIEALIALHKAIKKDEDKALQRVAMSFGEQSLITKGADKFNDVRTTLDTRLSNANSYLVLAGAISSLYQLVRDYKNFTTHTFKYVSDKPF---VAWYYADANVAIAREIKHCYKLYATVAASGINLMKASMDEKLNLVLTLKTTIDRARGIIDNANLYCYLVTDCGIWEILN----STVKEEIANRIINQWNK..... 230
136 6.000e-19UniRef50_A0A0H5QKD9 Uncharacterized protein n=1 Tax=uncultured prokaryote TaxID=198431 RepID=A0A0H5QKD9_9ZZZZ  ali  60  8........ILTVIIAVLASLQARAQLVVSNPLEWLALAEGNEAINGQVKDQTDAQTRTAALQNTIAAEFTKIHEWEKKYSGYLQTVSGFASSLKASATLYEDGVRIFITLGKLKKAIGSNPQGIVATLRR.................................................................................................... 129
137 8.000e-19UniRef50_B7BHI5 Uncharacterized protein (Fragment) n=4 Tax=root TaxID=1 RepID=B7BHI5_9BACT  ali  19  1MRTRI---TFAICLCLLFAGRASAQWVVSDPGNLAQGIINA-------SKNIIHTSKTATNMVNNFQETVKIYEQGKKYYDALKSVNNLVKDARKVQQTILMVGDITDYVTSFQKMLRDDNFTVEELGAIAFGYTKLLEESNDVLTELK................................................................................. 140
138 1.000e-18UniRef50_X5DND2 Uncharacterized protein n=5 Tax=Bacteroidia TaxID=200643 RepID=X5DND2_9BACT  ali  10  2...KNLIVFILIVILAVAASASKAQTPVTDVGAGIQREALWTEEEGILSKINLYNVLIKALNGDIKGLTGEILGIDQKMLESLEKVSLLIKDYKRIKETKDILQQIIIYTDKVPLLVQDGNFTTQQAAAIVQSFDLILDDSKALVTSILNIIVK-DNLFMMDDKQRYDAINGIYLSVKQHYGTICYLHNKLMYASY.................................. 194
139 1.000e-18UniRef50_K1SEN2 Uncharacterized protein (Fragment) n=2 Tax=human gut metagenome TaxID=408170 RepID=K1SEN2_9ZZZZ  ali  42  2...................ISCFGQSVQSNPLEYAAIGEGESRINEIIGKQNEILDTLSVLHGGMVVAETKMKKWEQKYNNYLKTTQGYADAIKAGCTLYMQGMQTLTALWEINTACKINPQGIAASVSMNTLYAETAVELVKTYRILKTVVAKGGEGNMLKGSER................................................................ 149
140 1.000e-18UniRef50_J9CHQ8 Uncharacterized protein (Fragment) n=1 Tax=gut metagenome TaxID=749906 RepID=J9CHQ8_9ZZZZ  ali  18  1MYAKQWKLTLLAAAFGLMAGETQLFAQQTDPALTSAVLGQTAALKQIHKKRKKTQEKIIAAEVAVTASMERIHQVENKMLDYLSNAQGAMQNLYQIKRAGELVKEIPQNSSLLLKSIGSHLKGTAIAAMVSDELTDAATQMAALFPFMKQLVTSGKKVNLLNASERYYIANEVVSRLE.................................................... 192
141 5.000e-18UniRef50_A0A1G6ZAU3 Uncharacterized protein n=2 Tax=Riemerella columbipharyngis TaxID=1071918 RepID=A0A1G6ZAU3_9FLAO  ali  12  4......KFSILVICTLFLYVNIHSQTIVVNDKLLSQLSKNQAVRVANNNVLTNIFKKQREFYEDMEKKATEITLIEQYIYDNLQKVNNAISDSKQVRYTLQHTTNVMIKLIELSELSAGNIQYSIL---YTKYYRELLKLVLDIREELKQYTQKVWNR-LMDNYDRHFFISRLYDKVRLVEINTNYLIYLIKYAKMRNVINNTFLNNWVIQDKSIIGSIMIKYN...... 221
142 7.000e-18UniRef50_K5YXH8 Uncharacterized protein n=89 Tax=root TaxID=1 RepID=K5YXH8_9BACT  ali  17  25MKLRNISIISAGIIMLLLPVKASAYIIPKDLPTIEALIALHKAIKKDEDKALTRVATSYGEQSLIEKGAEKFNDVRTTLDTRLNNAYSYLVLAGAISSLYQLVTEYKDFTGNTFSHVSKKPF---VAWYYADANVAISREIQHCYRLYASVAASGINLMKASMDEKLNLVMTLKASIDRARYIIDNANLYCFLVTDCGIWEILN----SNVKNEIAERVINKWNQGYAG. 255
143 3.000e-17UniRef50_A0A0L8VAY2 Uncharacterized protein n=6 Tax=Prolixibacteraceae TaxID=1471398 RepID=A0A0L8VAY2_9BACT  ali  11  28................ISPKTAIGQAPVTDVGAGIQREALWTQEKGILSKINWYNILIEALNGDIKGLTGELLGIDQKLLESVEQVSGLIKDYKRVKHTRDMLEKIMEYTEKLPRLVQDENFTDQQAVVIVQSFDLILDDSRQLATGILNTILK-DRQFLMDDKQRYDTINGIYEDVRRHYGTICYLYNKLLYASYLKSFES............................ 213
144 3.000e-16UniRef50_A0A174I4T5 Conjugate transposon protein n=44 Tax=root TaxID=1 RepID=A0A174I4T5_BACUN  ali  15  7.........IIVGVVCLTAGAANAQWVVHDPGNLAQGIINTTKEIVE-------TSATAQHTLDGFKETAKIFEQGRKYYDALKAVHDVVKGGVKVKKSIEMVADISEYVRNYQKMLGDPNYTPDELSTISFGYAKLLSESADILQDLKNVVNVTGMS--LSDAERLAIIDQSYKRLLEYRNLVQ------YYTDKNISVSYLRAKKKKDADRVVA.............. 199
145 2.000e-15UniRef50_R5G837 Uncharacterized protein n=1 Tax=Porphyromonas sp. CAG:1061 TaxID=1262916 RepID=R5G837_9PORP  ali  15  1..............MAVSCSTAFAQNLVIDKTSVEQVGKNGAAAVAQEELIGSEFKEMKKEQNSVKKMMAVIERHLDKVDKTQQDISAFKKEGPAMRLFLLKFKRATKELELLAKALKENPKGAIGSARITSLSTDIYGISSSMISVVVDARFSKASMNLLEPQERLAFFERCCYDMDIVIFKIKQMQFEIQYTSLSEIALKIAPLTYSNYGEEICNDIIKLWKN..... 223
146 4.000e-15UniRef50_A0A1I0IJE5 Uncharacterized protein n=2 Tax=Hymenobacter actinosclerus TaxID=82805 RepID=A0A1I0IJE5_9BACT  ali  15  2...RMKLTILSLAVLGLSGGNARAQAVVSAPVLEVQSGIQTGLQKTMKGLSKAANILVKAGQELTKVFSEKNLKLARTWYDGLLQVSSAVRSYRRVQSVFEKQGKIIQTYSTAIETLRQSPFVQPEQLSMTSVYTKMLTQSANTLSDLQTVV--SPTMLKMTDAERMRFIDKISDQLSLITYYTQRNYVQMHLAEQK................................. 201
147 4.000e-15UniRef50_UPI000DBEC9FB hypothetical protein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEC9FB  ali  15  1MEFKRTKMGLLVVFLLSFTATAKAQTFSEWKTQKEYLAKQITGLQLYIGYARKGYETLRTGWNTVQMLRNGEFNLHGDFFGGLASISPIVRNYRVVPEFIALQLRLLDRMKTARKLFAAHVRLKPESEYLGAVFDKTVATASKLLDELMAVALQPGLE--LSEGERLKLIDRLYQQLQGLDRFVRSFNR......................................... 192
148 2.000e-14UniRef50_A0A0T7A051 Uncharacterized protein (Fragment) n=1 Tax=Sinorhizobium sp. GL28 TaxID=1358418 RepID=A0A0T7A051_9RHIZ  ali  16  1..............MLLSVCKMQAQN---DPVLAGMIYAYTDKAEKELKNQEKVMLMQTTGHIWLKEEVEGTTNLQREFNNYLNSFRSIVVYAAQVYGFYHEIDRLVDNLGGFTKQLDKHPSNALASAKRNKIYRELIMGSVEIVNDI.................................................................................. 134
