current user: public

If you have questions about the server, please let us know.

Query: gi|12044857|ref|NP_072667.1| DNA polymerase III subunit delta` (MG_007) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MLTTTHALLIIQRKGSFLKPFLDNYLTSIVCENKNGCKKCINCLEILNNKYNSLYWFDQINPFKRENALQLARIFNRERTSVNNKNIYLIEEIEKLSSNSINSLLRLVEDSPINSYGIFTTKNESLILSTFLSRVQKVVLKKASKVPFKVSKNDQEIITSFFTVDEQIEAIENGSFNRFKIILDACLNKKTGTEQIYHAWQIFRDFSNSEIAQLITLIINKTENIDKKSILFNCLKVLPYNPPKSTLFANLVSWLast
1 -77.300[L] COG2812 DNA polymerase III, gamma/tau subunits  ali follow..  16  35.EKFSHAYLFSGPRGTGKTSAAKIIAKAINCEQAEPCNECRACKGITSGSIVDVMEIDAASNNGVDEIRDIRDHVKF-APSEVRYKVYIIDEVHMLTTGAFNALLKTLEEPPSHAIFILATTEPHKIPLTIISRCQRFDFKRISNDALVGRMKTHEGIEAEDEALVLVARAAEGGMRDSLSLLDQAISFADERVTVEDVLAITGAVSHEVLTQVVESAQKG----ETAEALQLVNQLLANGKDPLRFVEDLIYY 288
2 -56.600[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  14  34.ADCMPHLLFCGPSGAGKKTRIKCLLRELYGVGTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVDLVKEMAQTSQIESTSQRSFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDVTKVLRERESFLLPENVLQKIVEKSEGNLRRAILMTEALRMENESGVAESVVIPVPE---EIYIQETARLILQKQSSDMLLKVRERLYELLSRCIPPTVIFKKLLEH 301
3 -56.400[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  67.GNVPN-IIIAGPPGTGKTTSILCLARALLGP----------------ALKDAMLELNASNDRGIDVVRNKIKMFAQQKLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGF-GFINSENVFKVCDEPHPLLVKEMIQHCVNA----NIDEAYKILAHLWHLGYSPEDIIGNIFRV 302
4 -56.100[L] COG0470 ATPase involved in DNA replication  ali follow..  12  44.GKLPH-LLFYGPPGTGKTSTIVALAREIYGK----------------NYSNMVLELNASDDRGIDVVRNQIKDFASTQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIAVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDDEISDDVIYECCGAPRPSDLKAVLKSILED----DWGTAHYTLNKVRAKGLALIDLIEGIVKI 284
5 -52.900[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  10  70.NKLPHLLLY-GPPGTGKTSTILAVARKLYGPKYR----------------NMILELNASDDRGIDVVRQQIQDFASTSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRLKEAERLVVSDCGLAALVRLSNGDMRKALNILQSTHMASKKQITEEDVYLCTGNPLPKDIEQISHWLLNK----PFDECYKDVSEIKRKGLAIVDIVKEITLF 315
6 -44.800[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  52.....HSMILWGPPGTGKTTLAEVAANYANAE----------------------VERVSAVTSGVKEIRAAIEKARE-NKLSGRRTILFVDEVHRFNKSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQKVAAVFADNVLDRLAELVNGDARMSLNYLELLYDMAREDDQGRKQIDLPLLAEVAG-YDLISAVHKSIRGSDPDAALYWAARMISAGCDPLYIARRLLAI 299
7 -43.000[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  135.NRLPSIVFW-GPPGTGKTSIAKSLINSSKDPSLYRFVSL------------------SAVTSGVKDVRDAVESAKRLNLEGRKRTVLFMDEVHRFNKSQQDTFLPVIEDGSILFIGATTENPSFHLITPLLSRCRVLTLNPLKPNHVETLLRRANSVEVDDSVIEFLANNCDGDARVALNALEISATMATTRAGTDAVVSIDDAKEALQ-YNLISALHKSMRGGDANAAIYWLARMLEGGEEPLYIARRLIRF 389
