current user: public

If you have questions about the server, please let us know.

Query: gi|12044855|ref|NP_072665.1| seryl-tRNA synthetase (MG_005) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MLDPNKLRNNYDFFKKKLLERNVNEQLLNQFIQTDKLMRKNLQQLELANQKQSLLAKQVAKQKDNKKLLAESKELKQKIENLNNAYKDSQNISQDLLLNFPNIAHESVPVGKNESANLELLKEGRKPVFDFKPLPHRELCEKLNLVAFDKATKISGTRFVAYTDKAAKLLRAITNLMIDLNKSKYQEWNLPVVINELSLRSTGQLPKFKDDVFKLENTRYYLSPTLEVQLINLHANEIFNEEDLPKYYTATGINFRQEAGSAGKQTKGTIRLHQFQKTELVKFCKPENAINELEAMVRDAEQILKALKLPFRRLLLCTGDMGFSAEKTYDLEVWMAASNEYREVSSCSSCGDFQARRAMIRYKDINNGKNSYVATLNGTALSIDRIFAAILENFQTKDGKILIPQALKKYLDFDTIKLast
1 -129.000[J] COG0172 Seryl-tRNA synthetase  ali follow..  42  1MLDIKRLRKDFAGIREKLQTRGEDISGLEKFGSLDEKRRQVIVKVEELKSRRNQVSQEVAEKKDADHLIKEMRDVSDEIKGLDETLRQLDEELDQLLLAIPNVPHESTPVGETEDDNVEVRKWGEVPNFPFEPKAHWDLATALGIVDFERAAKVTGSRFAFYKGAGARLERALINFMMDLHKHGYEEVLPPYLVNRTSMTGTGQLPKFEEDAFKIREEDYFLIPTAEVPVTNLHRDEILSADQLPIAYTAYSMNFRSEAGSAGRDTRGLIRQHQFNKVELVRFVAPEDSYDELEKLTGHAEKVLQLLKLPYRVMSMCTADLGFTAAKKYDLEVWIPSANTYREISSCSNFEDFQARRANIKFRREAKGKAEFVHTLNGSGLAVGRTVAAILENYQQEDGTIVIPEVLRPYMGGMEK. 422
2 -116.000[J] KOG2509 Seryl-tRNA synthetase  ali follow..  25  2VLDLDLFRVDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWG-DCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKDKVEFVHMLNATMCATTRTICAILENYQTEKG-ITVPEKLKEFMPPGLQE 466
3 -22.200[J] KOG2324 Prolyl-tRNA synthetase  ali follow..  16  22.................................................................................................................................NVPESANQLLIDM---------IQPSMPGIFQYLPLGLRVQNKICDLLHISMRSGASAISLAHLSSKEIWEKSGRWQKTGSELFRLNDREMCLAPTHEEDVTRTMATIIDSQKQLPIRVYQIGRKFRDEL----RPRGGLLRGREFMMKDLYTFIDKASAMKTYEDVLQAYHTFFKEVGLPFVMVKAATGNIGGNLSHEFHYRH---CNDQLTSTTAIEVGHAFYGKIYSSKFNATVEVKNKQEVLHMGCGIGVSRLIAAVAHVTKDAKG-LVWPSSIAPW....... 329
4 -20.900[J] KOG4163 Prolyl-tRNA synthetase  ali follow..  11  49..STTTPSALIANATSSKDPRLARDDLVKQAFQSESARAFILGDLANATSNFHLLIDHELGTVDGDTILQLNDSTYMKKSDMMKFLNNFEDSQKVVEVSKETATEGKKQQKAAAAALEDAKLIGITVDKALDFPGYQQILTKGEMLD-----YYDVSGCYILRPPSYAIWENIQKWFDDKIKAGVQNAYFPMFVSSRVLEKEDHVEGFAPEVAWVTEEPIAIRPTSETVMYPYYAKWVQSYRDLPLKLNQWNSVVRWEF----KHPQPFLRTREFLWQEGHTAHLTAKAEEEVLQILDFYAGVYEELLAVPVVKGRKTEEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFSKMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGVMVMIHSDNKG-LVIPPRVSQF....... 474
5 -18.500[J] COG0442 Prolyl-tRNA synthetase  ali follow..  17  32.......................................................................................................................................................IRKLASGLYTWLPTGVRVLKKVENIVREEMNNGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRPFVLGPTHEEVITDLIRGEINSYKQLPLNFFQIQTKFRDEV----RPRFGVMRAREFLMKDAYSFTTQESLQETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGGSASHEF-----VLAESGEDDIVFSTGS-DYAANIEFAEALAPTEPRAPATEELRIVDTPNAKTIAELVE......................... 268
6 -15.700[J] COG0441 Threonyl-tRNA synthetase  ali follow..  17  238.................................................................................................................................EAAKRDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKLEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGF-----FPTWLAP........ 539
7 -15.200[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  19  286.................................................................................................................................EAAKRDHRKIGREQELFFFHE----LSPGSCFFQPRGAHIYNTLMGFIKAEYKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDLG-------ELEQWNDAEKALAESLNEFGMPDFQPIRFNLSYIADDGEKKRPVIIHRAILGSVERMIAILTENFAGK-----WPFWLSP........ 586
8 -8.140[J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit  ali follow..  11  1........................................MREQLEALRDDAIKKIEQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVIGQLANDVREAIGKAIESKMEALEQAEIHRKL--------------------EETIDVTLPGRPVLKGGAHPLTATITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPRDMQDSFYFTDELLLRTQTSPVQARTMEKYK----GKGPIKIICPGKVFRRDD---------DDATHQFMQIEGLYVDHGVRMSDLKGVLQAFAKSFFEERSIRLR-FTEPSVEVDVSCGICHGDGCRVCKQTGWIEILGAGMVHPRVLEMSGF----NPNEYSGFAFGMGVERLSMLKYGIDDIRHFYTND------RFLAQF....... 341
9 -7.610[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  1...................................................................................................................................................MQTWQLPEHIA--VLPTNARQLESAREQLLALFRVHGYELVQPPLMEYAHSLLTHIDAGLSLKTILVTDRLSLGIRADITPQVARIDAHL-LSANQGINRLCYAGPVLHAQSDGLL-------NMREPLQAEMYGFADIRGD-----ELIDLMLKSMKIADMGKVLLSL--GHIGIFRALSDAAHLDAGQSATLLALMQDKDTETVEAQVKAWKLDGMWAKAFSLLPRLYGGREVLSDARGRLPDLSAVGGALGELQAVCD......... 251
10 -6.790[K] COG5576 Homeodomain-containing transcription factor  ali follow..  13  432.......................................................................................................................................................................................................................YDSEFYYFSCTLLVIGLWKR---ASPQDLMCFYSPPKKLFA-QFQGIQ------YRIESFFVIESIHVFRVEEPLLNELSATASSRDKPAP----------------NEYWLQMDIQLHMITSEGQGN------CTDFQASEV-------------LLHSLMGRATSMFQMLDRVRRASPELGSVIRLQKGLNP........ 596

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.