149 3.000e-14UniRef50_UPI00096A6AE5 hypothetical protein n=1 Tax=Parabacteroides sp. SN4 TaxID=1750560 RepID=UPI00096A6AE5  ali  18  2.......LMVFLLSLFTLEAASQVVIVMVDPVNTKTMYEGNSIHEAGFNMLRENQSRILQLQTHISYFSTMMVKRETEKMNTLLNIDDFFSNIPWQEHFLGRMDTVRMNLNTIGRLIASYPKTSKLAI----VHKRLTEDLDDAFAKYNQAINKRGSENMMRNDERNHLAILAEDQLEKVAKLVREMFRSIPHAREQIM............................... 190
150 7.000e-14UniRef50_R9HNI7 Uncharacterized protein n=10 Tax=Bacteroidales TaxID=171549 RepID=R9HNI7_BACUN  ali  12  38............................................................................KKYYDALKSVNNLVRDARKVQQTILMVGDITDYVTNFQRMMRDDNFTVEELGAIAFGYTKLLEESNDVLTELKNVVNITTLS--MTDKERMDVVERCHSKMKRYRNLVS------YYTNKNISVSYLRAKKKNDLDRIM............... 169
151 7.000e-14UniRef50_R7KUI4 TraI n=1 Tax=Bacteroides thetaiotaomicron CAG:40 TaxID=1263054 RepID=R7KUI4_9BACE  ali  15  1MRTKI---IMLLVLCSLFAGKVNAQWVVSDPGNLAQGIINAS--KNIVQTSSTAQTMIKSFQ-----ETVKIYQQGKEYYDRLKSVHNLVKDARKVQKSILLIGEISDYVNSFQKMLSDENYTPDELSAIAYGYT............................................................................................... 126
152 1.000e-13UniRef50_D7NBM1 Uncharacterized protein n=22 Tax=Bacteria TaxID=2 RepID=D7NBM1_9BACT  ali  14  3.....KSKLILVMAMLLASLNIQAGWVVIDRKTTAAVVSNAASQKLIEDKHNGRLDSIKSKQEKLMKYTATMASIKELYQLSMQNITGFGEESKYYGEIVSLTAGIFKDVPIVLKQLGKSPNYVVCLNEMTNLVSETEGLVHDFVDIVNNGKIKDDGYNLLNRYERLTMANKIYSRLLEIHYKLEVMVMMCQFNSWGDVLMAIDVESWAATVRNSVDGLIDNWN...... 238
153 1.000e-13UniRef50_UPI000DD0594C hypothetical protein n=1 Tax=Chryseobacterium lathyri TaxID=395933 RepID=UPI000DD0594C  ali  15  1......................................................................................................MNKITQNQAAIIDEISTAPYSIAAVLPSEVQYVD---DLQMVLRLITGIILSYGAINQMEKSERKILLDYALGEVKTLSRNSTHMLLKIRDIKAKVLRNKRALQYYVNRDKQVVENIMKNIKS..... 120
154 2.000e-13UniRef50_U7ULV9 Uncharacterized protein n=11 Tax=Prevotella TaxID=838 RepID=U7ULV9_9BACT  ali  14  3...KIKKLMIVMAIMLFSVNSANAVKVVFDKNAIAAVGANTAFQTLIENKHNAQLDSIRSKQDKIMSYTASMASIKELYRISMQNISGFGEESAYYRQMAEQFIQVPGNTARAVKAIGRCPNYINSLNEIVNIQAEVVGLIEDFVDIVNNGKIKGDGYNFLDRYERLTLANKLLSHIVDINMRLQQIEYICEFCTFSNLMYSIDPLTWATSGKNIVDDVVSDWNYH.... 255
155 5.000e-13UniRef50_A0A126P4A5 Uncharacterized protein n=3 Tax=Hymenobacter TaxID=89966 RepID=A0A126P4A5_9BACT  ali  15  2...RKLLTIAVLGGVGLLARPAHAQFVISAPIAEGQATKHQGILTVLKDLGNTIVKKGNDTQAIIKSLEDQTVQMHDEWYSSLLKINSVVSNYQQVKTIWSYQNRTLSLYTQNITQLRSNPYLTPTQIQMVKGYTVLLSENVGLLDDLTTILTP--AAAKMTDAQRLKFINKISDKVTHQYQLVAYFTKR........................................ 190
156 9.000e-13UniRef50_A0A2X2S4M7 Uncharacterized protein n=1 Tax=Chryseobacterium balustinum TaxID=246 RepID=A0A2X2S4M7_9FLAO  ali  10  2......................HSPKTYIDPTVTAAMILYSENLKAKQNEVIEETSKLKDAQTWVGTQMVAANDIQNKILKGLKEVSGTLQNGIQAQEIYSELNKCYNYSSQVVQLASEHPEYAIFGVKASQ.................................................................................................. 111
157 2.000e-12UniRef50_UPI00040FFC56 hypothetical protein n=1 Tax=Adhaeribacter aquaticus TaxID=299567 RepID=UPI00040FFC56  ali  13  1....MKKCLLILGLIIGVQFSSSAQFVVADPTAFSQRAIQQITNITEQIQQKYELVRQ-------FQETNKIYNQGKEWYDGLKRVNQTVAEYEKIYETLQLTAEIVDYATNIQRFRIDKNFSPTEVSSITDGYGKLLRESSRLVDDLNLGAKSSSLS--LTDKERLDMINATYEKVREHKALVQ------YFTNKNISVSYLRAKKKNNTQGVM............... 197
158 3.000e-12UniRef50_W2CZ04 Conjugate transposon protein (Fragment) n=1 Tax=Tannerella sp. oral taxon BU063 isolate Cell 8/11 TaxID=1411915 RepID=W2CZ04_9BACT :_  ali  13  1......................HAQWIVTDPVNXAGNIANTIKEIATASKTVNNT-------LSNFKEVEKLYNDTKRYYDALKKVNNLIGDAYKVKETILMVGDMTEYVGAYKKMLSDPNYSPEELSAMAAGYAKLMERSSESLKELKSLVRSG........................................................................... 127
159 7.000e-12UniRef50_U6RAP5 Uncharacterized protein n=17 Tax=Bacteroidia TaxID=200643 RepID=U6RAP5_9BACE  ali  12  42..................................................................................LKSVNNLVKDARKVQQTILMVGDITDYVTSFQKMLRDDNFTVEELGAIAFGYTKLLEESNDVLTELKNVVNITTLS--MTDKERMDVVERCHSKMKRYRNLVS------YYTNKNISVSYLRAKKKNDLDRIM............... 167
160 1.000e-10UniRef50_A0A1M7LI59 Uncharacterized protein n=1 Tax=Chryseobacterium carnipullorum TaxID=1124835 RepID=A0A1M7LI59_9FLAO  ali  10  2...KKIFLILIIPIYIVMTSSGGSSTPAWQQENVSLEINAAMKEHDRQKEMRQKQTVNATVETVNQSQWKDYKDKVTKVQDRLRIVSFAIQSIPTGIAMSREITKITDNQTAIINEISTTPYSIVTILPSQVQFVDDLQMATRLTDD................................................................................... 150
161 3.000e-10UniRef50_A0A239AWR0 Uncharacterized protein n=3 Tax=Hymenobacter TaxID=89966 RepID=A0A239AWR0_9BACT  ali  14  3....KKIGILSLALLGLSVTQASAQLVVTAPVLEVQSGVQTGLQKALSSAANKLVSAGVKEQELTKMFSEKNMLMAKNWYDGLLSISSAVRDYRRVKNIFEKQTQIIQQYSSAIEVLRKSPFIKPQQLAMTTMYGKMLLESSNTIGDLQTIV--SPAMLKMTDAERMRFIDQLDKKITDQSGLVNYYTMMMRVAKEQ................................. 201
162 3.000e-10UniRef50_A0A132GXZ2 Conjugative transposon protein TraI (Fragment) n=2 Tax=bacterium F083 TaxID=1768114 RepID=A0A132GXZ2_9BACT  ali  14  2...RTKALVIIGLCMTLFVGKASAQWTVVDPTNLAQSIVNSTREIVETSTTAKNMINE-------FQETVKIYEQGKKYYDALKSVNNLVKDARKVQQTIVMVGDITDYVTNFQKMMSDENF............................................................................................................ 114