8 -42.800[K] KOG2680 DNA helicase TIP49, TBP-interacting protein  ali follow..  12  182.EKVQSGDVIAIDKATGKTKLGRSFSRSRDYDAMGQCPEGELQKRKEVVHCVTLHEIDVINSRTQEIRSEVREQIDTEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENEMSPILVVATNKSPHGIPIDLLDRLLIITTQPYTDDDIRKILEQEEDVEMNEEAKQLLTLIGDTSLRYAIHLITAAALSKGKVVEVEDIQRVYRLFDVRRSMQYLV-------EYQSQYMFSEPIKNDEAAAEDEQDAMQI... 469
9 -34.200[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  52.GDALDHVLIFGPPGLGKTTLANIIANEMGVNLRTTSGPVLEK---AGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEI------YPAMEDYQLDIMIGEGPAARSIKLDLPP--FTLIGATTRAGSLTSPLRDRFGIQRLEFYQVADLEHIVSKCLGLELTPEGAHQLARRSRGTPRITNRLLRRVRDFAEVRAD........................................................... 239
10 -32.400[L] KOG1942 DNA helicase, TBP-interacting protein  ali follow..  10  217..DLEAEEYVPLPKGEVHKKKEIVQDVTLQDANARPQGGQDILSLMGQMMKPRKTEITDKLRQEIN---KVVNRYIDEGVAELVPGVLFIDEVHMLDMECFSYLNRALESSLSPIVIFATNRGPHGVPIDLLDRLVIIRTQIYDPSEMIQIIAQVEELTVDEECLVLLGEIGRTSLRHAVQLLSPASIVGRDNICKADIEEVTSLYDAKSSAKLLHEQQEK................................. 455
11 -16.700[L] COG1466 DNA polymerase III, delta subunit  ali follow..  10  19YAEKVPAIALIGSALEDDKDALIELLVSESFKE-------------------------GGQGLMPATLMSWTETF----ALFQEHETLGIIHAEKFPLATKEFLSRYARNPQPHLTILIFTTKQEELSKALPSALSLSLFGEWPADRLLQRAERVGISCSQSLASLFLRALASTSLPDILSEFDKLLCSKKTSLDHSDIKELVVKKEKASLWKFRDSLLKR----DPVEGHQQLHFLLEDGEDPLGIITFLRT. 251
12 -15.000[H] COG1239 Mg-chelatase subunit ChlI  ali follow..  12  76....RQNFILLGLRGQAKSRILRAITELLPDDPLNPIGAEGQHLLEAHGMEPDVTVADLIGDVDPIKAARLTRSMHFGLLPRANRGIFAVNELADLSPKVQVALFNILQEGDVQIVMLVFSANPEKIVTPLKDR-SEIRTHYPTDVQTAQEAVKEEGVVVPPFIAELIEDIAFQSQRLPISLMELACANAERRSLVSGDAPVVRVTDVYAGLPAITGKMELEYEGELKGADNVAKDLIRK.............. 382
13 -14.900[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  13  62.GETPSNVLIYGKTGTGKTAVTRYVGKELERVSEDKSLFCSNCEVIDTQYRL-ARHFEEEVPMTGWPTDQVFMKFKEAIDARDQVIIIILDEIDKLIKKGDDVLYNLSTDLRKAKVSMIGVSNDLKFTEFLDPRVKELIFPPYDAEQISDILKQRAKMAYNDGVLGAFAAQEHGDARRALDLLRVSGRENQPQVLEEHVRRAQEKIEIDRVVEVVRTL-----PTQSKLVLYSIILLRSRGREGKNV....... 330
14 -14.600[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  11  34ISQVGKHLLIEGPSGIGKTCVVFKVFEELQWSQGR-----------------DFTYVGCRDQNAEQIIDDFLKNAAAGNALSP--CVLVIDDFHLLSQAKRMEILKRLQAEPAKVILIGIPTAGVSLLYDLGPRLGSYALTRASDVEIDKLISEEQALAVLFEDRDVLLAESAGNFWLAQYVCNKVCAIEEVYETQDDAKILTFDILG------IRGRLMAELTQRYLPIARTFAKGKRWRPGGNKPYLEIL.. 273
15 -14.400[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  411......AVLLSGPPGIGKTTAAHLVAKLE-----------------------DVLELNASDTRSKRLLDEQLFGVTDSQSMAKSRLVLIMDEIDGMSSGDRGGVIKKSMIP----IICICNDRAHPKLRPLDRTTFDLRFRRPDANSMRSRIMSREGLKLSPQAVDQLVQGTQSDMRQIINLL-STYKLSCSEMTPQNSQAVIKNSEKHIPWDICSRYLHGGMFHPSSKS........................ 633
16 -12.800[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  11  130....GSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATDLRTDKKIILVEDLPNQSHTLHEVLRKYVRIGRCPLIFIISDSLSGDFPKEIQEEISNISFNPVAPTIMMKFLNRIKITVPDKTSLELLCQGCSGDIRSAINSLQ...................................................................... 341
