current user: public

If you have questions about the server, please let us know.

Query: PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;, from HGM_OVER

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# E-value Template Links and tools%idFirst MTKVFLIVSVACNVWFLLMLLSDRITETKFVRFLKGAAGLWRSLGTKSEKQDTLHSEASDEDADIIGKSRFRMAPTRTTAAISTQEAAISEKGIELSEEEATFDDGNTETASRPTQVPEDKLDETFTSISPEELEYGEDEPEDDEPGKGQASGSAFEDIDMAVRTIKKDSPSEAEMRHAGKVMTELDGTELYSRITERLTDEPMSERLAKAMAVFVDTVNTTVAQPKTKVFVVLDNIEEFEIRNNLast
1 2.000e-52UniRef50_Q56VF7 TraD n=214 Tax=root TaxID=1 RepID=Q56VF7_BACFG  ali  75  1MTKAFLIVSVACNVWFLFLLFYDRIMDTKLIRFFRHIAGLWRSLDSTVAEQGKDKEIPHADTSDIIGKSRFKMASTRTTAAIPTQEAATSEKGIELSEEEATFDDGNTETVSRPTQVPEDKLDETFTSIPPSELEYGEDKPEDEEPDKKQASGSSFEDIDMAVHTIWKESPSDEEMRHAGKVMTELDGTELFTRITERLTDEAMSERLAKAMAVFVDTVNMTVTQQKEKVFVIPDNIEEFDFRNY 245
2 2.000e-49UniRef50_F0F843 Uncharacterized protein n=32 Tax=root TaxID=1 RepID=F0F843_9BACT  ali  56  7MTDILLTVSVGCNLWFLFLLLYDRIMETRLVRFLRSIAGVWRSLGGTAAKPETVRDTPPADTPDIIGKSRFRMASPRTTAAIPTQEAATSEKGIELTEEETTFDDGNTETVSRPAQVPEDKLDETFTSLTPSELEFGEDEPEEETPDAPRASGSSFDEIDDAVRTAKNPEATTTERERAAKVFTDMEGTELYEKLMTG--SSEMSIRIKGLIEIRLKK------NKPKKDFVVPDSIENFDIRNY 243
3 2.000e-45UniRef50_K9EHW5 Uncharacterized protein n=7 Tax=Bacteroidales TaxID=171549 RepID=K9EHW5_9BACE  ali  30  1MTTVLVCLLVLYNAWLVTYLLWEK-----------------RQGAERPEADEPQPQGRTADPTDVVGRSLFRMTEKVPTPATSVPQAATYGESEEVEEEDVTFADETDGTP--PEQIPDDQLDDAFSDLRITDVPVEYDGDGPKDATVGYASGATFEEIDKAVRTAKNPSASEEEQRNAGKVFSQMEGNELFDRLTN---MSSIGSKITGLMDLYLNKPVIPKGGRKEPIPVMPDTVEGFNIRDF 231
4 8.000e-42UniRef50_E5WUK7 Uncharacterized protein n=5 Tax=Bacteroides TaxID=816 RepID=E5WUK7_9BACE  ali  30  1MAELLIVLMMAFNLWMVIYLTWE------------------RREDNKAEGGKEKDCGMKGIPDDVVGKSRFRMVERKPQAATTEPNAATVVQSEAVDEKDVTFADETDTENKTSRQVPDEELDETFSDSRVSDMAE-YDGDEDYDGTPHEASGVTFEDIDLAMRTVKKPKATREERRHAGMVFCDMKGNELFALIE--RNSDATRRKLNELMDYYLDSVSAAQAKPPKKAPAVPDNFEDFNIRDF 235
5 1.000e-39UniRef50_A0A239RJT5 Uncharacterized protein n=2 Tax=Prevotellaceae TaxID=171552 RepID=A0A239RJT5_9BACT  ali  35  1METLLIICLLACNAWLLHLLSSGR-----------------EKKDGRGKRQAEPSPDHHASMDDIIGKSRFRMFSPRAQAAIPAPHAATSDETEEVSISDTTFADEI--PQKSPMQVPADRLDEVFTDMRIEDADG-RDRWEESREDEPMAQGTGFEDIDKAVATVRKDSASDEDNLHAGKVFTRIETSELYDSIVSSYE--SVGTRVRQVMDMHLS--ALESKAAARKAFSLPDSIEDFDVRKY 225
6 5.000e-37UniRef50_UPI00044E3A95 hypothetical protein n=1 Tax=Bacteroides fragilis TaxID=817 RepID=UPI00044E3A95  ali  28  1MTTILVCLLVLYNAWLVTYLLWEK-----------------RQDGKSPGADGPPKREGTADATEIIGRSLFRMEE----AVKKVPQAATTSEEEELREEDVTFADEIPDEGMPQAQIPDDRLDEVFSDVRMEDVPVEYDEAPDGTAQIGYARGVSFEDIERAVRTAGDPRADHEAQRHAGMVFSLMEGNELFDKLVQS--SSAIGKKITGLMDRYLDTPVTPPKGTPDGTPVIPDSVEGFNIRDF 239
7 3.000e-35UniRef50_I9A5P2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=I9A5P2_BACUN  ali  22  1METILICLLLLYNAWLVHYILFG------------------RRQGNNAPAEEKPPIKPPETADDIVGKSRFKIQPKVPQATIPEPQAATEIEDEDVTDIAVTFADGKDEEPA--ARIPDDELDEAFSDIRMDDIPVEYAEGDEEGPAKRLATGASFEEIGEAVNIADNPEATTEERRRAGQIFSDMEGNELFNKMIGS--NPERAKKITGLMDEISGKTISGEGKAPQNISEVPADISGFDIRDF 231
8 1.000e-32UniRef50_A0A2D3NA82 Uncharacterized protein n=1 Tax=Prevotella intermedia TaxID=28131 RepID=A0A2D3NA82_PREIN  ali  35  1MTTFLIIALLAYNAWLAYHLLSRPSAA---------------KGQTASREEKEKERKVQDEAADIVGKSRFKMETTTPLAATMAPQAATQEKTEAVDIENTTFADETDEKP--FRQVPTDRLDETFTDIRINDVTGENEDAEDGETDTPTARGTSFEDIDRAVKSVRKSEADEEEKLHAGRTFKDIAETELFQKITESFTG--ISDRVNEAIDLY------TARAMQAKPLVLPERIEDFDIRDF 228
9 2.000e-32UniRef50_U2DY82 Uncharacterized protein n=4 Tax=Bacteroides TaxID=816 RepID=U2DY82_9BACE  ali  20  5..............FIIGTLLYYAIFLWRY----RDSLGTWRGRKKQPEQPESKPTVKTGNGDSLVGASRYRMGQMRTNGDILGHLS-------KGVDNASIFVPQSDEAEE-------------ETDVSPDEIEAEEIACYMGDSEPEMAQGITLGELVQMVQVIQVEQATEREERQAVQTICRTE-TNLFHSLVEQINGGR--SRVAELLQKHEIPVPVTVPAAG------NDEMAAFDMNDF 203
10 9.000e-31UniRef50_I8XSC6 Uncharacterized protein n=33 Tax=Bacteroidia TaxID=200643 RepID=I8XSC6_9BACE  ali  17  5..............FIIGTLLYYAVLLWRY----RDSLGTWFGRKKQPEQPESKPTVKAGNGDCLVGASRYRMGQMRTNGDILGHLS-------KGVDNASIFVPQSDEVTETPAEMEFETENTEETDVSPDEIETEEIACYMGDGEPEMAQGITLGELAQMVQVIQIKQASETEERQAVQTICRTE-TNLFHSLVEQINGGR--SRVAELLQKHEIPVPAIVPAAGSNEMA------DFDMNDF 225
11 2.000e-30UniRef50_A0A1M3EEH9 Conjugal transfer protein TraD n=11 Tax=cellular organisms TaxID=131567 RepID=A0A1M3EEH9_9BACT  ali  18  24.............................................KKVVKSKPQHPAVNPDLSEIMGKPKPVKRHI-------VPTSATKRQFDKKADIPDNFEAETNE-AGFAREIPQEELDEVFGSEPVSDEDEEWQEQGLPNSDNGFATGVTYEELTTVGALLQQDVLEPASQQKAVDIVQRIQGTELFSLLENSIEGA--SRKIAELLDKSL-----PARADFNSSNVRNKDLEGFDIGEF 211
12 2.000e-30UniRef50_R5S3G9 Uncharacterized protein n=17 Tax=Bacteroidales TaxID=171549 RepID=R5S3G9_9BACE  ali  29  24.........................................RRTGDTTREKNGKDGGNRTAASEIVGRSRFRMPETKPQTATPAPNAATEIRSEEVDEKDVTFVDEEDGTDAHRRRIPDEELDEVFTDRRVSDIAG-YDGDEEPDAEPDTAEGFTFEDIDLAVRTAKKADATGDERRHAGMVFCEMKGNELFALIERS--SEATRRRLDELMDYYLDSIPAPPAASTRRPPAMPERFEDFNIRDY 231
13 3.000e-30UniRef50_A0A1I5F256 Uncharacterized protein n=137 Tax=Bacteroidetes TaxID=976 RepID=A0A1I5F256_9FLAO  ali  20  20.........................................KGFLNKKADKQSIMPKANPTLPDIMGQPK-----AQPVITTSKKTAQTEIIKSTPEINPDDLDIEYDENETLYRQIPKEELDKAFTSTPLEEEEEEWYQYHISHTDNGFAQGVTFEELGTVTNLLQKVDLNQNQKGKAVDIVKRLQGTELFSLLEDSIQGASV--KIAKLLDNKLSSVSNNIPPTVQKS-----NLSDFDIGEF 212
14 7.000e-30UniRef50_A0A0F5J6K3 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A0F5J6K3_9BACT  ali  14  1METYLHFAVKLAVCAYVLYRVWVILFNERIFSLWNRIPVRPPKGTPEPV----IMVVSAKENPDVVGKTTIVYLEDPELAAKVPAHSEKLEPTDFIGEEPDISSDDVESDLSSEAKKPEEILEEKER--------FEIMDDLAPGLDPDFSTGLTYEEMANAIGVLTVSTDNEKQIIEAAKTIHSIKDTDLFEFFTNQVSN---LDNVEKLMSDCLDDNGKPLPIRKSKL-----ELDIFDINKF 225
15 9.000e-30UniRef50_I9RDM9 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=I9RDM9_9BACE  ali  26  25.........................................RQREHPASQPDVTSPEREDDVPDIVGKSSFKMRATTPIAAKPTPQAATEGKTESVTEKAPTFATGTDNRTS--ARIPDEELDEAFEHLEIPDIPLEYEEEPLAEGRRRYASGASFEEIDAAMKTARDPAADDASRRQAGRLFGQMEGTEFFDRLVSG--SADVAEKITGLMDYYLSPPPPTIGGAGTVAVQAQNTADGFDIRDF 238
16 2.000e-29UniRef50_A0A081TXB0 Conjugal transfer protein TraD (Fragment) n=1 Tax=Bacteroides fragilis TaxID=817 RepID=A0A081TXB0_BACFG  ali  67  1MTMILLTVSVGCNLWFLFLLLYDRIMETRLVRFLRSIAGLWRSLGGTAAKPETARVTPPAETPDIIGKSRFRMASTRTTAAIPTQEAATSEKGIELTEEEATFDDGNTETVSRPAQVPEDKLDETFTSLTPSGLGFGEDEPEEETPDAPRASGSSFD........................................................................................ 158
17 5.000e-29UniRef50_B3JE30 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=B3JE30_9BACE  ali  28  21.......................................TWERKESRKADGKDGIEPAREPLPDVIGKSRFRMPEMKPQAATPTPNAATEMQSEAVDEKDVTFDDEMEAETKPSRQVPDEDLDEVFRDNRVHDTDGEFD------GEPPEASGSTFDEIDRAARAVKDPKARKADILQAGKVFHELEGTEFYDMF--RRNNARYEARVSEMVETYLTSIQPAEKKTRMKA-AVRKEYENFNIRDY 223