163 4.000e-10UniRef50_A0A1M6R5E9 Uncharacterized protein n=3 Tax=Prevotella ruminicola TaxID=839 RepID=A0A1M6R5E9_PRERU  ali  11  35............................IDYWTIAQVGENTAAESGAEGIHNNTLAEQKKKQERIAEYTTAINVIRQLYKQSMQNTRGFGEESRYYQLIGENALYIVTNIPVAVSWLTRKPHLPLCLNEISNLTMKTEQCIAGFVNIVNNNIGQDDGYNFMSRSDRMGMANDILEDLVIVRNNLDYLIFMCQTNNLEDLLMELDPDTWCNQMKWSVGDIVSGW....... 254
164 8.000e-10UniRef50_UPI00096A46B7 hypothetical protein n=1 Tax=Parabacteroides sp. SN4 TaxID=1750560 RepID=UPI00096A46B7  ali  15  30..........................IYIDPTHKAGEKDYISTTKKLITEINKSATATAALYTTASEEMKKLERLKREQYNALTTAYAFYTDELRIKRFNETLGTVKRNLQMGFSVIEANPQASFF---FRDRLIELIAEVNDAERVFKQATVIEGEDNQMSNADRNALLFKAEEMIAEIAKEGQNIVN......................................... 189
165 1.000e-09UniRef50_A0A132GRT8 Uncharacterized protein (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A132GRT8_9BACT  ali  12  2....VRARFAIVLGAFLLSVQAHAGWVVFDPWTTGAVTANAASQELIESQHNTRLDSINSKQQKIMQYTATMATIKELYKMSMENVSGFGAESQYYVEIGSCVAEIFKDVPVVLKYMNKSPNYVICLKEVTDIVLET............................................................................................. 137
166 6.000e-09UniRef50_A0A0U3H0L5 Uncharacterized protein n=1 Tax=Myroides odoratimimus TaxID=76832 RepID=A0A0U3H0L5_9FLAO  ali  14  1....MKKLNLLILITISFIMISHKSNAQGDAAVLGPLIAQTNILLGAIETSSVTMQSSIANLQAIQNQEYTTNQINDDI---MWKVSDIVKKSKEAVEIYEKEKRIFNKLQNINSMSSS--IGGNSYNEINNVVRKSLDTTSSLISMSNTIL--SDKSTRQTDGERKEFLNNILSNLNAIEMMINKLNRSISSYNKALTRSKENEQKY...................... 197
167 7.000e-09UniRef50_A0A126P7P7 Uncharacterized protein n=4 Tax=Cytophagales TaxID=768507 RepID=A0A126P7P7_9BACT  ali  14  20....................AAHAQAVVSAPVLEGIQTGLQATLKALNAKANTLADDGVVEQVLTKGFTEKNMLLAKDWYDGLLAISNTIKKYRRVQHIFERQTAIITIYSNYIGQFKADPNLTPQVVGMVKGYTTLIQESATYLDDLSAIV--SPAQSKMTDAERMELIDTLDDKVTHQYELVSYFTRR........................................ 191
168 8.000e-09UniRef50_W2CDS8 Uncharacterized protein (Fragment) n=4 Tax=Bacteroidetes TaxID=976 RepID=W2CDS8_9BACT  ali  13  18....................TAHAQWIVTDPVNLAGNIANTIKEIATASKTVNNT-------LSNFKEVEKLYNDTKRYYDALKKVNNLIGDAYKVKETILMVGDMTEYVGAYKKMLSDPNYSPEXLSAMAAGYAKL............................................................................................. 128
169 3.000e-08UniRef50_A0A0X8X5U4 Uncharacterized protein n=1 Tax=Mucilaginibacter gotjawali TaxID=1550579 RepID=A0A0X8X5U4_9SPHI  ali  7..FRILLFTSSLFFAFCFSLSAQAQEYVFDQQYFVSVEANQAVRSSAESTHDQYLGKINNNIQDVNINVGSVVLAETIIYN..................................................................................................................................................... 85
170 6.000e-08UniRef50_A0A132GS48 Uncharacterized protein (Fragment) n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132GS48_9BACT  ali  23  1.............................................................................................................................................................SSKMTEQEKNKVISTIRPKLRTINKQLRQLTLALRYTSFLDVWNELMERAYPATKHDIITRCRRQWWNNAKSV 76
171 3.000e-07UniRef50_E6MTL0 Uncharacterized protein n=13 Tax=Prevotella TaxID=838 RepID=E6MTL0_9BACT  ali  13  26.............................DLPTISALIELHKQMAKAEELSVHQVSASYLEQGVATENTTKFHEVRKTLNSKLNNAHQWIILAAAMSKTTLDVGNATKEYIQFTKLMSNNLFRKPIAWYFAETNYNVAKRISLLKNSITLLVASETNILKASLDERIEVIYNIQEQIAVIRSLINQALFWSKCVSLGGIWDILN----SDVYDGIAKDIINNWTSN.... 224
172 5.000e-07UniRef50_A0A1H6QKA4 Uncharacterized protein n=4 Tax=Dyadobacter TaxID=120831 RepID=A0A1H6QKA4_9BACT  ali  11  1....MRKITWLLCVLLLARPQAKAQTPE--VTQLILNIEKLDELRKILEELKKGYEILEKGYNTIKNLSEGNFKLHQAFLDGLLNTNPAVKNYAKVQQIISVQLTILQECRQARSWLSSQNGLDQVENRLEQLYVKLTSQSLQHLDALL-LVLTEGKL-RASDDERLKMIDKIHQDV..................................................... 170
173 7.000e-07UniRef50_K1SXQ8 Conjugative transposon protein TraI (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1SXQ8_9ZZZZ  ali  14  26..........................................................................LDKRYYDALKAVNNLVRSARKVQQCMLLVGEISDYVNGYQRMVVDDNFSAAELAAIATGYARIIEESAGELKELQDIVNPTDMS--LTDKDRIDVVERVY........................................................ 124
174 7.000e-07UniRef50_H1YAG9 Uncharacterized protein n=1 Tax=Mucilaginibacter paludis DSM 18603 TaxID=714943 RepID=H1YAG9_9SPHI  ali  14  1....MKKYMLILGLLCALGNTGQAQTWAEWFSQKKTQKKYLQQQIVALSMYSKGYQITKDGFQFINDAKNGELNLHQGYFSSLRAVNPKIRNLEKVKEIRDMQTEILNRYKTTWRQVRSSLYSSEEKASIATVYDGLLTDCEQVIDELTPIITPGEAE--MTDDERIERIDKLHADMTTHYTFSQSIASAI....................................... 190
175 9.000e-07UniRef50_J9FF31 Uncharacterized protein (Fragment) n=5 Tax=gut metagenome TaxID=749906 RepID=J9FF31_9ZZZZ  ali  14  10.............................................................QSMVTKGVSKFNEVRTTLNTKMNNAYSYLVLAGAISSLYMLIKEYKDFTSNTFKHVKKKPF---VGWYYADANVAVAREVKHCYKLYASVAASGINLMKASMDEKLDLVMTLIDKARYIVDNANLYCFLITDCGWKPIWEILN----SNVKDEIANRVINQWNK..... 175
176 1.000e-06UniRef50_G1WAC3 Uncharacterized protein n=1 Tax=Prevotella oulorum F0390 TaxID=702438 RepID=G1WAC3_9BACT  ali  14  27...........................VINPWAIGQVEANTAAVTLIENDHNSKLSQIQDKQKKIAQFTATMATIKEVSLLSLQNVSGFGEESKMYKEILSTLATMPKDFAITMKYLTKKNYLICMDEIMGLVY-----DVKHCTNTFKNVVTKNDGENLLDRWTRWSLANQILSDLKEIQYKIHAIAYMCQYCSMSNLIFAVDVDSWLSTAKNAVDGLISDW....... 243