17 -12.400[F] COG1618 Predicted nucleotide kinase  ali follow..  8..KTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGINLDDLERIGANAVRNALACDLVVIDEIELISQSFVSAVEEVLESD-KPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNR................................................................................................... 178
18 -12.400[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  10  146.QQKAGSLYICGCPGTGKSLSMEKVVQQVGDWSTQACTSLSKTTDIFSKILGEIKPGKNANTNSSPLQHLQNLFSQKQESSSSRMMLIIADEMDYLITKDRGVLYDLFMLTPFSRCILIGVANAIDLADRFLPKLMVITFRAYSKDQIQERLRVLSYVAFQPKALELCARAASGDMRKALCVCRSALEILEIEVRMDHMAAALSKTFKSPVVETIQSL-----PQHQQIIICAAAKAFRGSKKDATVGELNKLY 438
19 -12.200[L] KOG1514 Origin recognition complex, subunit 1, and related proteins  ali follow..  12  420...LGRCMYIHGVPGTGKTISVLSVMKNLKAEVEAGGLKLASPENIYSVIYEGLSGHRVGWKKALQSLNERFAEGKKIGKENEKPCILLIDELDVLVTRNQSVLYNILDWPPNSKLVVLGIANPEKLLPRISSRMQRLCFGPYNHRQLQEIISTEGINAFEKTAIEFASRAISGDARRALEICRRAAEVADYRLKKSNISAKSQLVIMADVEVAIQEMFQKSVSKLSRIFLTAMVHELYKTGMAETSFDRVAT. 700
20 -11.900[R] KOG2170 ATPase of the AAA+ superfamily  ali follow..  105......VLSFHGYTGSGKNYVAEIIANNTFRLGLR-----------STFVQHIVATNDFPDKNKLEEYQVELRNRILTTVQKCQRSIFIFDEADKLPEQLLGAIKPFLDY--RRSIFILLSN----------GEIARITKEQYESGYPREQLRLEAFERELMNFSYNEKGGLQMSELISNHLIDHFVPF----------------LQREHVRSCVGAYLRKRGRGDLVSNVDFVERVLNS.............. 313
21 -11.800[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  80.GRPANNVLMSGARGTGKSSLVKALLHEY------------------ADKGLRLIEVDK------SDLIGLPYLLTLLKECPEKFIVFCDDLSFESGDETYKALKTALDQRCANVLVYATSNRRHLMPEYFDEN--------------------------AGTTGMRGEIHQKEAVEEKISLSDRF-----------GLWLSFYPFDQNDYLAAVQNWLEDFGVPYDETAQMAALQWAQSGRSAWQFACDWAG. 279
22 -11.100[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  10  116.......ILMIGPTGSGKTLLAETLARLL---------------------NVPFTIADATTLTEAGYVGEDVENICDYDVEKAQMGIVYIDEIDKISRKSQQALLKLIEGTVASVILFICGGAFAGLERVIQNRSARGGIGFNAEVRSQEMGKKVGEAFKEVEPEDLVKF---GLIPEFVGRLPVIATL--DELDEAALMQILTEPKNALTKQYAKLFEMEGVDLERPDALKAVARKALERKTGARGLRSILE. 377
23 -10.900[O] COG1222 ATP-dependent 26S proteasome regulatory subunit  ali follow..  11  180..KPPKGVLMYGPPGTGKTLMARACASKTNA----------TFLKLAGPQLVQMYIGDGARL-----VRDAFALAKERKPT-----IIFIDEIDAIGQRTMLELLNQLDSSSEEVKIIAATNRVDILDPALL-RSGRLDRKTLGRKRILQIHARKMSVRDDVNFDELARSTEGFNGAQCKAVCVEALRKEKTEISQNDFMDGIQEVLSRKKSKLL....................................... 398
24 -10.700[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  12  46.......AMLTGEVGTGKTTVARAILASLKTRAGMILNPTFSDLELLEAICDEF--VSYPKKATLKKLTQVLHEFLLAEHAQGIQVLLMIDEAQHLAPDVLEQLLTNLETESHKLLKVLLIGQPE--LRQLAQRITRYHLLPLNEEQTADYIRFRIEQAFNRKACQWIAEQTHGIPRLINLVCDAAL................................................................... 242