18 8.000e-29UniRef50_D7I9S8 Uncharacterized protein n=1 Tax=Bacteroides sp. 1_1_14 TaxID=469585 RepID=D7I9S8_9BACE  ali  28  73............YLFILLFIYASYLSIEKYVHT--GGIFTWRGGKVKKERRTTPHPEISLSEAEIIGRSRYRMRQSLTMDDNSGQAESGIEKSGTFTEKETGPVLQAHEPFDRHTKYPEQKLNYPETDGSPSSGEEKEEIPERYESNPHRATGVTFDDLDMIEKVMTSDPVTEAEQEQTRQTFRKLEGTNMERILQAGILG--NNDKLKRYMRLYVDKGEPHLLTRKDKD----DILREFDITEH 318
19 9.000e-29UniRef50_A0A1R4IFL5 Conjugative transposon protein TraD n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1R4IFL5_9SPHI  ali  20  1........................................................................MGQPKPIERLSVPNTATERQIQENEINPANLDIEYDENENVSVQIPQEELDEVFRNPDLEEEEEEWNRYGISGGDNGFAQGVTFEELSSVGVLLQKEELEPAQKEPAIAIVQKIQGTELFSLLENSIEGA--SQKIAELLDSKLSSETETGSSTLRK-----NDLSDFDIGEF 167
20 7.000e-28UniRef50_UPI00068F8326 DUF4122 domain-containing protein n=1 Tax=Prevotella sp. HUN102 TaxID=1392486 RepID=UPI00068F8326  ali  15  3MEKYLYFAYLSWRLWIFLFALWGRLIAWARLIHSEMAKRRMVNMKKERRKPVMQSQAINGREEEVIGKTKIVYLEDPERRDVEPVRSEPLPASDFIGEDDEISDDEVENSLSARHGSVNDILSE--------EEKREMMEPVGAEPDADFSEALTYEDMKNVADVLAQGNVSEENCIRAAKTLYNIRQTDMFGFMTSQIGNMEL---VENLLRECLDEQGTPLK--KRKKMQDAKKTEIFDWNKF 246
21 7.000e-28UniRef50_F8X443 Uncharacterized protein n=15 Tax=Bacteroidetes TaxID=976 RepID=F8X443_9BACT  ali  23  27.........................................KRRKKNIVGQGSSIQETGRLKENIVGKSRFDLSASTPLAAKSEPLTATSLKSDNQAENPNIFASANEVKPS--AEVPQEELDEAFSDTPPDEDNEPMDIDYPLEYEVTLASGVQFDDLGNAVRTVNRNEATPEQKQKAGDTLLEMRQTDMFEQVISGKPDAKRI--VTDLMAESLSAFYERKDKEAGTTGSGKKAPDSFNIRDF 251
22 7.000e-28UniRef50_A0A255TTY3 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A255TTY3_9BACT  ali  28  3METIFLIVLAAFNVWTIYF---------------------YKKLLLEVANGKEKEKKPPIDPMALVGKSLFKVSQLRKKEETEQKQT----ESMSVSDNDVTFDD----SPKSTARISDEQLDDVFTNVRIEDIGVKYSDKEE-DADVPQAKGSSFEDIDAAVNTVKAPKATDKEKRHAGKVFHEMDGNQFYEKFME--NSEECKKNIYDYVTFYLQTHKIVEISKPKNEFKVPDSIEDFNILDF 215
23 1.000e-27UniRef50_A0A1I4ET84 Uncharacterized protein n=1 Tax=Porphyromonadaceae bacterium KH3CP3RA TaxID=1855396 RepID=A0A1I4ET84_9PORP  ali  20  1MVKIYLTTVVLYSLFVAICLVRMNVA----------------KRRRKEVIGKGETVRIERNNTEIIGKSTFKKPESKPSASKPEPATSTLPEQEKAIGKDDTFVPSVDDSPS--AVVPPEELEEAFADTPPDEDEELLDIDYPLEYEAALASGLQFEELGNVVRTIKKEEANRQERKAAGDTLLEIRQTDMFEQLVTGKPD--VRELVTTLMAASLADFYRKKDKEAGNTGSGRKAPDTFDIHNF 248
24 1.000e-27UniRef50_A0A1M5JF77 Uncharacterized protein n=4 Tax=Flavobacterium TaxID=237 RepID=A0A1M5JF77_9FLAO  ali  15  22..........................................PARVSNPGKKTGYIKSSAKVPNIIGRPKGFKSLLAPQDANDWHLKAAGDEVHNF--------DAEISREQHLTDWQDELDDANEYLPDFEQEEEEWNNFGISNGNSGFTQGVTFEELSSVGMMLQAEDLELSQKETAAALIQKIQGTELFNLLENSMEGA--SRKMAELLDGKLSSLNLNQYAPDRK-----NDLNDFDIREF 209
25 2.000e-27UniRef50_UPI000A1CA5EB hypothetical protein n=1 Tax=Massilibacteroides vaginae TaxID=1673718 RepID=UPI000A1CA5EB  ali  23  24......................................NTRKRRKKNIVGQGSSIQETDRLKSDIVGKSRFDLSQSKPLTSKSEPLAASSSKSENPTQNPDTFVPSNEIKPS--AEVPSEELDEAFSDTPNEEDNEPMDIDYPLEGQAALASGVQFEDLGNAVRTVNRDEATEEQKEAAGNTLLEIRHTDMFEQLVSAKLDAK--KMVTDLMAESLAAFHRRKDKEAGNTENGKKAPADFNVRDF 251
26 8.000e-27UniRef50_A0A1Y4PMB5 Uncharacterized protein n=1 Tax=Bacteroides ovatus TaxID=28116 RepID=A0A1Y4PMB5_BACOV  ali  25  3............YLFIILFIYASYLSIEKYVHT--GSIFTWRGRKDRKERQATPHPAASSSETEIIGKSRYQIRQSLTIDDNNGQLEPGMEKSGTFTPEKETEPDPLDKNTKFPEQKLNYPEIDYMREASPSSGEEKEEIPERYESNPHRATGVTFDDMDMIEKAMASDELTEAEQEQARQTFQKLEGTNMERVLQASVLGS--SDKLKRYMRLYVDKGEPHLLTGKNRD----DILREFDIREH 247
27 1.000e-26UniRef50_A0A1I4YZ96 Uncharacterized protein n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A1I4YZ96_9FLAO  ali  15  27................................................PDKTKILKRNTPKFPEIIGVPKNTGRHH-------EQETSSVLQIHEPKINPDNLDIEYDIHENLRVQLAKEQGPILMTSPDYDEEEEEWKKYRISGKDNGFAQGVTFEELSSVETMLQRDHLKPSQKETAAAIVQKIHGTELLNLLENSMESA--SRKIAELLD-----GSISSKNNSNSSFLQNNNPDGFDIGDF 210
28 1.000e-26UniRef50_L1NLK1 Uncharacterized protein n=14 Tax=Prevotella TaxID=838 RepID=L1NLK1_9BACT  ali  30  32..........................................SRDKPTEETTKPQERQDNDAVSVVGKSRFSMKEPVPTPATAVPNATTSDETEAVDIEDTIFADETDKKP--FRQVPADRLDETFTDIRIIDVAGENEDAEDGEPDMPAARGTSFEDIDRAVKSVRKPEANEAEKLHAGKTFKDIAETELFQKLTDSF--AGISDRVNEVIDLY------TARAAEVKPLVLPARIEDFDIRDF 228
29 2.000e-26UniRef50_A0A1I0QF40 Uncharacterized protein n=1 Tax=Chryseobacterium wanjuense TaxID=356305 RepID=A0A1I0QF40_9FLAO  ali  16  24.............................................RKRLNKKKDPEKPPVVELDIMGEIGAVSRQLVPKPTVQSHHEDTEPEVNNFSSEIDG--------EGVDIQIPQEEPDNVYDEVDLQEEEEEWSGYGIFEGENGFATGVTFEELSAVGMIIQQDVLEASDKDIAVRIVHKIQGTELFSLLENSMEGA--SKRMAELLDNRLSEGADSGSSNVRKS-----DLMDFNIGDF 209
30 3.000e-26UniRef50_A0A0P0EQA5 Conjugate transposon protein n=24 Tax=Bacteroides TaxID=816 RepID=A0A0P0EQA5_BACT4  ali  24  3............YLFIILFIYASYLSIEKYVHT--GSIFTWRGRKDKKERRTAPAAIHPAIAPSIIGKSRYQMRHSLTIDDNSGQPESGIEKSDTFTEKKTEPVLRVHEPLDKNTKFPEYPEIDYMQEPSPSSGEEKEEIPERYESNPHRATGVTFDDMDMIEKAMASDELTEAEQEQARQTFQKLEGTNMERVLQASVLGS--SDKLKRYMRLYVDRGEPHLLTGKNRD----DILREFDITEH 247
31 1.000e-25UniRef50_A7V7D0 Uncharacterized protein n=9 Tax=cellular organisms TaxID=131567 RepID=A7V7D0_BACUC  ali  28  3MESIFMIVLVAFNVWTIYF---------------------YNKLLLEVANNKEEEEKPPIDPMALVGKSLFKLSQLRKKEETEQKQT----ESMSVSDNDVTFDD----SPKSTARISDEQLDDVFTNVRIEDIGVKYSDNKE-DADMPQAKGSSFEDIDAAVNTVKAPKATDKEKRHAGKVFHEMDGNQFYEKFME--NSEECKKNIHDYVTFYLQTHKIVEISKPKKEFKVPDSIEDFNILDF 215
32 1.000e-25UniRef50_F0S6W7 Uncharacterized protein n=82 Tax=Bacteria TaxID=2 RepID=F0S6W7_PSESL  ali  17  24.............................................NKTVRREIKPEKKSSDLPDIIGLPKPVERHTLPPNATKRQSGERDGIADNFGTETYGIGVGLENP-----QIEGEPDEIFGSMSDFENEEDEWDVYGFEDSDNEFATGVTFDELTTVGAWLEQDTLEPALQKKAVDIVQRLQGTELLSLLENSMDGA--SRKIAELLDKSLSAGTDFSSPDLRKS-----DLEDFDIEEF 211
33 2.000e-25UniRef50_I9IPG3 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=I9IPG3_BACUN  ali  15  1METYFYFSVKTVCCGYLFYRLWIFLFRQRIYGLWEDMVKYLPKKKGKSAEPVTAPK---VDDNEVIGKTNIVYLEDPEIDCKVPARSEPLPPAEEMEEEEDISADDVESTFNPPGGLSEEEKAELMSD-------------YVSEVDEDFSTGMTYEDMMNAVGVLTEENMNDEKVIRTVKSIYDIRQTEIFDFFTTEVSNIEL---VESLFKECLDEYGEPLPQ--RKKEAPPESEEKFDWDKY 228
34 3.000e-25UniRef50_A0A1T4SYQ7 Uncharacterized protein n=1 Tax=Chitinophaga eiseniae TaxID=634771 RepID=A0A1T4SYQ7_9BACT  ali  22  22.........................................RVTTLKTGRQSEPAAYQQPPLPDIMGTAKVANRQ-------EPPNEAIQRQSEIPSRDTATFDTDPNEDYFVDV-VPQEELDEIFGEVDLDEEEAEWRLDVQPEGQDGLATGVTFEELSLLGSVLRQQSSSSAREEQVAGIAYRIQGTDLLALMVESIDNA--SERIAEMLDKHLA-----QETDSSSSIMRSYDSNAFDINNF 211
35 4.000e-25UniRef50_A0A1T3LZH6 Uncharacterized protein n=1 Tax=Elizabethkingia anophelis TaxID=1117645 RepID=A0A1T3LZH6_9FLAO  ali  16  1METIIVICL-----FFIIALLVDDKMN-----------------DKKKADHTAKEKNTNQDFPDIMGVSGSVIRNSLPNTTAESHKTETENTPDNFEVQYNKSVDANILQEGPQKAIS--------SIPDLYEEEKTLSRDAFFDDHHGLAQGVTFEELGTAEMLLKKEKLEPSQKETAVVIVQKIHGTELFDLLENSVEDA--SRKIAMLLDGHLPEVGSGPSVLQRKG------FKDFDVKDF 208