177 3.000e-06UniRef50_A0A1I0TXP3 Uncharacterized protein n=1 Tax=Pedobacter suwonensis TaxID=332999 RepID=A0A1I0TXP3_9SPHI  ali  15  2...........LLSVLLFHTGAFAQVSVFNQGQTLKLLEQLVALRVYEQYLSKGYDIARNGTASISTIKTGDLGLHSAYFDSLSRVSSRVRTYPKVGAIARMQGQMIQAHNQAYRYAAAEKQLSTELMDFNASYRQLLGQAEANMEEL-QLVVSSGRL-KMTDDARLSAIDRLYAQMQRIYTGSASINRKI....................................... 182
178 4.000e-06UniRef50_E5USN5 Uncharacterized protein n=22 Tax=Bacteroides TaxID=816 RepID=E5USN5_9BACE  ali  11  2...RLLSIFFFFTGMSLHCVTAGAQWVVTDPGNTAQGIINAANTAS-----------------TVKQTVEQVNRLQTAL-DYVQKVSATVRRARMFTDLIDRQNRLNSNCLRTLEEAEKDMKGLP---GITSAVQDVVANNAAIIS-LTGDILSSD--LKMNDSERMEQLDGCLQEVRRQEASLGTIRQIMSHTR................................... 170
179 4.000e-06UniRef50_A0A1N6KB93 Uncharacterized protein n=2 Tax=Chitinophaga niabensis TaxID=536979 RepID=A0A1N6KB93_9BACT  ali  14  1MKNLLKLFSSFFFLMIILP-TAKGQSYEVQQLILNIEKLNQ--LKSILSQMYKGYTILNTGYTTIKGLSEGNFSLHKVFLDELLNVSPTVKKYRKAVEIINMQAEILKYKKSFASFSVKKILSEPESNYIEIVYQDLFKRSLKNLDELLMIITA--NKLRMSDAERIEAIDRIYDDMRE................................................... 175
180 4.000e-06UniRef50_A0A1M5FF36 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A1M5FF36_FLAFR  ali  14  2...KKIFISVVIAVTLFLPYKAGAQSAEIQQLILN--IEKLSQFKKILSDMKKGYELLSRGYKTVKDMSEGNFNLHKTFLDALMQVSPAVKNYKRVGDIVNLQVLLVKESKKLERFIKSGSFSQKELGYFEKVYGNLLNQSLRNLDELTIVITA--DKLRMSDDERLTAVDNVYLEMQ.................................................... 173
181 4.000e-06UniRef50_J9F3A1 Uncharacterized protein (Fragment) n=1 Tax=gut metagenome TaxID=749906 RepID=J9F3A1_9ZZZZ  ali  20  1..........................................................................................................................................................SDGYNMLDRYERMSLANSIYTHLNEIRYKVDGMMLMAQYATLNDLCFAIDPEGWANAMRNQVDGLISDWN...... 72
182 5.000e-06UniRef50_UPI000A1CD4D4 hypothetical protein n=1 Tax=Massilibacteroides vaginae TaxID=1673718 RepID=UPI000A1CD4D4  ali  1.....MKKFYLLSICLAFMANAKAQFPVTDLGNLFMKALDYIE-----------FSSTATSTVDNLKESKKIFEQGQEYYDALKDVHSIVKKSRNVEGCIKLSTEVVGYQTTYSKVMSDKNFTSDQINVYRKQQENIISAIAKNIEGLNNVIVNTGMS--IPDKDRLDAIDTYHARILALHNESRGLNFQM....................................... 174
183 6.000e-06UniRef50_I2F0Y8 Uncharacterized protein n=1 Tax=Emticicia oligotrophica (strain DSM 17448 / GPTSA100-15) TaxID=929562 RepID=I2F0Y8_EMTOG  ali  17  1MKSYSKKWGLTSLMFILTGSFAFSQFVVSDPIHTGISIAAKILHV--------------ANQITSTLHLDEVLKAAEK----LKKVSNGIKTFHRITQTVTNIKNAGQHYQQAVKVISTDKHFKPEMEKILLGYESLLRESSNVIKDLNQ--ATQGNFLEMKDGERLAWIEKVCDKANQHIKSIEQYTASVR...................................... 173
184 6.000e-06UniRef50_A0A2H1XW41 Uncharacterized protein n=1 Tax=Tenacibaculum finnmarkense TaxID=1680763 RepID=A0A2H1XW41_9FLAO  ali  14  1....MKKYTIMFVTLLLNIVQSHAQIVVESPTLSTLLVTANTQQATASATALQTKLQTVKNYLTNLKQLNEVIDAADK----LRKVAGYIKNGQTVVQIYDTEKRILRKIRTL-----SSNSNADFSSNNAAQIRNTILETTGLLVD-KAIQVISDDIFNMSDFQRENVLEEILEKLQQIEDLISNTS.......................................... 174
185 9.000e-06UniRef50_L0G251 Uncharacterized protein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G251_ECHVK  ali  13  2MKIKLLILMLMGALAWGNPVRAQSQEAVQLVLNFEKL----NQLKQILQDMYKGYHLLSTGYKTVKGIAEGDYKLHEAFLDGMLAVSPEVRRYYRIAEIVRYQQLIIEYTATYRQLSRDGKMGLAELEYLSSVYRHLFKESLKSLDELAMVLTSG--KLRMDDHERIEAIDRVFGEMQSM.................................................. 176
186 1.000e-05UniRef50_A0A1M4ZH54 Uncharacterized protein n=3 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M4ZH54_9BACT  ali  10  1....MKKVVCAVWLFFLCTSTTNAQDPVTEIIRRGIVKVIKAVDLKIQRMQNETLTLSKTRLEEIAGWVSKQRDLYQDYYEQLWRVKAAVSFYAQVRELAQRQMQIVQAYKTAWSRVRKDKFTTQELVYIGNTYTGILKQSLHNIEQVHKLIQSFALV--MTDGQRMELVGKVADDINR................................................... 185
187 1.000e-05UniRef50_F8ER92 Uncharacterized protein n=2 Tax=Runella TaxID=105 RepID=F8ER92_RUNSL  ali  15  1.....MKKTIAFITAFALAFAVQAQFVVSDPMHTGV------------------TTLIKLIQDPSFKTMVKNIE-------QLQKVASTVRQFHRGMETVKTVQNCVAKMQKLSAAVSGHIYPTEFSAMTQDIEA-LAAEGSSIFKDMRTATTQSGGVLKMTDAERVVFLDNAYKRVSRYSATIDRYFAKVRSMSIQ................................. 168
188 1.000e-05UniRef50_A0A1M3R123 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 40-81 TaxID=1895835 RepID=A0A1M3R123_9SPHI  ali  13  1MKTKV--LMITMLLLVVSSTSVFAQNK------FKPLIERIALLQVYLEYLQKGYSIAKNGWETVRKITKGEFDLHGDYFNSLETVNPQVKKYVRIGSIIAIQLRMVKAYKEAYQYAKDSEQFTPEVEYLSRVFENLLTQAAKDIELLTVVIT--NNKVKMEDKERLAWIDRIHEYMKDKEKFLYTFNAEMY...................................... 183
189 1.000e-05UniRef50_UPI000C0BF05E hypothetical protein n=1 Tax=Sphingobacterium sp. 1.A.4 TaxID=2044603 RepID=UPI000C0BF05E  ali  13  16..................SAQARAQSTEIQQLLLN--VEKLAQFKKVLKDMEEGYEILKNGYNHIRDISKGNFGLHRLFLDGLLKVNPAVRNYHKVASILSMQKRILESIGHTGDLVRQGGFDPKELEHLENLYSRVLQGCLEELGEL-TMVLSAGR-AKMDDGERLRTIDSVHERMERHLRLIRSLT.......................................... 182
190 1.000e-05UniRef50_L0G6D6 Uncharacterized protein n=2 Tax=Echinicola TaxID=390846 RepID=L0G6D6_ECHVK  ali  59.......................................NTIWLQNAQKVLENTLNKLK--LEEIAEWGERQKELYGDYYDGLWKVKSAIAQYQKVRDIARMQGRVTEYQKAWRHITASGQFSASELRWMEKVYLGILDHSVRNLEQVLGVV--SAFNMKMDDGERLALIDRVEKKVR.................................................... 194