36 5.000e-25UniRef50_UPI0004B635E5 hypothetical protein n=1 Tax=Bacteroides sp. 14(A) TaxID=1163670 RepID=UPI0004B635E5  ali  30  30.....................................ERRQPFQESAPPEKEKPKPVEEVKDNGIVGKSNFKMPSKVPP---TVPDAATADEGEAVNEEDITFADETDGQ--IPEDLTQEELAEMFSDHRSGNVKDDDDWDEEDGQTEGYASGASFEDIDTAVRTAKKVKPTKEEKRQAGKVFTQIRNSELFDSITESME--SVGDRVVEMMDLFLKQPQRITENIAPKPFKLPDNIENFDIRDF 234
37 7.000e-25UniRef50_A0A1M4TYJ9 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1M4TYJ9_9BACT  ali  17  34..........................................RFRKENREAMLKDQDRKNNKGDIIGKSRFVLRERIP-----VPQAAKEPDNEKDNGKGNIFVP-SDVPKEHSRIIPANELDEVFGDVPPGEANPPLDIDCPMPSGRSLAEGISFEQMGEAYRVVHNPVITEEKKEETGRVLLHLKHTDMFEAMVSG--EPERENRVGGLIDSYLKAFHQRKAESGENKPSATSVPKGFDVRNY 247
38 1.000e-24UniRef50_A0A1M3L2J2 Uncharacterized protein n=1 Tax=Dysgonomonas sp. 37-18 TaxID=1895907 RepID=A0A1M3L2J2_9BACT  ali  21  1..................MILYPILVKKWKQFVDWLHLITYGKSEEEIAEKPKRITTEEDKIASILGKSKFNLRQ-------STPNTATDLKNENPIEKESTFVPPADEAEKFDIDVP---LDKVEYLSQEEFDAECEQEELEGEYDAVLASGASYEELAHTNRTIADKQASVTDKDEAGRVLYENKQTEMIEQVIA--NGAEISKTISTLIDVHLAMCARRL--QGDNEIVYPKDFKDFNID.. 212
39 1.000e-24UniRef50_A0A1Y4HNX6 Uncharacterized protein n=2 Tax=Bacteroidaceae TaxID=815 RepID=A0A1Y4HNX6_9BACT  ali  26  23......................................ERKEERTGDFSGKAGKEEQQQKPLADIMGKSLFRMPERTPQATTTAPNAATTVRSEAVDEKDVTFADELKDTGNHSRQVPDEDLDKVFEDNRA------YDTDEDFDEEPPQAGGSTFDEIDRAAKTVKDARAEETDVLQAGKVFHELEGTEFYNMF--RRNNARYEARVSGMVDAYLASIRPVQKRPRMKAAAQ-KEYENFNIRDY 226
40 1.000e-24UniRef50_F8X1U5 Uncharacterized protein n=1 Tax=Dysgonomonas mossii DSM 22836 TaxID=742767 RepID=F8X1U5_9BACT  ali  19  1MWKLIIAGIVLYYIVLI-----------------WKYRNSLFNSKKKENKTNPPEPERNANSRSIIGKSGFRLGQLKSS-------EAFERQISKPISNATNFDQLNNEDTPQPMDV---EFDMEYEDDVENEEPEEEEIICFMDEELQSAQGISFEEMAQAVQVVHTANVAEEEERKAVQTFSVMEQTNLYDTVIEQINGGRL--RVAEMLKKYDYVFIAPPAET------THEDLSTFDMNDY 210
41 2.000e-24UniRef50_A0A2G6UHI4 Uncharacterized protein n=1 Tax=Chryseobacterium sp. 52 TaxID=2035213 RepID=A0A2G6UHI4_9FLAO  ali  18  1METLIVICLLV----VIALLLQDKIII-------------------KKTEKDKPEKKINTKLPEIMGRAR-------PVRSHEVPNTAIEGQPVRYEKEADNFDLE-IERENFDLQIPQEEPEEVLESPDFEQEEEQWRREREPIGEDGFATGVTFEELSTVGMLFRQKIPEPSLEKETLAIVQKIQGTELFSLLENSMGDA--SRKIAMLLDRRLHS----TETDSGSSIMRKNTLDDFDINAF 209
42 5.000e-24UniRef50_UPI0006DC104F hypothetical protein n=1 Tax=Alistipes finegoldii TaxID=214856 RepID=UPI0006DC104F  ali  15  22.........................................RHDARPRFRRGTERETSRKRGKEIIGRSHVVMTHRSQSVPLPQTQTSTPSQEGKSVGNSDIFAPA--SVPEHPRQIPPEELDEVFGDVPEGEANEPLEIDYPAEEDENLARGVSFEDMGEVYRHVQSPIITTEQKEKAGRILLNLKQTDMFEAIVSGHPEGK--DKVKDLIDTYLSAFQRKVERSAESPSPQGAVPSDFDVRNY 245
43 7.000e-24UniRef50_K9DXI2 Uncharacterized protein n=36 Tax=root TaxID=1 RepID=K9DXI2_9BACE  ali  18  24..........................................RRMERNEPADGIVAEDTPCRQEIIGRSRFVLD-----PRHSRPQAAVESETEKVTEKADIFVP--TNVPEHPRQIPPEDLDEVFGVAPEGEPNEPLEIDFPLYDESSLAQGVSFEQMGEAYRVVHDPPSTDEQREETGRVLLGLKQTDMFEVIVSGRPDG--NDRVKSLIDTYLSAFHRRSERSAESPSPQGSVPTGFDVREF 245
44 3.000e-23UniRef50_A0A1T5G3V0 Uncharacterized protein n=4 Tax=Chryseobacterium TaxID=59732 RepID=A0A1T5G3V0_9FLAO  ali  18  24..............................................QKRSEKEITSENTKPPSSIMGLSQSVKSQTLPNNDGESHIEKQTHRNSNFEEE--------INDKKVDIQITQEELDDIFRSTDFEEEEEEWSQYQIFDNDNGLATGVTFEELNTVEAFLKDQNSELYQMETAANIIQKLNGTELFNLLENSIEGASI--KIAELLDLNLS-----FENNSNSSFYQNSNLARFDIEDF 208
45 3.000e-23UniRef50_A0A132GR57 Uncharacterized protein n=2 Tax=bacterium F083 TaxID=1768114 RepID=A0A132GR57_9BACT  ali  30  36...............................................KPEAVRDGNRQKAEPVSVIGKSKFRMSVTVDAGVTKRATEATKDDTAEEAEEDVTFAPENE--TRRPARLSPDEMQEAFEDIRIEDVTGDDDTTY-GEPSDDMASGATYEDIDLAVRVAKGKEATQEEKARAAVVLTELQGTQLYERLTDGKDDIRM--RIKLLIDLQMEGKAQPSAASKDREVSVPDNLDQFHIRDY 235
46 3.000e-23UniRef50_A0A0A2EBX4 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A0A2EBX4_9PORP  ali  16  19..........................................RFRKEANNSPSKSPGNRKNERAVVGKTTFRLRQVTPSEDTESQFS-------KGVDNASIFAPADTEDTPQPMDV---EFEMKYEDEVPEDELEAEEIALITGGEGQSARGISFEEMAQAVQVVREQEAPEEEERKALQTLSVMQQTSLYDTMMEQINGGMV--RVAEMLGKYDAVFIAPPNETS------PEDLQAFDMNDY 203
47 4.000e-23UniRef50_A0A1M4Z1N4 Uncharacterized protein n=1 Tax=Bacteroides faecichinchillae TaxID=871325 RepID=A0A1M4Z1N4_9BACE  ali  16  1MEAKIYFAVKVLSALFIFYHLWVFLFCRKIYGLWDKPTDKPKPIQTETHKKVEESPPVDDDPNEVMGKSNIIYYEDI-NAARTIPTHSLELKQVELPVDKDVNPDDVEDNFEPQKGLTEEDMQELM-------------EPEGIMPDPDFDTSMTYEEMNNMVDVLSSDTHSDENGLRAAQTFHKLPGTELLRLIENELAD---QQKIDRLLFDYLDEFGRPLPESKRRERK----IKDFNIKKY 262
48 5.000e-23UniRef50_G5SMY2 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=G5SMY2_9BACT  ali  25  27.........................................RQERQDEKPEKASRQMEAESDTNIVGKSLFKMSKGRTTGDTAVPQATVSVEGKAIEKDDITFADESEKQPS--MRLPDEELDTAFSDTRLSDVPVEYAGGEEEEAGEYA-SGATIEDMNEAIRTAGNTEATDSEKRKAGEVFHEMKGNELYETVTAKRP--AIVGKIRELIDLYENKPTISKGGNKKTIPVLSDNIDDFDIRDF 232
49 6.000e-23UniRef50_E1WRY7 Conserved protein found in conjugate transposon n=62 Tax=Bacteroidales TaxID=171549 RepID=E1WRY7_BACF6  ali  20  26..........................................SRTSPGRTDDAPLPRNGVSGYTLIGESRYKGGLIGTAQDKSGHLP-------QAAENDTIFAPQADGLTEETPGYENDEPDY---------EDEEIAGYMDGDDDTGRATGVSFDELGEAVRTANADNPTEAEKRQAAGTLAGIEGTNLYDAVVENINGG--LAKVAELLGRNEAELATAAVPAGTGD--TSEEHEAFDMNDF 208
50 1.000e-22UniRef50_A0A0T0M6C7 Uncharacterized protein n=1 Tax=Chryseobacterium sp. Leaf394 TaxID=1736361 RepID=A0A0T0M6C7_9FLAO  ali  18  1METVIIICLLI----VVFLLMQDKAANKKILDPSSPC------------------ENKKNKHPSVMGEPKRLI--------LNGDQSDSSEPEKKYSETALERLNVKGSKEERSVQIPNEDLDKVFSGPDLEEEEEEWKKYGFTVDSANLAQGVTFEEFNDAGRLLRSDPLRPTEKDAAVHLFSKIQGTELFNLLESSIEG--VSVKIAALLDNSFSEG------------DIKKDVTEFDINEF 202
51 3.000e-22UniRef50_A0A1C7H2G1 Uncharacterized protein n=29 Tax=Bacteroidales TaxID=171549 RepID=A0A1C7H2G1_9BACE  ali  16  1METKIHFTVKALCAAFIFYQLWIFIFSRQMYDAWEKVCRMMRIARIKQESHGTVMQPSPTDDNDVIGKTKIVYLEDPEVARKKPTRSEPLVKEPIEEDEEIRPEDVAHE----DRGLAKEEMEALM-------------APVNSEPDPEFNTAMTFEEMNNVVEVLTSETGDEQKDFRASMTIHKLSGTEILNLLENEI---GCQQKIESLLNEYLDETGRPLAKRK----AASKKVEAFNIDKF 257
52 5.000e-22UniRef50_T0NPP6 Uncharacterized protein n=7 Tax=Elizabethkingia TaxID=308865 RepID=T0NPP6_9FLAO  ali  19  25...............................................KKQNKNETEEKEPDFTQIIGQTRSVERSLQP-------NSAIDDHTMKPKINTDNFDFQYDEDKNIVSEIQQEESEENFSMTPDWDQEEEEFKEEAEFSNDGLAQGVTFEELGTAGMLLQKDKLELSQKQTAADIVQKIHGTELFDLIVNSVEDA--SQKVSEIL----YNIILTETKTDSSVLLPKNNYKDFDIQDF 210
53 1.000e-21UniRef50_A0A1Q6EMA0 Uncharacterized protein n=6 Tax=Alistipes TaxID=239759 RepID=A0A1Q6EMA0_9BACT  ali  12  10.TLVVLFLVLFCYLFLDKFLFRGELGEICFGPTCRALARWYRRQADRPRRRRRRTAAVTPKDDALVVTRDYGAGQRTPARAVSRH---SRRKGNNSDKSDHTFVPASDGDKEHPTALTAEEENTLTREAAIEEV---MDIGCETTAPPAGTQSFTPQQLDCILALCKGQAVPEEQRQTLAGVLRDIRHTEVQRTLMDAISGASPI--IARYLDDAEKEAAQRMAAAPK................. 245
54 1.000e-21UniRef50_A0A0E2AP74 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=A0A0E2AP74_BACFG  ali  22  31..........................................KRRRAARNAAAILPRNTVPATGILGKSNFVLPASVPLNTTLKPLEATKEESGKGTEKDDTFVAE---PEKHPLQVPDEELDELFNDAPPEDYEDEDEETAGCSEPGAMASGVSFEDMCAAVKVLAKETVSEQEEKEAGRTLTELQHTDMFEQLVA--NHPQRAERVTELINRHMENYRQEQETDENGYRADGDVPDDFSIAD. 244