191 2.000e-05UniRef50_A0A1I0IJF1 Uncharacterized protein n=1 Tax=Hymenobacter actinosclerus TaxID=82805 RepID=A0A1I0IJF1_9BACT  ali  11  67..............................................................GQIKGVIDKTQALHEQWYSSLLQISAGVRNYRRVKEIYTHQGEMISQFASAIPDLRTRQLTPTQLSEAASVYQALLQENVALLGELAGVLSSSKA--KMTDPERIEFIDNIADRIAGQHELMDYFGNKCR...................................... 194
192 2.000e-05UniRef50_A0A0F5IZV6 Uncharacterized protein n=10 Tax=Bacteroidales TaxID=171549 RepID=A0A0F5IZV6_9BACT  ali  1..................................................................................MKSVHDLVKGARKVQQTILLVGDISDYVTNFNTMMGDPNFTVEELSAIAFGYNRLLEESSNLLLDLKEVTTATGLS--MTDKERLDIINRIYGEVLEYKNLTW------YYTRKNIGISYLRSKKKGDSRRVLA.............. 127
193 2.000e-05UniRef50_A0A0A7LV74 Uncharacterized protein n=4 Tax=Hymenobacter TaxID=89966 RepID=A0A0A7LV74_9BACT  ali  13  65..............................................................GQIKGVIDQTQALHDQWYSSLLQISAGVRNYRRVREIYTHQSEMISQFSAIIPELRTKQLSATQLGEASTVYQGILTENIALMGELAGVL--SASKAKMTDPERIEFIDNIADRISEQHNLMNYFSSKCR...................................... 192
194 3.000e-05UniRef50_A0A1Q3TER4 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 44-61 TaxID=1895838 RepID=A0A1Q3TER4_9SPHI  ali  12  2...KKFIILSALFIVCTMPVSLKAQSY-----ELQQLILNLEKLRAILDQMQKGYQVIAKGYSAVKDLTEGNFSLHKIFLDKLLEVNPTVKQYKKIKDIITFQKNLIKEFSAGKTYFKKDVFNSIELEYLESVYQNLISESINNLDELIMVVTA--RRLRMSDAERLNAIDKIYQEME.................................................... 173
195 3.000e-05UniRef50_H8KNU4 Uncharacterized protein n=16 Tax=Bacteroidetes TaxID=976 RepID=H8KNU4_SOLCM  ali  16  2..KRCVMIGLVAFIMLTGFRRANAQQNEIAQLLLNVEKLNQFKQ--ILKDMQEGYRIVSTGYNAIKDISQGNFSLHKTFLDGLLEVSPAVKNYKRIAEIINMQKVLVEYKTAFMRFKSSGNFTTAELNYLFNVYDNLLDQSARDLEELVMIVTAG--ELRMSDDERLTAIDNLFVSLQDKLSFLRSFNNS........................................ 186
196 4.000e-05UniRef50_L0G2W6 Uncharacterized protein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G2W6_ECHVK  ali  12  1.....MTGILLLGMLCLSPVRASAQVGEASQLLLNVEKLNQFKQ--ILNDMYQGYRTLSRGYNAVRDIASGNFGLHKLFIEGLSTVSPVVKRYHKVGGIIHYQQVILEYRRAYRQFLDRGKFSREELDYLALVYGNLLDMSVCNMEELLLVVT--GGKLQMSDGERMAAIDRIFDEIK.................................................... 170
197 5.000e-05UniRef50_A0A1M4SD49 Uncharacterized protein n=3 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M4SD49_9BACT  ali  11  1....MWRIIMWILWFLVPYQKVAAQEQ--DAQQLLLNVEKLARMKEILEQMKSGYEVVAKGYLAVQNISAGNFDLHKVFMDGLVQVSPAIRNYYKVSQIVRWQLDLVKTSKATIKGVRGNNLLIPELDYISKVVGNLMKGSLKQMEALAMVLTSGN--LRMSDEERIKAIDHIWDE...................................................... 169
198 5.000e-05UniRef50_A0A1S9PLV1 Uncharacterized protein n=8 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1S9PLV1_9SPHI  ali  11  1MKKHIIKLTVLLFISISFSRTANAQGQEMQQLLLN--IEKLTQLKSILADMKTGYQIYEQGYGTVSSLAKGNFSLHSVYLNGLLEVSPVVRNYGRVAEIISQQASLLEYKSAFAKFKRSGSFNAKELDYMSSVYSHLVKQSLNDLSDLANVLTA--TKLRMSDDERIKAIDRIYDKLQFIRHNCQGTLLSLQRTKEMGQVKMLKQLYGINN................... 215
199 6.000e-05UniRef50_L0FX71 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=L0FX71_ECHVK  ali  42..........................................QLKNILNDMYEGYRILSTGYNTVKGIAEGNYKLHEAFLDGLWLASPGVRKYYRIADIIRYQQHILEYQSTYRSIAAGGEFSADELLYLSGVYQRLFKQSLQNLDELAMIITSG--KLRMSDYERIEAIDRVYDNMKEV.................................................. 178
200 6.000e-05UniRef50_UPI000D6EC491 hypothetical protein n=1 Tax=Pedobacter sp. R-8 TaxID=2203212 RepID=UPI000D6EC491  ali  11  1MESNDMKRAIIIPFLLVVSFQVNAQTVVFNQQNKKTMIQQILFTKTYREAAKAGYNICREGWNTVKGFRDGEYNLHNLFFTSLKKVNPAVKGYLKVGEIIKLQNDIILECSSLRKLNSSQNMTQDELRYVGKVCERLLKDCEQAIEQL--LAVLSDSQLEMRDDERIERIDTLYEEMLDRRRFSNTFYL......................................... 193
201 7.000e-05UniRef50_U6R926 Uncharacterized protein n=3 Tax=Bacteroidia TaxID=200643 RepID=U6R926_9BACE  ali  18  4......KIIMLFSLCLLLAGRASAQWVVTDPTNLAQGIVNTTKQIIQTSSTASNMLN-------NFQETVKIYEQGKKYYDG.................................................................................................................................................... 72
202 7.000e-05UniRef50_A0A077XWX4 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A077XWX4_9SPHI  ali  1....MKKILIFILLVGCFPPIVHAQNFNEWFRQKKTQKEYLAQQIAALQVYKGALKKVEGGLNVISDLKDGELSLHKNYFEGLNRVSPYVKQYPKIELISKCYKKIYKLNRQSEDMLSSKAFTAKELDAIHITWNKVMRNSHSLIAELEKICT--DSALEMSDIQRTEHIDRIHLDMESNLSFSHSFSMEVFTVKR.................................. 195
203 9.000e-05UniRef50_A0A239YTR8 Uncharacterized protein n=3 Tax=Sphingobacterium TaxID=28453 RepID=A0A239YTR8_9SPHI  ali  1....MKKHWLMLLISLCLSIPAKRLFGQSDVSQLVLNVEKLAQLKKILLQMKQSYSILSKGYGMVSQLSQGNFNLHRVFLEGLMEASPSVRKYRKVKEVVNIQLHLVSLCNTIKRYRNSGAFSIGELRYLASVQQKVLSESLGNLEEL--AVLVTGGLVQMDDGERLSAIDGIHRKMEETIGFLR............................................. 181
204 1.000e-04UniRef50_A0A1H8DF54 Uncharacterized protein n=1 Tax=Mucilaginibacter gossypiicola TaxID=551995 RepID=A0A1H8DF54_9SPHI  ali  13  1....MKTIRSFFAMAVLLIMTARARAQSSDLIQLILDIEKLTQLKSILTDMKTGYDIINGGYNQVKQIAGGNFSIHSVFLNGLLAVNPGIAKYGRVADIVLDQAAIVSEYSRYYRYFKGGNFNPDEIGYMANVYNELLQESLSNLDQLTSVVVAG--KLRMSDDERIKAIDRIYT....................................................... 173