55 2.000e-21UniRef50_A0A174U9K8 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=A0A174U9K8_BACUN  ali  15  1MVTILYFMVKTICVTIILYGLWDGVVRWLRVRSWKLHRKYLKKKKDARRKPETSETASPVSDDDVIGKTKIVYLED-PDIRKKVPVRSEPLEKIPVEEDREINADDVDDTLSGGK------------NGLSDEEKRELMVSADSEPDPDFNTALTYEDMNNMADVLVDNSTDETKIIRAVHTIHKLSGTQLLAFLENE---SGFQQKIDNLIDEYMDKVEGFTKQDAGEKADIS-----FDIRKY 260
56 2.000e-21UniRef50_A0A0M3CEA2 Conjugal transfer protein TraD n=2 Tax=Sphingobacterium TaxID=28453 RepID=A0A0M3CEA2_9SPHI  ali  18  5.......................................................................................ATKRQSGERDGIADNFGTETYGIGLGLENPQIEEPDEVFGSMDFENEEDEWDEYGFEDSDNEFATGVTFDELTTVGAWLEQEVPEPALQQKAVDIVQRLQGTELFGLLENSMEGA--SRKIAELLDKSLSAGTDFSSPDLRKS-----DLEDFDIGEF 157
57 3.000e-21UniRef50_A0A0B0BNA3 Uncharacterized protein n=1 Tax=Alistipes inops TaxID=1501391 RepID=A0A0B0BNA3_9BACT  ali  11  14.....IFCLLFCYLFLDRFLFARRLDALLFGRPLRRLAELLERWARKTGVPADVPQAKDPPEDDLVPR-GGSLRHIAPKSANARQKSSGRLPEMFTDPVRIAFYDDYLRSTLQGQKPSAEQPDD---GQTPSDTEAPHDAVMESASPHDCGQGIGPRELEWIIRLCNGQQVAAEHRAALVRAVRSVQDTQIYTSLLESISGSD--DRIARFLDQAEAADTSAEE..................... 253
58 3.000e-21UniRef50_A0A2N2VUF8 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2VUF8_9BACT  ali  13  2ITQIALTVIALYCLFTIYYIYKEDIKRI-------------LGQKISTKEDEVKQPKEWLDESGIIGSTKPFLRQKETSADNLTANFQDVRKEDTFTCETKKRFPAVVSREEMEEIFSKQENEETEYPGDQNDEAGFDEDEELMDLTGGIASGLTYEEIIETAATIGKINPSVEEKERAVDVINRAGKTDMFEQVVSTIPESD--NRIKKMLEECDEKIKNRQLTLRNSKSATKEITIDFDLGKY 237
59 4.000e-21UniRef50_A0A1N7HSX4 Uncharacterized protein n=1 Tax=Chryseobacterium joostei TaxID=112234 RepID=A0A1N7HSX4_9FLAO  ali  15  19..........................................QKKLSRRKDKEEKKHTQLNLPSIIGDTK-------KEERQSVPLYADQRQSENNKMGVPIFEPETNSQGLDNNNRKKNLDEILVRSEAWEEEEEDWLDEMEIEVESGFATGVTFQELNAASQFFQHDVLDPDIENEAAYIIQKIQGTELFNLLEKSLGEA--SRRVDNLLSKNYQNDGTPISSDPHKG------FDGFDIGEF 206
60 5.000e-21UniRef50_D6CZF9 Uncharacterized protein n=19 Tax=Bacteroidales TaxID=171549 RepID=D6CZF9_9BACE  ali  20  3............YAFILLFLYASYLSIEKYVHTGSILRDGQRPASALPVKEEPAEPREETSEEAVIGRSRYRLWQSPPMDG------------------EYAMSEKRTDTAMKGRKAPVPEFPAPFGRPEEGEVPERYEITGYVEPDPHRARGVTFDDMDLLSRFMATDRLSEPEQSHARQTLERLEGTDMERILQAGILGSD--ETLKRYMELYVDSDREPPLLAGKDRESI---IRDFDIMDF 215
61 6.000e-21UniRef50_R9HQW3 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=R9HQW3_BACUN  ali  16  2MTKIYLTVNIICAVYILYRLLWDRLWRWHKIRMVAKAERRKRRTVRNQKKKKEVAAVAPSTYCEVIGKTKSVYIPDPKKAKEPVRSEPLP---------ESDFIGEDDDISADDVDDILEPMDE--------EDLQELMEPGLSEADPDFSQSMTYDDINNMVAVASGANKDETDTIRAVETLYSIRQSDIYEFILSESDN---KDRIERLMNERFDEKAAPNKHSERLETQTS----GFDWSQY 244
62 1.000e-20UniRef50_A0A0N0LJL8 Uncharacterized protein n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A0N0LJL8_9FLAO  ali  15  1METIIFLCLLI----VIALLLHDKIF--------------------KKNSKQKMPKEKLNLDTHMLGHPKSVISLSKEKNFIETQ-----------IHKPTINSDSTNVESDQNNIQNINEKQENTSNTQLDFNAEEEEFKKQSRSDHSLAQGITGEEFNAAKILLQKDKVYLPEQETSTALLQKIHGTELFNLLESSIEGA--SQKIAELLDNSFPPEADIHT-----SLFLKDDLNNFDIEEF 205
63 1.000e-20UniRef50_A0A060RAS3 Conjugative transposon protein TraD n=2 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060RAS3_9BACT  ali  15  26............................................RSNRKKSRVKEVIAPSKSGDIMGASKAANRQITPNTAKQSHAENTAKESVTFVAEAEKRYSAVIKKEELDAVFSDNQMDDVDADYSADDDTQMDDIPCYEGGAESMGNGVDFPEMDNLAKVIAQKEQRKQLITKAAETVRKIENTGLYDAVIAGYENG--LQKVAAMLAKYEANQPANVPMGKM------DSYEEFELNNF 219
64 2.000e-20UniRef50_UPI0009328C18 hypothetical protein n=1 Tax=Bacteroidaceae TaxID=815 RepID=UPI0009328C18  ali  30  25......................................DIWLRSKLRIEKTNVAPKESPPIPAD-----DFIVRHTYTVSPKKVPSEPVQIKGETIRENEVTFED--DQSLVKSARIPDNKLDEVFTDTRIEDVDVKYDESEE-EPVVEQASGNSFEEIDKAVETASKPNATNEECAHAGKVFIEMEGNELFNMIAER--SKQIKRRMNALMELHMSSVSTIKPTSEKATKVVPEDFKDFNIRDF 232
65 5.000e-20UniRef50_A0A212KFA9 Uncharacterized protein n=1 Tax=uncultured Dysgonomonas sp. TaxID=206096 RepID=A0A212KFA9_9BACT  ali  18  29...........................KWKQFVDWLYVTTYGKAKNEEVKTEKKTTDEEDEIDSILGKSKFNLRQ-------STPNTATNLKNENPIEKESTFVPPVESEPEKFDE--DVPLEKVESLSEEEFDSETEREDLESEHDAVVASGASFEELAHTNRTIADKQASETDKDEAGRVLYENQQTEMIGQVIAS--GAETSRTISTLIDTHLAMRAQRQQGQEDNETAYPNDFKDFDID.. 239
66 7.000e-20UniRef50_K1VAU3 TraD (Fragment) n=2 Tax=human gut metagenome TaxID=408170 RepID=K1VAU3_9ZZZZ  ali  30  3METIFLIVLAAFNVWTIYF---------------------YNKLLLEVANDKEKEKKPPIDPMALVGKSLFKVSQLRKKEETEQKQT----ESMSVSDNDVTFDD----SPKSTARISDEQLDDVFTNVRIEDIGVKY-SDNKKDSDVPQAKGSSFEDIDAAVNTIKAPKATDKEKRHAGKVFHEMDGNQFYEKFMEN............................................... 170
67 1.000e-19UniRef50_A0A0G3LWJ6 Uncharacterized protein n=1 Tax=Chryseobacterium gallinarum TaxID=1324352 RepID=A0A0G3LWJ6_9FLAO  ali  17  39.........................................................KPERLPDIMGKP------------VLVQKERPLYPKKYPKMMADRLKKRDTAVEARPVSTTEAGEDGVSGSMDWSDDEINNESQPE---DGHFTQGVSLEELMRVGDLLKQDHLNEVQENQTAEIIQKIRGTELFDAMQSSIQGA--SQKIARLLDKSLSENQLGDVQVKYKG------PEQFDIGDF 203
68 1.000e-19UniRef50_F8X3M0 Uncharacterized protein n=20 Tax=Bacteroidales TaxID=171549 RepID=F8X3M0_9BACT  ali  20  1MKQYIISAIILYALFVVLYLLRERIQ----------------KRKRDAAKKSVFNPFRSAPKEDIIGKSKFDIRQSRT-------EATTLINNKKETENASIFV--EKEEKKTSAAIPLDKLDEVFTDNRMEENSDEIDADTEGRAGVSMALGLDFNNLASMVRTVETDNATSKEKEEAGRVLVEIRKTDMFEQVVSGEPKKEVV--VSSLMDDYFAAFHRKQQEAGVLHEPTVKAPKEFDVRKF 247
69 2.000e-19UniRef50_A0A2T5RLH0 Uncharacterized protein n=1 Tax=Elizabethkingia sp. YR191 TaxID=2135666 RepID=A0A2T5RLH0_9FLAO  ali  18  2.................................................................................................DNADNFDFQYDENKNIVSEIQQEESEENFSMTPDWDQEEEEFKEEAEFSNDGLAQGVTFEELGTAGMLLQKDKLELSQKQTAADIVQKIHGTTLFDLLINSVEDA--SRKVSELL----YNISLTETKTDSSVLLLKNNYKDFDIQDF 144
70 2.000e-19UniRef50_A0A1N7PYM4 Uncharacterized protein n=5 Tax=Chryseobacterium TaxID=59732 RepID=A0A1N7PYM4_9FLAO  ali  16  24..........................................KVKIVKSVETPEPKAVSSQLPDVMGKTHKDADHSLREERISGR---PLIKPKNNEFDQPNKVLENPLKPQLESELPIDTIED-----------EEWLEDEFPPYDERFSQGVSLEELLTVGKLLQQNDLGSEQQNKVIDVMQKIQGTDLYNVLENTIEGA--SQRVAILLDKTLDSKNLNDLAPSEG------NLDDFDIGNF 204
71 2.000e-19UniRef50_A0A1M5JR27 Uncharacterized protein n=5 Tax=Dysgonomonas macrotermitis TaxID=1346286 RepID=A0A1M5JR27_9BACT  ali  22  42.............................................EKEISKKSKPEPEPSKIPSVIGESKTKLGHDRT-------NATTNPKNDGVIEKESTFAPETKEETNQIADV-DVPLAKVETLPEEEFDPDEEAVELEAERGAVLASGAGYDELMATGNVIANKHPSDEEKDEAGRVLYENEATEMVEQIVSQ--DEKTFAKVNDLISFHMKKHNLT---GEDSNMPDPEEFENFDIN.. 226
72 3.000e-19UniRef50_UPI00082CD3FE DUF4122 domain-containing protein n=1 Tax=Porphyromonadaceae bacterium H1 TaxID=1658779 RepID=UPI00082CD3FE  ali  16  1.........................MAIWIIIVCLAALFLLLFRKKKPKEVIAPSKTKLHFEGDVMGKTTVVLRQLQTNEDTRGQ-------VLKPNENPDNFADDENEVENEPMEISV-PLEYEAGNPDDDFDEEAEELHQAIGGEANLASGASFEDLEHSYDVIRERKTSEEDERKAAETIRSEGGTDIFKQMVAQVPQG--VERVTSIMDKYLS------PQAVQVEPSTDKDYSDFDV... 202
73 3.000e-19UniRef50_W4V0W3 Conjugative transposon protein TraD n=1 Tax=Bacteroides reticulotermitis JCM 10512 TaxID=1445607 RepID=W4V0W3_9BACE  ali  17  1...........................................................................MLPLSGQSQPEATVTPETELDTKKENIFAPA--SVPEHPRQIAPEELDDVFGAVPEGETNEPLDINYPLQVKPPVAQGVSFEQMGEAYRVVHNPTITEEQQEETGRVLLNLKGTDMFEAIVSGQPG--RGDKVDILINTYLTAFQKKVERSAESLTPQSEVPAGFNIRMY 191
74 6.000e-19UniRef50_F8WY45 Uncharacterized protein n=2 Tax=Dysgonomonas TaxID=156973 RepID=F8WY45_9BACT  ali  16  26.................................LYHIFHLGKKQMEKEKTKASDKPITSGKEASIVGKSTFTLSQPVPTTTTPVAKEPV------IETDAHTFATESD---PAPMDIDYSFDREPDNEDNLNEDEEAIELKEIFGKDVCYASGVEIDELQKIKHVIESSKVTQGERQEAGRILYENKETEIVEQL----SSGKTANIISGLIDLHITLHQQ--EHGKPKEIKESEELESFDVNKF 222
75 8.000e-19UniRef50_A0A0W8EPW8 Uncharacterized protein n=28 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0W8EPW8_ELIMR  ali  16  27..................................................REKDNLTKSTNLPSIMGDSKPRERHSLPIDTNDGQNNVPFAEENNFESDTTEEEFENVDTAKNLGEI----------SVKNEDWQEDEDWKYQSNVESGFATGVTFQELSTAGQLLQEEKLEHDLEQQAVEIIQKIQGTELFDLLESSLGDA--SKRIASLLKESISNEDEIISSKRSNSSES------FDIGEF 204
76 9.000e-19UniRef50_UPI0004ACBE6D hypothetical protein n=1 Tax=Bacteroides neonati TaxID=1347393 RepID=UPI0004ACBE6D  ali  13  1MWEILIVACLSYGIWLVGDAVYRRLRPKKKTLPKKPKRHL--------------------SGEQLLGKCRYEVGQKQT-------NVSTYPKAEQAMDKEHIFAPDKKNESPEPLHY--EESNEEFSGLEIPEEAEEIIPAADGKVELAVGDGVNWEAWAEALSVISRTDATPDQIAKAGELLHQSEGNDIVDKLRSE---PQRSQRVDELICSYFERRSKARITEENPFAETTGVAGDFDIRNY 232
77 1.000e-18UniRef50_B3CC86 Uncharacterized protein n=7 Tax=Bacteroidales TaxID=171549 RepID=B3CC86_9BACE  ali  21  22.........................................RRVAVNNRTAPQPERKKRENTASLVGESHFRSGLMRTNGDILGHFP-------QAVENDTTFAPDAGGENE------ETDFEMTFEAAEEPDYEDEEIAGYMADDETGQATGVEFEKLVEAVRTVNTPNPAEADKQQAAETLGQITGTNLYDAVVANINGE--LEKVAELLKRNEAA---AIPTTDTQTAGTNEEYRKFDMNEF 207
78 1.000e-18UniRef50_UPI0005A6AE15 hypothetical protein n=1 Tax=Bacteroides neonati TaxID=1347393 RepID=UPI0005A6AE15  ali  14  29.............................................KKEVGQVREQPIRKPKKGSIMGATRTVISQTEPTEAKQSHDEPSANQV-------TIFAPQTES--NHPAKVEQEEFDTVFSNTPM-DIEVQAEYPQETGEAPPTAQGLDFDEMSNLIKVMRQKEDTPQELKMAVTTIDKVRDTELFNKMVSSIGGEGLA-RIEAMFAKNESQPKEPPATGG---------FDDFDFKSF 221
79 1.000e-18UniRef50_F8X3Z1 Uncharacterized protein n=6 Tax=Dysgonomonas TaxID=156973 RepID=F8X3Z1_9BACT  ali  16  1MIELLIILCL---VGIILIKLSDYKITIKKNSSDYKSEIAKSQKREKRVGR--------------VGKSMPDIRQMMTLNDSS-------LESDNPQKKASIFDSSKDESEPD----PKDLVIDADPTETVIDHEEEDEIAAYTKGEVYTAGGMDYEVMMNTVKVINSKTATKEEEQKAGQVLYDNRDTVLVDKMVSAK--KELSVRITSLIGLRLQQHAEENPQNVESHLNESDEYKNFKADDY 219
80 1.000e-18UniRef50_A0A0B4CJK9 Uncharacterized protein n=3 Tax=Chryseobacterium TaxID=59732 RepID=A0A0B4CJK9_9FLAO  ali  18  24.............................................KPASTPSKENKRAPYNTHNIMGETK-------TIPSHELPTSLIEKQKKELEIDPSTLDIEYDVNENSYVQNLKEEPEKNLSESDFIEEEEEWKKYRIIDKDNGFAQGVTFEELSTTKIILQQEVCDTSEKETAVAIVQKIYGTDLYTLIENSIENA--SHKIAELLEKSFDDEYENST-----PFLRNDNIREFDIEKF 210
81 2.000e-18UniRef50_A0A2E4PDA3 Uncharacterized protein n=1 Tax=Flavobacterium sp. TaxID=239 RepID=A0A2E4PDA3_FLASP  ali  19  41..............................................................PDIVGRPKVGGRPALPTQ-------AIEAENDSSATVAPNFDTVNKWETTLP--IPQEEPDE-ESLPDWDDEEEEMKGYAANAVDEGLATGVTYDELATVGQLLQRKALKASEKKRTVSVASKIDGTELMLMLETAVGDA--SKRIAMLLDQADDH-----ESDSGSSSLRNNNESNFDIGDY 209
82 2.000e-18UniRef50_A0A1B1S991 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A1B1S991_9BACT  ali  18  1MTVFVVLALLASNIFLAKMLLSKDKEKADSPSTDAASDNTPDPPKNNNEGVSDASVENPEKIASVVGESKYDPDTYKQIVKEIVKEVVPLIIEEYGNFADAGFP--ELEDKKSSIVVPNDKLDEVFSNTTVAELTGE-----APEPTEPCADGLDFNDMTTTMNVLKETSNNPEDMEVAQETLRKLDGTVIKEKLS---LDPAIQKKIL-LIELHLPKQTKEETEDTIPEHDQNDS......... 227
83 7.000e-18UniRef50_A0A1M5IEG4 Uncharacterized protein n=1 Tax=Chryseobacterium arachidis TaxID=1416778 RepID=A0A1M5IEG4_9FLAO  ali  16  24...................................................................KVKIVRRAKPTDSENRSQITPDIMGQVSADFKENSFADRASSTTIFEKMIARDTLDPPENIDLIIDLDEESEEDFDHVPDDDFSQGVSLEELSKVGQLLQNSNLDELQEKETVEIIQKMQGTEMFDSMQASIEGA--SQRIAKLLDKSLANDND------YRNTSHSKDIDNFDIGNF 202
84 7.000e-18UniRef50_R5FN81 Uncharacterized protein n=1 Tax=Eggerthella sp. CAG:1427 TaxID=1262874 RepID=R5FN81_9ACTN  ali  24  1..................................................................................................................MRVPADKLEDAFSDTRLSDVPVEYE-DGDDEPTGEYASGATIEEMNEAIRTADNPKATDTEKRKAGEVFHEMAGNELYEILTAKMPG--IISKIRGLIDLYESKPTVSSGGNKSRNIPAVEGLDDFDIRDF 134
85 8.000e-18UniRef50_K1RWF5 Uncharacterized protein n=1 Tax=human gut metagenome TaxID=408170 RepID=K1RWF5_9ZZZZ  ali  19  28.............................................TSAVEESRVEDSPPLSRRSIVGKSLYVL----PSRRQPTPTTATRSETEKWEEKADIFAPE--KQTEHPRQIPPEKLDAVFGTPPADESNEPDEEDEENESQPPLAKGVQFEQIGEAYRTVAHETPGEKKKQRVGRTLVELEQTDMFEAIVSASPEGA--DKVYDLMNFYLKAYYRRAERAAESPPPQVSAPEDFDVQNY 249
86 1.000e-17UniRef50_F3PYU2 Uncharacterized protein n=20 Tax=root TaxID=1 RepID=F3PYU2_9BACE  ali  14  1MEELIYLCVRIVC--IVYLLYSVYCWRTRIETVCTLLYGKPPV---KKEKPEASGTGAVASEDEVMGSTRYVY-----LDENAGKTAAPFMSQ--PLEKNFIGEEENVEQEEVECNLALEKM-----KLLLQEQEELDAGNPDVESVSPVLSSRDMETLGE--YLARKGEVGEEKALQAARIVFSIQQSNLIDIFTSNAENAKM---VDELLDRYLDEDGNPKPLPPKENENPADGWR....... 216
87 2.000e-17UniRef50_A0A2S1R123 Conjugal transfer protein TraD n=1 Tax=Flavobacterium sp. HYN0059 TaxID=2175091 RepID=A0A2S1R123_9FLAO  ali  18  27................................................ARNAKGDEGEAPELPDIMGKTKSQ-RHAAQMDDTPGQPGKGDREADNFTSEQYGNPVEGESLQEGPERARGTIPD-------LEEEEEELMAYGLQGSAGGFATGVTFEELSAAGMAIAGQGP-AASFTEAEATVRKIDGTDLLTLLENALGDS--SRKLAILLDRSPGPDPGP-------HILRNDDDGDFRIGDF 205
88 3.000e-17UniRef50_A0A1Y4F9S8 Uncharacterized protein n=71 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y4F9S8_9BACE  ali  11  1MEEVIYLSVRTACAAYILYKVWQTKSQVK-----RICDTLYAVSSSAQAEEKETPASGPPPEADVMGGTQSVYLDENT-GETGAPFLSLPLEKDFIGEETETPDEDVECTLDLERMRLLQ--------------EEQEELDAMNIPTEAVSQPVTQADLVNMADVLNRARENEEQSSRAALTLHAIRETEMFAVIEAQVENKEV---IEELMERYLDEEGNPKPVRHGTPPK............. 212
89 3.000e-17UniRef50_A0A2V1IWC2 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IWC2_9BACT  ali  18  1MEVLLIVALLASNIYLIG-------------KVLKKPAEKHPPAPATNSEETPSPALSGSDDDSLVGRSHYDMDKVNSRVDEKVDEIVTRIRTELTSPEDVGLPPEEPAQPEPEKTIPQERLDEVFTHHTVGE-----SFGDAPEITERQTGGQDFKALESAVRVAKDEPHTPEEAAAAKETLKEIQGTVIEERLS---LDPKVRTRILSIIYGDEDEP-LTKEVIAKKKVVYSKTIDTVDID.. 229
90 5.000e-17UniRef50_A0A1M6MQV1 Uncharacterized protein n=1 Tax=Tangfeifania diversioriginum TaxID=1168035 RepID=A0A1M6MQV1_9BACT  ali  20  4MVDIAGIVIVAFCIFSAGYFLLN---------------------GTKGVKTQETEAETPENNESIVGISKTRLGQY---VDGSIQRSVNKRRVIPPEDIEQVFYTREEALLNIDVDI------EPLYQPNEEENEGDELPFDDTELVPVLATGASFDDLSEMSEAIQSHELSQAHIVKAAKIIRTVNETDLLKQLISQVEGGE--QKVASILDRCEAEL-----KTSARQESETDDAEGFDLGKY 213