205 1.000e-04UniRef50_W2CBM1 Uncharacterized protein (Fragment) n=5 Tax=Bacteroidales TaxID=171549 RepID=W2CBM1_9BACT  ali  11  1.............................................................................................................VGAYKKMLSDPNYSPEELSAMAAGYAKLMERSSESLKELKSLVRSGALS--MNDKERIELIDRIYNEVKEYRAATSYFTRK........................................ 79
206 1.000e-04UniRef50_A0A1C2GS74 Uncharacterized protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1C2GS74_9SPHI  ali  13  1.....MKTIKISIVCLLLSLGAHAQS--SDLTQLILDIEKLTQLKGILSDMKTGYQIVDGGYNQVRSVASGNFNLHATFLNGLNAVSPAVANYGRVADIINLVAEYKRYQASFRQSGT---FNAAELGYMANVYSTLLQQSLQNLSRLTDILMTG--KLRMSDADRLKAIDRIY........................................................ 166
207 1.000e-04UniRef50_A0A0A0BMK5 Uncharacterized protein (Fragment) n=1 Tax=Cellulomonas carbonis T26 TaxID=947969 RepID=A0A0A0BMK5_9CELL  ali  21  1..............................................................................FNNYLNSFRSIVVYAAQVYGFYHEIDRLVDNLGGFTKQLDKHPSNALASAKRNKIYRELIMGSVEIVNDIR................................................................................. 74
208 2.000e-04UniRef50_A0A1N6E6Z1 Uncharacterized protein n=5 Tax=Algoriphagus TaxID=246875 RepID=A0A1N6E6Z1_9BACT  ali  10  2...KKIHFLSCMFVLSLGIQLAQAQTDEATQLLLNVTKLNQ--LKEILSDLEQGYTTLRKGYSQIEKLASGNFNLHETFLNQLLEVNPAVKDYYKVAEIIHFQLQLLNDYKRAYSVFRQSGQFTQEISYLYQVYQNLMQKSLQHLDEL-TLVLTAGTL-RMSDEERLKAIDRIHQGM..................................................... 172
209 2.000e-04UniRef50_A0A179DM91 Uncharacterized protein n=1 Tax=Pedobacter psychrophilus TaxID=1826909 RepID=A0A179DM91_9SPHI  ali  13  1.....MKRTLLTIGFCCCYFLGFSQSAEVKQLLLN--VEKLKQFKNILEDMKKGYTIIDQGYGTIKKISEGSFSLHETFLDNLLKVSPTVKKYYRVNEIIHLQIRLAKNSSSALKAFSSKKGWSLEDFNYLQLVLKRIGKSSLQNLDDLTMILSA-NQLRMNDDERLKEIDRIYTEI..................................................... 169
210 2.000e-04UniRef50_A0A1F2KBE4 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1F2KBE4_9SPHI  ali  11  1....MRKHIKFLFITICCSLQLHLVSAQS--AEVTQLILNVEKLKQILKDMKKGYDLVSKGYGTIRDISEGNFSLHRTFLSGLWLVNPEIARYRKVADIIRYQAEILSQSKAALKRYQSGSYNTKELDYLSRVLGGLLDESLGNLDELVMVITA--NNMRMSDDERLRAIDRIFDDMQ.................................................... 174
211 2.000e-04UniRef50_A0A1Q3ZHG7 Uncharacterized protein n=1 Tax=Flavobacteriia bacterium 40-80 TaxID=1895763 RepID=A0A1Q3ZHG7_9BACT  ali  14  1MKTKAIIIAFWAAVLTLNPFA----KVLGQSQEMQQLILNIQKLKKILTQIKDGYQILNGGYNNIKNIAQGNYNIHKQYLDGLLNVSPTVRNYQRVSKIINYQMQIGEYKRAYSRFVSSGNFSPEELAYMARVYDNLLSQSLRDLDELVMILTSG--KTRMSDDERLETIDRLFFEME.................................................... 176
212 2.000e-04UniRef50_A0A0C1L280 Uncharacterized protein n=65 Tax=Bacteroidetes TaxID=976 RepID=A0A0C1L280_9BACT  ali  15  1.....MEKILMILLVHLLAASSKAQTTDEWLNQSSTLLQQIAALQVYLGYAKKGYNIVTGGINTIRNIKNGDLNLHRDFFNRLKNVNPAIRRYAKVPDIIAYQVKIIKQTKLVLQQIRETKQFTAELDYCKQVFDTLLDECIKTMEELILVTTSG--ELEMKDDERLKRIDGLYADVQ.................................................... 176
213 2.000e-04UniRef50_A0A1T4MMV8 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1T4MMV8_9BACT  ali  12  1MKLWICVVAVVFSSQLFLCVPARAQADEL--AQLALNIQKLSQLKKILQNMYDGYRIISKGYNTVKDLSQGNFNLHYVFLNGLYAVNPAIKKYKRIPDIINRQAAIVKEYKTAFNTFRSGLFSVEELEYMTAVYGRLTSESLKSLEELLMIITAS--KLRMSDDERLEGIDRIYANME.................................................... 175
214 2.000e-04UniRef50_F7MCK3 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=F7MCK3_9BACE  ali  19  1MRTRI---TLIICLCLFAVGRASAQWAVIDPSNIAQSIVNTSKNVVHTSTTAQNMIK-------NFQETVKIYEQGKKYYDG.................................................................................................................................................... 72
215 2.000e-04UniRef50_H7FVJ5 Uncharacterized protein n=30 Tax=Bacteroidetes TaxID=976 RepID=H7FVJ5_FLAFP  ali  13  2...KKILIIGTLFLSLFFPPRLAAQSQEMQQLLLNIEKLAQFKQ--ILTDMKKGYQILSGGYNTIKELSQGNFSLHETFLDALMQVSPTVRN-------YRRVGEIVKYQLLLVKEYKSANFSPAEIAYFSNVYSNLLNQSLRNLDELVTVITA--NTLRMTDEERLTAIDKVYADMQ.................................................... 173
216 2.000e-04UniRef50_UPI000D6D0161 hypothetical protein n=1 Tax=Dyadobacter jejuensis TaxID=1082580 RepID=UPI000D6D0161  ali  14  2....KKIGLLFFLFVGLGSTNLNAQMVTNDPIHTAITTLIKMFQDPSFKSIVSNIEK-------------------------LKKVTSAVRQFHRGTEIVSSISGITSKLTAYSTIAKDGHIYPVEYKLMSQDIQMFTQEATKLVKDMKSATAATGGVLQMTDAERAKWIDETYLRVSSFESKITRYFENIQNVSIK................................. 170
217 3.000e-04UniRef50_A0A2E4P9E4 Uncharacterized protein n=1 Tax=Flavobacterium sp. TaxID=239 RepID=A0A2E4P9E4_FLASP  ali  14  1....MKNLITILLMAFCISASGQSKQVKVLLQQISALRTYSGYLAKGYKIAQNGLNAISNLKN-------GELNLRKAFYDALATVNPAVSSHARVADITELLEGIINEEEQLKTIMTTGPFTQQEQQYANRVSGRLSGDCEKQLELLHALLT--DNELEMDDAERIKRIEQIYLEM..................................................... 164