91 5.000e-17UniRef50_R5AZ73 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:927 TaxID=1262753 RepID=R5AZ73_9BACE  ali  21  1METLLIIALLASNVWLI----------RKVLKKPETPPAGKEVADTVENSAPPDPDRAAEAPTEVIGKSNFDVGQFMEAATEAAKEVVPLIIKEIGTPADAGFPD--IPEEKPTAQIPVDKLDEIFSTHSVSELTGETPPPADAN-----AEGIDFDELQSTMKVLKDKPHTDEDEKIARRVLPELEGTEIIEYV---KLDPVVRKRILMIECQLPDTTEENDNPPGKSDDAAPKKKIVFDID.. 233
92 5.000e-17UniRef50_A0A2V3PJF0 Uncharacterized protein n=2 Tax=Dysgonomonas alginatilytica TaxID=1605892 RepID=A0A2V3PJF0_9BACT  ali  9MATFIFKAVLIACLYMAGLNLWLLFKDWFKERYARKGDAM---KQDKRVGRVGESKGDERNIPSFVGKSKWXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILSIPLEAIPKEQDAEHQNSYDQPVSSEEEIILDTTYDK---SDVELSGNQSFTMDEFEMVAKSLKGNPVSKDEEKQVAEIIPRIKGTDMFRQFIGQVNGAE.......................................... 208
93 6.000e-17UniRef50_UPI000D3DFD78 hypothetical protein n=1 Tax=Sphingobacterium sp. M46 TaxID=2152717 RepID=UPI000D3DFD78  ali  14  24.......................................KVKIVRAEKSQKTLSPDRLPEAIPDIMGKPISSANDHVPKQLINSKKMMLRM----AGANARNIVPASIKEDYKDAMITENFGEEYV-----------DEDHEGLTDDERFEQGVSLQELMKAGKLLQQEVVNEIQEKEAVEIMRKIQGTELYGLLENSIGDA--SKRIATLLDRDLN-------INESADYDPQDNFDKFDIENF 205
94 1.000e-16UniRef50_UPI0008380E93 hypothetical protein n=1 Tax=Culturomica massiliensis TaxID=1841857 RepID=UPI0008380E93  ali  19  25........................................WRSMLGCRGKPPDKSPNVPSETADVVGKSTFVY----QPPPPEPPFVEEKEKYSAIDQESLDEAAAEADQEEIEGAIPK-----------LSEEEMYYRYPPDQEDYSSFAAGVAFDDLPKVKTVLTTDDNTEEEERETAIIIDLNRNNSLIQGIISNIPEGE--KRVDRILHKHLNPFYQTETDENNGGNGISEEIKNFNINNY 216
95 2.000e-16UniRef50_UPI0004A765FF hypothetical protein n=1 Tax=Prevotella sp. 10(H) TaxID=1158294 RepID=UPI0004A765FF  ali  13  22.....IVVLAIKYLSYLINSFNRILRKSQRPLFALSIREQRKILKREPLKKEDNLPEQLNSAHPVVGNTKTVLIFRLPELNEAVPFETVEVPLEEPQEPVEMPFPESDEFEEERETLPSEELRK--------EMEEALFDGYENDLPDDDTSGISVQEMEQAYKVLHNKIPAESNSDIVANVLYTLNGTDMFKMFINTEESDIMAKSI---MDGYIKKYKVDITKVDTKEFNMDMYLE....... 244
96 4.000e-16UniRef50_I4A2J0 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=I4A2J0_ORNRL  ali  22  25.........................................PKNKTSNPRSGIPPKPKKEQPYTVVGKSKFV--------ASKVDEPAQETTEPSSSNEEPTMAQPEPKKTSIPAQIPDEDLEAIFSKELNEDEEEELRALRTPEEDDDFATGLSFEELAQVEPLLTKKELDKEEERQATSIAKKLSDTELLNQIEKVLPQAK--KRVSELLDRNLKSPPTKSK-------------EDFDIGDF 205
97 4.000e-16UniRef50_A0A174L9L1 Uncharacterized protein n=1 Tax=Bacteroides uniformis TaxID=820 RepID=A0A174L9L1_BACUN  ali  14  4......................KAKDTKRKVRLNKGATAKPKMEPKNRSEDEVKLSLMKENSNEVIGKSMFVYIEDQGIARNAPAHSESLPPSDFIGEEEDIHPDEVETNLM---------PEKIGRNVLSEAEIQELMAPAESEPGPDFSTALTFEQLGNVAEVLMSGSGNERKNGWAAEILYQVKDTDLYNFFANEV---STKEEIERLFRECLEEKGQPLPARKRIQNKIVNEP........ 210
98 4.000e-16UniRef50_D7W0U1 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=D7W0U1_9FLAO  ali  12  29...............................................KPQRKIFRKVEQIAEPDVIGKVTI---------PEKAKTPAWLANRKKLIEQMLTNKADQGNEDPTRNDLEKE-------DVSSSNIEEPDETDNIPEDDDRFGQAVSLNELTKVGDLLKQDNLDAAQEKETSDILHKMEGTEFLAMMQQSIDGA--SQKIARLLDKSLSEKHNVIPKEN-----QNNALDNFNIGDF 203
99 4.000e-16UniRef50_A0A0F5J650 Uncharacterized protein (Fragment) n=1 Tax=Parabacteroides gordonii MS-1 TaxID=1203610 RepID=A0A0F5J650_9BACT  ali  21  11..............................................................................................QAAENDTIFAPQADGLPEETPGYENDEPDY---------EDEEIAGYMDGDDDTGRATGVSFDELGEAVRTANADNPTEAEQRQAAGTLASIEGTNLYDAVVENINGG--LAKVAELLGRN--EAELAAAAVPAEAGNKSKEHEAFDMNDF 148
100 7.000e-16UniRef50_A0A180FQN3 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A180FQN3_9BACT  ali  18  4........................LAVTAIIIALYLMYRMAFPKQPETKEDNDYPPEKEPDTDDVVGKSHFVLG----NQRQPKPTPAKPEKSENQAEKPDTFASENK---KSDAVIPSEELDEVFSEPDIDTEEEAEELRQTLGKDAEVASGFTYEEMEQAVDAVNH--SSEETEAEVGRVLSGLEKTDMFEQLVSG--DVGREARIKSAIDRHVQSILPEETLEENN----NKEYGDFNIADF 227
101 1.000e-15UniRef50_A0A0E2B1S6 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A0E2B1S6_BACFG  ali  17  93...................LEAQAIVEELAKRFEDTSQDEPLQLLVEEKPKPKIKPVVFDDPNEVMGKSNIIYYED-PEVARKTPTRSIELKQVELPVDEDVNPEDVEDNFVPQKRLSQEDMKELMSSESI--------------PDPDFSGACTFEELGNVADVLLNRTTDKKKIMDAAETLYKLQDSDIYHFYTTSISTEKQVDRLLR................................... 268
102 3.000e-15UniRef50_A0A2W5TYE3 Conjugal transfer protein TraD n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5TYE3_FLAPS  ali  17  27................................................VNQQDEQIKVNPDLPDIMGQPR-------ETKDFSTRKIAMKDVAETDTKTTPSLAADRENPDKK-----KEIDNPAITENNDINLEVEEESWGAPGSDDGFATGVTFDELATVEKLLTQQTIKDSEKATVSAIASKIDGTELVGLLESRIND--FSKRIAMLLDNGFDPMDGKGPTKRRNSDEGNFDIENF..... 206
103 4.000e-15UniRef50_A0A1V5HFM9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.BinA174 TaxID=1852817 RepID=A0A1V5HFM9_9BACT  ali  21  38.........................................KGKRKSYGNDIERTSRQQPKTVDIMGTSG-------QSERQSQPNNATERQKENREEKPITFAREIPSEELDQIFGTKEDVVDTQEDPDPNEDAVDWQEEENDDNNNDFASGVSFEELHKVTLLIQKDELHAEEQKTVTAAALKLVHTDLWEKMMEALPDA--NEKIAKMLDTSSTKVNTV------------EDWQSFDIRNF 229
104 5.000e-15UniRef50_A0A069S2L7 Uncharacterized protein n=34 Tax=Bacteroidales TaxID=171549 RepID=A0A069S2L7_9BACT  ali  24  27...........................................RKKRAEKAEQILTRMAVDVSDILGKSTFSLSH-------STPQIPGKNENEKPVNEADTFASE---KEKYPKIVSAEELDKLFGDSMPEELELMEDMDVPLEGCTPQATGIRFEDMGLAVRVVSGEAASEEERLQAGKTLAELRNTPMFDQLISG--DAEREERIGSLIELHLTAYRRRSPDSESATETIPDTFSLSDI... 239
105 6.000e-15UniRef50_A0A2V1IP73 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IP73_9BACT  ali  24  1MELLCIIALLASNLWLI-------------RRHLRKPDSTSAGHPPKNEQPEPDAQAKEIYYPSIIGESRSIIEKRVKEEVDSQVSTKVKEEVERVIMEKTRHEDVEIEPDKDPVQVPLNKLDETFTHKTISEAEGE-----DPEVAAPMENGDDFKAIESAVRCAKDEPHTEEEAAAAKTTLAGLQGTQIEERIS---LNPAVRTRILTILFGDEDS-SSTSENLKTKKTVFSRTVDTRDIDE. 230
106 7.000e-15UniRef50_A0A0J7IEI1 Uncharacterized protein n=5 Tax=Chryseobacterium TaxID=59732 RepID=A0A0J7IEI1_9FLAO  ali  15  33........................................................APKKDQKDIMGKSNYDGRLTAPSVSTESQINERKDKENNFEMKTEGKGLEHPVPDGNSDENSEEQIDYEEEEEEFKNMGLPNDV-------RGYAKGVSFQELNDAGQVLRNNDPEPVSVKKAVAVVRKIEGTDLFYLLENAMEGS--SRKIADLLNKNLPNEEEPKT---------SENSDDFNIGDF 203
107 2.000e-14UniRef50_A0A250FB01 Uncharacterized protein n=1 Tax=Capnocytophaga leadbetteri TaxID=327575 RepID=A0A250FB01_9FLAO  ali  16  6.........................................EKPRLPKTEKALKAPQKPEENYSVMGASTYVPKTPQPVKAEAQVKEQEPSPQE-----------EANNEANYPLEIPVEELDAIFPSIDFEDEEEELHGLRSPEEDEDFATGLTFEELGQFVPLLSNSNTSEVITPDTLVIAKKVENTNLLEALDRALP------KISALLEKYLPKPAD-------------DVEEVFDIGEF 180
108 2.000e-14UniRef50_A0A1Q4G546 Conjugal transfer protein TraD (Fragment) n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1Q4G546_9SPHI  ali  18  24.............................................HKRSEQKSKQEKVNPNLPDIMGQPK-------PVRSLSVPNTANDSQIQEPEINPDNLDIEYDENEDVNIQIPQEELDEVFSNPDLEEEEEEWNRYGISGGDDSLAQGVTYDELSSVGALLQKENLEQAQKETAV................................................................. 152
109 2.000e-14UniRef50_K5ZG78 Uncharacterized protein n=26 Tax=Bacteroidales TaxID=171549 RepID=K5ZG78_9BACT  ali  15  3.TTLIYFSVKVLSATYILYKVWMFIFSPKVYNFWDSQLRLWKSRKKRHEEKTETQPNPLDEYNEVIGKTKIVYLED-PDVARKTPTRSEPMKKEPIEEDEDIDPDDVIDGFSSQKGLTESEKRELMSN-------------DGCVPDPDFSRALTFEELNNVADVLISGTDDRKKIRNAAETLYQLQDTDLFRFFATELSTQSQLEK---LLKENMPNGKETPKQS................... 250
110 2.000e-14UniRef50_A0A1F3LQU2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_42_66 TaxID=1797351 RepID=A0A1F3LQU2_9BACT  ali  14  22...........................................RKSGKTSVERKSTLNNRAPEEIVGKSTFVLTAGKSS------------------------VSETDSSGKMDIEVPLE------YEPDISSVEEQEELEQLGLPTESFSD-LTFEDMMEVVNEVGS--MSPQNPAKTGKLLHENNNTDWVEQM--AFSSPAYQKRIVELIDLHLGKLGQN-----GNNQVPSNDMEGFDIGDY 183
111 3.000e-14UniRef50_A0A2X2JLA8 Uncharacterized protein n=2 Tax=Sphingobacterium multivorum TaxID=28454 RepID=A0A2X2JLA8_SPHMU  ali  10..............................................................................................................EQMLAKKADQENNDSTGNEREEENEEPDDIDNIPADDDRFGQAVSLNELTKVGNLLQQENLDAAQEKETSDIIQKIEGTEFLAMMQQSIDGA--SQKIARLLDKSLSEKHNVIPKEN-----QNNALDNFDIGDF 143
112 7.000e-14UniRef50_K9DZD4 Uncharacterized protein n=7 Tax=Bacteroides TaxID=816 RepID=K9DZD4_9BACE  ali  18  19.............................WKYYRTDIAGLLRKTDAEERTDEPDEEEKPGEPYTVIGKSTYRSGQTYEPKDKQGHTENQADKTDNFAPGTPESTPETNGTEQAEESAADEDADYSYVPTAEELEEEEELGAYYPDSNPDFATGYTFEDLKMVHKVIATDEVDEEEKRQAREVLPAVMGSDVWDEMLDEFEGAR--QRVARLMNNS.............................. 221
113 1.000e-13UniRef50_W6NZ42 Conjugative transposon protein TraD n=1 Tax=Bacteroides xylanisolvens SD CC 1b TaxID=702447 RepID=W6NZ42_9BACE  ali  58  7MTDILLAVSVGCNLWFLFLLLYERIMDTRIVRFFKGIVGLWRSLDGNEAKRIAAHEEVPAEKADIIGKSRFRMASTR........................................................................................................................................................................ 83
114 3.000e-13UniRef50_A0A238U766 Conjugative transposon protein TraD n=1 Tax=Tenacibaculum jejuense TaxID=584609 RepID=A0A238U766_9FLAO  ali  12  24.............................................KSTSAKPPKEKSKLKPSNSIMGESKEVL------------------KQQEVKKTLVDSPDKSIDKTETQKIIPTEDLDTIFNSSPSKDNDVSDKPHFSNQTDQDFNTGLSFEELQKIAKLLNQKELTND----TLPVAMKIENTELLEILNEKIPKA--QQHVSDLLNTHLATH---------SSSKINDDWRDFDIGDF 201
115 1.000e-12UniRef50_A0A2V1IPQ8 Uncharacterized protein n=1 Tax=Muribaculaceae bacterium DSM 100764 TaxID=2094239 RepID=A0A2V1IPQ8_9BACT  ali  17  38.........................................KKSAKTDDSEQSDDSTQELPSADVVGKSALDIDEWRKIVREEFREVVPLIIKEFGSPADAGWDDEEYVPQKYRKVVAKEDLEDVFSNKTASELTGE-----APTPAPPMADGIDFKQMDTTMKVLKGKSDNPEDIETTKRVLSEAGDAAIFEVI---KLDPVIQKRILMIECHIPKEKADTTATQVDKTDTPK........... 222
116 2.000e-12UniRef50_K5ZA42 Uncharacterized protein n=29 Tax=root TaxID=1 RepID=K5ZA42_9BACT  ali  21  34...........................................ETDEDTDGTGKEPGQPGEPYTVMGESTY-----LPFGAEDGEEAAAG-----AVDEPAAEDDGADYSDIEPEEDEEETDYEPTPEEIRELEEEEELEAYYPDGNPDFATGYSFDDLKKVRRVLVSDNADEKAEREAREVLPSVMGSDIWEAMLDEFEGAR--ERVARLMDNH.............................. 193
117 6.000e-12UniRef50_UPI0003EE4DBA peptidase C11 n=1 Tax=Arthrospira sp. PCC 8005 TaxID=376219 RepID=UPI0003EE4DBA  ali  14 2708..................................RDFLDIHLPSTNTQRSSNPTQPEERPNSVTVEPESEELEESDQPENDSETPEESQASPESEAVTSNIAESDEPDESDESDELDESDELDESDELDESDELDESDEPDESDEPDES-------DELDESDESAEVDPLTENLEAEAEDILDDLQGSEEANLIAGSSEDLSGVT----VIPTTDDAIALEVEEAEGSSNFDPVDLEEEDV... 2921
118 6.000e-12UniRef50_UPI000785DAC2 hypothetical protein n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000785DAC2  ali  13  20.........................................RFRPKKITKETIVKNKKSKKNSSIMGEPKT-IEKSIKGASKKKALTKNTPKKNTSKVIPTEALDEVFGRPNTQTLIAD--------DWEFIEEEEDLKSNISIEHDQDFSTGISVDELGKISTLLKQKELTNE----TLPVAVKIADTELLELLNEQIPQA--QQRVTSLLDKYLKTHHNPK---------ISEDWRDFDIGEF 199
119 1.000e-11UniRef50_A0A132H835 Uncharacterized protein n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132H835_9BACT  ali  19  28..........................................RPEPEKTGNTEERTDSTAEESTVIGRSTLDLG------AQLRRMEARRAETELQAAVRRGEMTEDGKEIAKAVDIKDCQLEEKKTIVPVPDEELDDM---FAEPDVRMAEGNPLNDIDLAFDTARRKEPDEQDERMAADVFKSLEGTELLDQVCGRWP--EVGENIQRILDKYYGE-----ESERPRGFVMPDRFEDFNIND. 213
120 1.000e-11UniRef50_F3ZNE8 Uncharacterized protein n=3 Tax=Bacteroides TaxID=816 RepID=F3ZNE8_9BACE  ali  17  22............................................RKDQKGVKPINKIIPKRARSIIGKSTYIV---------TIPLEADQTTPENYTE---------------PMHVDFEMEYDDEEEEELSIDLELEEIALLTNEDIKSAQGLSFEEMSQVVEVIQQEQTTEEKERQAAQTISLMQQTALFDIMIEQLDGGR--QRVADILSKY-----ETALVNNDSESASANELEEFNLDSY 191
121 3.000e-11UniRef50_K1T5B0 Uncharacterized protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1T5B0_9ZZZZ  ali  20  1...................................................KRTVPSSSSDDDDVIGKTKVIYLED-PKVARMTPTRSEPMEKIPLEEDEDIGSDDVEQENKGLT----------------EEEREELMAPVDAEPDPDFNTALTIEEINNVAEVLTSGIVDEQKALRAARTIHKLSETEILAFLTDKLSN---LEKVNDLLDKYLGNRRGVSGRKGSKED------EPFDIDKY 169
122 6.000e-11UniRef50_H1W862 Peptidase C11 clostripain n=4 Tax=Arthrospira TaxID=35823 RepID=H1W862_9CYAN  ali  14 1769..................................RDFLDIHLPSTNTQRSSNPTQPEERPNSVTVEPESEELEESDQPENDSETPEESQASPESEAVTSNIAESDEPDESDESDELDESDELDESDELDESDELDESDEPDESDEPDES-------DELDESDESAEVDPLTENLEAEAEDILDDLQGSEEANLIAGSSEDLSGVT----VIPTTDDAIALEVEEAEGSSNFDPVDLEEEDV... 1982
123 1.000e-10UniRef50_A6L273 Uncharacterized protein n=36 Tax=Bacteroidales TaxID=171549 RepID=A6L273_BACV8  ali  15  100.....................................DEKVEAKKKAEGKNMEKPPQKRSETDSLVVTKSYGIRQRPPIN-------VTGSGTIAGKENASTFAGRNEDTPQKVAQVPPERIPELFRDKRVEEWEELDDLNCIREEYSGEATGIGPEEIDLIIDLCNGKDIPTDKRLSLLRAIHHIKDTQIERSILESINGSD--SRISKFLDEAEQMGGAAPDRD................... 310
124 2.000e-10UniRef50_A0A073I5B2 Uncharacterized protein n=1 Tax=Porphyromonas sp. 31_2 TaxID=658663 RepID=A0A073I5B2_9PORP  ali  10  16............................................TPAKREQMISMSPEPADEKEVMGKTRFVY-----LDENAGKTAAPYMSQPLEQGTDYIGEDEEIREEDVECL--------LPLEEMELLRKEQEELDSALPETEVITQAVTLEEFSLVGDVLMRVNGADQDADKAARTLFAIRNTSLFDLFISQVGNEEA---VNKLLEENLDEDGNPRPLKKG................. 186
125 2.000e-10UniRef50_A0A134BIS1 Uncharacterized protein n=76 Tax=Bacteria TaxID=2 RepID=A0A134BIS1_9BACT  ali  19  39........................................................TEEVSEAEIIGKSRFQICHSKPQVR-------SYPEVDSTGKKSSTFAMENGNEHSGDTGGLPEIDDVYETDGATAGEEEEVEVAVPNAEKETYDGGIDFARVQEALSVIHRNASSIAERQRAGETLTELEGTRLMETLRSDKVRSSTIDDINRFEELYVPSEGKGK...................... 203
126 3.000e-10UniRef50_K1RN30 TraD (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1RN30_9ZZZZ  ali  29  3.........................................................................................QTESEPVSENDVTFED----PPKNTARIPDELLDDVFTNVRIEDVGVKYSDDED-DADVPQAKGTSFEDIDTAVKTVKASKATDKEKRHAGRSSTRWMVT---NSMRNSWRTARSARK...................................... 112