218 3.000e-04UniRef50_R9HMV9 Uncharacterized protein n=13 Tax=Bacteroidales TaxID=171549 RepID=R9HMV9_BACUN  ali  16  2....KNKCLCSLVLLFMCVAQMSAQWVVSDPTLTTLSKLSWAKQLSEAAKQYGVLDKS--------------KNILGESLDLYKKVSGFIKNSRTVKNILERQTNMLKIAS--IECTRNDIYAPEAYDAYKDVINEVMDQSLVSFDLLRDVISTSAS---MTDGERLKIILDLDTKLQ--NNENRLLDERKRFNNINDAIKRIAA......................... 181
219 5.000e-04UniRef50_A0A1K1SZQ8 Uncharacterized protein n=1 Tax=Chitinophaga sancti TaxID=1004 RepID=A0A1K1SZQ8_9BACT  ali  12  1.....MKKLVLFICILAVYSSSYGQSAITSKTQRKYLAEQIAALKAYKGYLEKGYNIAKSGLNTISDFKNGEFNLHRIFFNSLKEVNPAVRKYAGIADIVAVQTDILTLYKSTSRYLKSNSFLPNEINYIDQVYTRVLNDCSKNIDELITLIT--DSSLQMSDDERLAKIDQLKANMSDNYDFTGAFYKDIR...................................... 191
220 5.000e-04UniRef50_A0A2T7BLM9 Uncharacterized protein n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A2T7BLM9_9BACT  ali  13  2...KKILILLFTPLFILGPMAAHAQEAEIEQLLLN--VEKLAELKSILQKMYDGYKILTEGYEKVKEITSGNFNLHEVFLDGLYLVSPQVRKYHRVADIIDAEATILEYKGTFGKIKSSGAFSSDQLGYLQGIYNNVLDGSLKNIDDLTMILT--DSQMRMSDDERLSAIDRIYANMQ.................................................... 174
221 7.000e-04UniRef50_A0A0W8EJW5 Uncharacterized protein n=1 Tax=Solirubrum puertoriconensis TaxID=1751427 RepID=A0A0W8EJW5_9BACT  ali  14  19....................NAAAQLIVSAPIAERSSISHQTTMSKLKSRARQLLDRGVKEQALTTKLVDQNLNLHREWYASLREVSATVRQ-------YERVRRIFENQGRIIELLHQQPGLRPEQIQTQRAYAGLIEESVGILDDL-QVVLQPG-HAQMTDAQRLKYINRIDERMQHHLALVIYFTRR........................................ 190
222 7.000e-04UniRef50_A0A1Q3PL67 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1Q3PL67_9BACT  ali  10  20....................RASAQTAEVTQLILNIEKLNQ--LRKILKELKNGYDILVKGYDTIRDLSRGNFKLHEAFLDGLLEVSPAVKNYKRVADIIRFQQQLLEYQAAFGQLRSTDYFNQDELGYMSGVYSRLINQSLKNLDALTTVLT--NKKLRMSDDERLSAIDEIYEDMQQ................................................... 175
223 8.000e-04UniRef50_R9HYY2 Uncharacterized protein (Fragment) n=1 Tax=Bacteroides sartorii TaxID=671267 RepID=R9HYY2_9BACE  ali  16  1....MKKTILLMAVCLCFVGKASAQWVVSDPGNLAQGIINTTKQIVQ....................................................................................................................................................................................... 43
224 9.000e-04UniRef50_UPI00035E7AD3 hypothetical protein n=1 Tax=Porphyromonas somerae TaxID=322095 RepID=UPI00035E7AD3  ali  11  3....MKKFRQIMLVLLLFTGGYSATVPVANAQVYAAMIKVVKEILQGTGAMDKKLAGLNEICGGMNNDIDSLWRATNTYYNDLKLLSGGVQDYRDMLNFIGHTRDIQGYCGAAINLTSRSKYLTLAEYEYVNNAVSIQEYSFNHLKKLYSLV-SQNGTLKMSDYERLQMLKELSDEQAKVLGSARNLVVYVKRAELR................................. 218
225 1.000e-03UniRef50_UPI000D6EB488 hypothetical protein n=1 Tax=Pedobacter sp. R-8 TaxID=2203212 RepID=UPI000D6EB488  ali  11  2..KKKIIIAMVFLASLCHCAPASAQSLANLLIKLGLNVEKLAQFKSNLTEIKNGIKVLTKGYNAVKDVTQGNFSLHKVFLDGLMEVSPSVKKYYKIPKIIENQIFLVEEYKNANRKFRSDSFTVEELSYIASVYNNLFDESLQNLDELITVTTAG--KLRMSDDERLKTIDRIDADMQ.................................................... 176
226 1.000e-03UniRef50_A0A2V6KN33 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6KN33_9BACT  ali  14  1....MKKYIALALVTVGVTVSARAQWIVFDPTMNVQSILNTAREIAKYVEMINNQVQQIQTLTD---QLNKFKHYEDLFGDPLTTVQPLVNDLRK....................................................................................................................................... 92
227 1.000e-03UniRef50_A0A1Q3T879 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 44-61 TaxID=1895838 RepID=A0A1Q3T879_9SPHI  ali  11  1.....MKRVLVLVAVICISNYGHSQTLVEWTNQKKTQIKYLVQQIAALQVYKKGYEIADKGLQTISNIKNGDFNLHRDFFGSLKAINPRIKNYAKVADITLLQIRIVQNYQKSYRRIKHSGQFTSEIEHIYKVFSRLLDDTADNIEQLTKLITA--NQYDMKDDERLRRIDELYTDMKDKDGMIRQ............................................ 184
228 1.000e-03UniRef50_A0A1W2DVF0 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1W2DVF0_9SPHI  ali  1....MKKIILIFMLMAAFAGISYGQSQEVQQLLLNVEKLSQM--KNILSDMKKGYEVVSKGYNSVKNIAQGNFSLHEVFLDAMMLVSPEVKKYRRIADIITYQSDIVEYKSAFNRFRSGGNFTISELDYLSKVYSQLFNQSLDNLDQLVMVITA--NKLRMSDDERLQAIDRI......................................................... 166
229 1.000e-03UniRef50_UPI0007168461 hypothetical protein n=1 Tax=Algoriphagus resistens TaxID=1750590 RepID=UPI0007168461  ali  10  11MKRQAWMLLAVFLSMGLGLKPAVAQDQEIQQLLLNVEKLNQ--LKKLLVQMKEKYDIIQQGYMRVKSVTEGNFQLHDLFLDRLYKVSPKVKTYYRVGETIQLQIQLLNYTRNILKDIKLDSGSSLDINYLTGVFSSLNAKSMRNLEEL--LLLITDNKFQMDDGERIRAIDRIYLDLRKV.................................................. 187
230 1.000e-03UniRef50_A0A2U2PHR1 Uncharacterized protein n=54 Tax=Bacteroidetes TaxID=976 RepID=A0A2U2PHR1_9SPHI  ali  12  1....MKILWVSLCGVLLFSPDVKAQSTEIQQLLLN--VEKLSQLKSILSDMKKGYTILTTGYNSVRNIAQGNFSLHEVFLDGLMLVSPEVRRYHKVADIITYQGDILEYKSAYKRFSGSGSFSVAELDYLSKVYQKLFNESLQNLDRLLMVITAG--KMRMSDDERLQAIDRIYDD...................................................... 172
231 0.002UniRef50_A0A1Q3ZHN3 Uncharacterized protein n=1 Tax=Flavobacteriia bacterium 40-80 TaxID=1895763 RepID=A0A1Q3ZHN3_9BACT  ali  11  2....KTKVLIISVLALLAVHTVFGQKKQT-----KIMLQQIALLEIQKSQVKKYYDIAKKGLKEIGSWTNGEKKAHDEHFKSLNNVSSAVKNHLNVAQTKQLRQKIAQITSKTYTEATGSAVFPQSELAYFKRVFARLNNDCNVSVEMLQSVTTDGK-MQMTDDERLKRIDDIHEHMTDNYTFVKSFCRDIK...................................... 183