127 6.000e-10UniRef50_UPI000780AAED hypothetical protein n=1 Tax=Aquimarina longa TaxID=1080221 RepID=UPI000780AAED  ali  13  13..................................................................................................................................WELTEEELKSDFPTINDQDFNTGINFEELQKITTLLNKKELTTE----TLPIAMKIENTESLEILNEQIP--QLQQHVSDLLNIHLATH---------NHPKINEDCRDFDIRDF 112
128 1.000e-09UniRef50_F9DAQ6 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=F9DAQ6_9BACT  ali  24  2...............................................................EIIGKSHFKLSH-------STPQVRSYPKDEAEAKKASTFAPENQEPSEEPDNLPDDEIPLTYESSDSSLFEEEEDEELPVSGKNEYATGIDFERVLEALSVIHRNASSIAERQRSGETLTELEGTRLMETLRSDKVRSSTIDDINRFEELYVPSDGRDK...................... 158
129 3.000e-09UniRef50_UPI000380B2C1 hypothetical protein n=1 Tax=Porphyromonas levii TaxID=28114 RepID=UPI000380B2C1  ali  16  71..........................................................EEVPFSLVGKSRPYIS---PSPSNDFPIVPATSPSEKSVENIDTFVPELPEQLGNSDEVIEEDNEDYTDDMEEVDEEQNEREEEPIAKEPLHSGGVLVKELALLQKTTQKETLDEEEVESVRETIIKLQGTDLLEQYNKNLIHIDMENKILKVIREVEEQGQETESQNSSIINQIPDS......... 254
130 8.000e-09UniRef50_A0A0K8QXS3 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0K8QXS3_9BACT  ali  14  22...........................................RKTGTASVERENTRQKNIPEGIVGKSTFVLTVGKSS------------------------VSEADSSGKMDIEVPLE------YEPDISSVEEQEELEQLGLPAESFSD-LTFEEMMEVVNEVGS--IEPQNAAKTGKLLHENDNTHWVEQM--AYSSPAYQKRIVELIDLHLGKLAQNANAVRS-----DDRVNEFNIEQY 183
131 2.000e-08UniRef50_A0A134BTT8 Uncharacterized protein n=1 Tax=Prevotella sp. DNF00663 TaxID=1384078 RepID=A0A134BTT8_9BACT  ali  32  1..................................................................................................................................................................MKSVRKPEANEAEKLHAGKTFKDIAETELFQKITESF--AGISDRVNEVIDLY------TARAAEAKPLVLPARIEDFDIR.. 73
132 4.000e-08UniRef50_E1WKB8 Putative exported protein n=8 Tax=Bacteroidales TaxID=171549 RepID=E1WKB8_BACF6  ali  13  54.......................................................................................TIRIPKRELSQEENILLAELPIEEEQQQEQSFETEMLEETVPSILEEEEVSVLVEVQGENHSLSESITVEELQQMGNVLSCKNAPIEEAAKAAETICKIQDSPMFQAIKKA-----TGERVRKLLDR-------VAEEAPKEILSGNFDYKRF..... 194
133 5.000e-08UniRef50_UPI000D1DE3A5 hypothetical protein n=1 Tax=Muribaculaceae bacterium DSM 100749 TaxID=2094238 RepID=UPI000D1DE3A5  ali  17  24..........................KKGAGKERPEHQDTPLPEAGEPINSNPVEPDKSKPDVSLVPKSDFNMEEFKKAITESMQTAMIHVLESMVGGE---------VTPDQVEFKDKDDISEYTPDDTGTEPDPSIDDVEPAAPSPP-ASGNSLEEIESALKVAANDRATADEKATAGNVLSGMSDVVFIGKIMASNENEGIMACIAESLRNKPNTKKKVSPAPKKKSKPIDVGGTLRDID.. 233
134 8.000e-08UniRef50_A0A0D8JCW5 Uncharacterized protein n=1 Tax=Draconibacterium sediminis TaxID=1544798 RepID=A0A0D8JCW5_9BACT  ali  17  30...................................................NEERKNNLSDESGIIGKSTFVLNTERKSQSHS-----------NFTGKLDIEVA----------------LDYVDVELDEELEELGIANSPLLD--------LTFEEMMEVVTEVEKDQA--EGLAQTGRLLYENENTDWVEQLASTSEN--YQKRISALIDLHLMKLGQ------NDDSFSDDERSEFDIGEF 178
135 2.000e-06UniRef50_A0A1M4U2U6 Uncharacterized protein n=2 Tax=Mariniphaga anaerophila TaxID=1484053 RepID=A0A1M4U2U6_9BACT  ali  13  98.........................................................................................................................................................ITFDAMMDAVKDVETEQ--PQKPMQSGKLFYENQDADWVEQLAAS--SDENGHRVSSLIDLHLAKLEQ-----QNSDIKIDDSLESFDIGAF 180
136 3.000e-06UniRef50_A0A0B7HK23 Uncharacterized protein n=1 Tax=Capnocytophaga cynodegmi TaxID=28189 RepID=A0A0B7HK23_9FLAO  ali  21  15...............................................................................................................................................PEQDNDFATGLSFEDLKKVADFLSQNASSTTENRELA---QKVVGTNLLEAIEKALPEASL--KAARLLDEFLPQTLQKES--------------DFDIEEF 97
137 8.000e-06UniRef50_F0ICQ0 Uncharacterized protein n=17 Tax=Capnocytophaga TaxID=1016 RepID=F0ICQ0_9FLAO  ali  19  19......................................DKMPITQKRTPKPKATPIPKSAPPTSVMGESRFVSPAKVATTAIPLTEKEQQDILTEWEEEPI---------------------------VNLEDEEEDLRSYRTEAEDNDFATGLSFEDLEKVATFLSEDK--EEVTTENIELLQKVEGTSLLEAIEKALPQATL--KVSALLEKALPKTTESET--------------EFDIREF 180
138 1.000e-05UniRef50_B4GUE0 GL25757 n=1 Tax=Drosophila persimilis TaxID=7234 RepID=B4GUE0_DROPE  ali  14  62.........................................KKETETKPSAKRKLPISTPSDEEELGGRRKRKRIVLPESESEDEMEETKSEDDFSGDESDYEPDGKDDAASEESESGDDEGEEPMDDEESEDDPTPNNNNEPVGQKVKLAEGSTFQELKNIQSNVKQDAAYDE....................................................................... 206
139 1.000e-05UniRef50_W6PFC1 Conjugative transposon protein TraD n=1 Tax=Bacteroides xylanisolvens SD CC 1b TaxID=702447 RepID=W6PFC1_9BACE  ali  39  2......................................................................................................................................................................................FTDMEGTELYEKMMEG--SSEIGIRIKGLIEIRLKKSE--------KEFVVPDNIEEFDIRNY 54
140 6.000e-05UniRef50_A0A2V3PJ83 Uncharacterized protein n=1 Tax=Dysgonomonas alginatilytica TaxID=1605892 RepID=A0A2V3PJ83_9BACT  ali  10  2...........................................................................................................................................................FDEFELMTKSLQGKSITKGEEHQVAEIIIRAQGTDLYEQMVNQIDGAKQRALI--VLKGYETEESINSGSING----------GFDLSKY 79
141 1.000e-04UniRef50_UPI0003AD4AE8 hypothetical protein n=1 Tax=Porphyromonas gingivalis TaxID=837 RepID=UPI0003AD4AE8  ali  11  20.....................................................................................................................SLETGMSEETSPFIPEEEEDYVLVEVQGESHSLSESITVEELQQMGNVLSCKNAPIEEAAKAAETIYKIHDSPMFQAIKKA-----AGERVRELLDR............................... 111
142 2.000e-04UniRef50_L9PRC1 Uncharacterized protein n=67 Tax=Bacteria TaxID=2 RepID=L9PRC1_9BACT  ali  38.......................................................................DLRLFFKERGKDKVVVTIRVPKREFAQEENVLLAELPITPEEEDEENSEPAES--SELLDMESEEEYVQVEFEGESHSLSESITAKELHHMGSVLSRKEVPIEEEVKAAETICKLHDSPMLQEIEKVAGG-----RVHELLERVMNQAPKAVQSGN.................. 186
143 2.000e-04UniRef50_A0A2W5E9M9 Conjugal transfer protein TraD (Fragment) n=2 Tax=Pseudopedobacter saltans TaxID=151895 RepID=A0A2W5E9M9_9SPHI  ali  20  24.............................................KKRSEQKPMRKKVNLNLPDIMGQPK-------PVRSLSVPNTANESQITEPEINPDNLDIEYDENENVSIQIPQEELDEVFSNMPD.................................................................................................................. 102
144 0.004UniRef50_A0A0F8C5C0 Multiple PDZ domain protein n=1 Tax=Larimichthys crocea TaxID=215358 RepID=A0A0F8C5C0_LARCR  ali  17  325.................LFADQLIKDEISEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEPSEDEISEDEPSED....................................................................... 483

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24