232 0.002UniRef50_A0A1M6R556 Uncharacterized protein n=3 Tax=Prevotella ruminicola TaxID=839 RepID=A0A1M6R556_PRERU  ali  11  29.............................DLPTIEALIDQHKECMSAEDESNRQLAANASIKAMVKDVAQKYDDVKSILDKKSNDALSYLALAAEMSRCVTNTVRLTKEYSEFTRFAADHLKGKPLVAWYAEANYKVSKEIKNIRKLYLAVAASETQFFRATNKERMNIIWTLNQSITNMRDVIQQAYMWCGYIHESHIWEIIDTSVLEEIGKSVIKD............ 223
233 0.002UniRef50_A0A1D7QQR3 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1D7QQR3_9SPHI  ali  12  1.......MKKILTAVLTLCCTLQLQLASAQSAEIQQLILNIEKLKAILSDLKKGYDIAHNGYNTVKNISQGNFSMHQVFLDGLLAVNPELRKYRKVADIINYQVRILEYQSAFNRFKSTGNFTPAEIIYLGKVYGNLFDRSLENIDELAMILTAS--ELRMSDDERITAIDRLYEDMS.................................................... 173
234 0.002UniRef50_A0A1I0PNF9 Uncharacterized protein n=1 Tax=Chitinophaga arvensicola TaxID=29529 RepID=A0A1I0PNF9_9BACT  ali  11  1MKAKI--ISVLLLCSLLFADRVSAQSFEIQQLILNVEKLNQFREV--LDKMYDGYKIISEGYQKVKDVTSGNYKIHDLFLDGLYQISPEIKKYHRVPEIIEGQIRLAKQCRSGLKYFRDATFKADDIIYVSRVYSRVIDESLQNLDELLLVITA--RKLRMSDDERLTAIDRIADDMN.................................................... 173
235 0.002UniRef50_K1RMW0 Uncharacterized protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1RMW0_9ZZZZ  ali  12  3....KRTIWIGILLLCIGIGKVRAQ---NDPVLAGMILLYTDKAEKELKNQEKVMLIQTTGHLWTKEEVKATTDLQREFNNYFGLF................................................................................................................................................ 81
236 0.003UniRef50_A0A1M3HLL9 Conjugal transfer protein TraI n=3 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HLL9_9SPHI  ali  10  1....MKKIVICLCSALFLAGWGQ-QAKAQDPTEIIKEGVKKVIRQRIQTKTIWLQEAQKTLENAMQKLVQKQKDLYSEYFDELWKVKTFIAYYDRIKEVTARQIDLVNAYKSAWALLKNDKFTAAELEHMQDVYAGIIDESIRNLDQVVLIIKSFD--TQMSDADRLAIINRAADRIEANYTDLNRFNNQ........................................ 198
237 0.003UniRef50_A0A1G7IPV0 Uncharacterized protein n=1 Tax=Mucilaginibacter pineti TaxID=1391627 RepID=A0A1G7IPV0_9SPHI  ali  11  14..........LACIQFLTVRPANAQNIGDLAMQLYMDGVQLAAMKSTLTELRKGFQIVSNGYGNVKNISKGNFDVHKTFLDGLMAVSPAVRKYYKVREIADDQIRIVSERKQALQRIRSGNFNPQEISYISGVYENLVIQSLQNLDDL--IMVTTAGKLRMSDDERLKSIDRIHASMQ.................................................... 180
238 0.003UniRef50_L0G629 Uncharacterized protein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G629_ECHVK  ali  11  43....................................LVEQIAALKIYAGTAWKGYRIARTGLNTLSRIREGKFNLFEEWFAAMDGISPHVRDNHLVEGIIVIQGKILGETAKGRELLDRAGLRPREQLAMERNFRESVRRSLAVLAEMYAVIKPF--QLEMENAQRLEVLEGLFVRMDKIHRQLLTWNRKLNNFSRQRKWEQVNGQ........................ 210
239 0.003UniRef50_A0A1M5WDD1 Uncharacterized protein n=1 Tax=Flavobacterium frigidimaris TaxID=262320 RepID=A0A1M5WDD1_FLAFR  ali  18  1MKT-IKTTLFLIILLTSSLSFSQGAMLVSDPVGYAQLVQNASNTLQTLKTAKESY------------------EMAKEIYTTAKKVNDAFKSAKVCGQILDNLEGTYNNISSVPRLINS----IEHSTIRKNLLRATDDLTVDVFSELSATVVS-DNVLSMNDAERLSAITSLYQKSKDLREKSEQLIKVINRSK................................... 173
240 0.003UniRef50_A0A1X9YSA1 Uncharacterized protein n=1 Tax=Pontibacter actiniarum TaxID=323450 RepID=A0A1X9YSA1_9BACT  ali  1....MKKFCLLLLFAMACGLRLQAQSAEAQQLLLN--VEKLAQLKQLLSDMKQGYQVINTGYTAIRQVSEGNFRLHEAFLDGLLQVRPAVRHYRRVADILRDQFQLVRESEQALRRFRAAGFSAQELDYLSGVYGRLLEESLLQLEALSRLIT--DGQLRMQDEERLQAIDALFLDVEE................................................... 172
241 0.004UniRef50_A0A258E5V8 Uncharacterized protein (Fragment) n=1 Tax=Algoriphagus sp. 32-45-6 TaxID=1970314 RepID=A0A258E5V8_9BACT  ali  12  36..........LAGLFLISGLPAKAQSDEIQQLLLN--VEKLDQLREMLDNMRDKYRILTQGYNQVKGIAEGNFNLHQAFLNRLVQVNPKVKSYYKVGEIIELQLGLIQGLTKAKREFRVTDFLQQEFVQVDHLFTVWSRSSLHLLEELVLILA--DNQLQMDDWERIRAIDRLHLAVFDLSKGVAMFSNSL....................................... 213
242 0.004UniRef50_A0A1I5XEM3 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I5XEM3_9BACT  ali  12  18..................CFHASAQTDEL--AQLALDIEKLSQFKQILSDMKAGYQVLEGGYNTVKDISKGNFSLHKAFLDGLLEVSPTVRNYYRVADIINQLTLVKEYKNAYGRFKQDNNFSVDEIAYLGSVYDHLFKESLRNLDELLTVITAGKA--RMSDDERLQAIDRIYADME.................................................... 174
243 0.004UniRef50_H8KNU3 Uncharacterized protein n=1 Tax=Solitalea canadensis (strain ATCC 29591 / DSM 3403 / NBRC 15130 / NCIMB 12057 / USAM 9D) TaxID=929556  ali  1.....MRKLVMLILLLMCSPGLKAQSYDEWFRQKKTQKKYLVQQLAALKVYAAYLQEGKQGLGLIEGFKSGEFGLHTEYFNSLKNVNPAIKQHARVKEIIESRLKIRKVIDEMNKQLKSKAFDREERLYLIKVFQRIERDSKQLEDEL--ILVIENGKLEMKDDERISKIDKLHDQMQQ................................................... 177
244 0.004UniRef50_A0A0P0UCI5 Uncharacterized protein n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A0P0UCI5_FLAPS  ali  11  7..........TMLLFGCIASPVQAQN-----KTVKTMMEQIVALQVYIGYAQKGYSVVKTGLDIIGNLKRGEFDLHTDYFNSLAHVNPEVQGYVSIGKTLLLQGQILELCDGARDFLQGNPYMTDELDYLERVFAQLLEDCHTILEEMEAVAT--DNQLTMKDSERIQRIDGLYERM..................................................... 167
245 0.005UniRef50_A0A1H4AAK5 Uncharacterized protein n=3 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1H4AAK5_9BACT  ali  43........LMTAALLLAGSPGAPAQSVEVQQLLLDVTKLAQFKQ--ILTDLKTSYDILDEGYTTVKNIASGNFSLHEAFLDGLLLVNPALAKYGRVADIIRDELKLVSRYKQAFEYFKSGRFQAAELEYMTRVYKNLVDKSLDNLEALTTILTAG--KLRMSDDERITAINRIYKDTHQMLGFLL............................................. 216

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.