25 -10.500[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  10  95........TVYGMSGVGKTKAIQEFAKSHANVWLVTASPSRSSLSEILYEIALELGISDAPRRKGTLSRLIARKIK------GTEGLLIVDEADHLPYEALEELRIMQEEAGIGLVLVGNDKVYTRMYARLWSRVKNTSIQKTKKADTQA-VAQAWGLETDEEALKVMQSITEGGLRILTQTYACR.................................................................... 277
26 -10.500[T] COG2766 Putative Ser protein kinase  ali follow..  10  103....KQILYLLGPVGGGKSSLAERLKSLM-SPVNDH-IMSPWAAKRLHEFGGDITKFREPGDENNQDISALVGKVDIRKLCRANQGIMEFVEMFKAPIKVLHPLLTATQEGNYNGGIILAHSNESKNNEAFLDRVYIVKVPYCLRISEEIKIYEKLLNHSELETLSRFSILSRLKEPENSSIYSKMRVYDGEYRDYAGVDEGMNGLSTRFAFKILSRVFNFDHAEVAANPVHLFYVLEQQ.............. 453
27 -10.400[R] COG1223 Predicted ATPase (AAA+ superfamily)  ali follow..  10  132.KWAPKNVLFYGPPGTGKTMMAKALSNEAKTP------------SVKSTKLIGEHV-----GDGARRVHELYERARQLAPC-----IVFLDEFDAIVSEIVNALLTELDNSNEGICTIAATNRVELLDASIRSRFEEFRLPSYEERLEILRRNLEEFPVPVKARLELVAAASEGSGRDLVEKVIKA-------SLHKAIAEGKDKIETEDLLTAAEKVKMPSRQPPKQMFV....................... 352
28 -10.200[O] KOG0728 26S proteasome regulatory complex, ATPase RPT6  ali follow..  11  180..AQPKGVLLYGPPGTGKTLLARAVAHHTEC----------TFIRVSGSELVQKFIGEGSRM-----VRELFVMAREHAPS-----IIFMDEIDSIGSSRIESLLNQLDEATKNIKVIMATNRIDILDPALL-RPGRIDRKEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEALRERRVHVTQEDFEMAVAKVMQKDSEKNM....................................... 398
29 -10.200[G] KOG3354 Gluconate kinase  ali follow..  12  14....KYVFVVIGPAGSGKTTMAKAVSEKLGFEEGDDLHPKANIEKMSQG-------HPLNDNDRWGWLHNCGGACAMELDKESIKGVVL--TCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNHY----MKADMVESQLAILEAPTADEKDVITIENGKEQSEEECLDIVHKMVN.................................................................. 188
30 -10.100[O] KOG0743 AAA+-type ATPase  ali follow..  746....KRGYLLYGPPGTGKSSLIAAMANYLK----------------------DVFDLELSSIYENAQLKSILLSTT-------NRSILVIEDIDCSGRVTLSGLLNFVD---DERIIVFTTNHKERLDPALLSYCTGLGFRTLVSNYLGLGGLNHPLCE------EIEALIDSTEVTPA-ELAEELMQEDDTDVVLRGVVSFVEN................................................. 946
31 -10.100[O] KOG0651 26S proteasome regulatory complex, ATPase RPT4  ali follow..  10  182..TPPKGCLLFGPPGTGKTLLARAVASQLDC----------NFLKVVSSAIVDKYIGESARM-----IREMFNYARDHQPC-----IVFMDEIDAIGQRTLMELLNQLDDSLGKVKVIMATNRPDTLDPALL-RPGRLDRKEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAIRAEREFVIDEDFMKAVRKVGDAKRLET........................................ 399
32 -10.100[R] COG0714 MoxR-like ATPases  ali follow..  16  34....GHA-LLEDVPGVGKTLLAKSLARSINGKFQR---------------TPDLLPTDITGT----NIWNPSSREFEFLPGPAFANILLADEINRATPRTQAALLEVMEELVPHPFFVIATQNPIEYQGTF-AQLDRFALS................................................................................................................. 166
33 -10.100[O] KOG0727 26S proteasome regulatory complex, ATPase RPT3  ali follow..  187..DPPRGVLLYGPPGTGKTMLAKAVANHTTA----------AFIRVVGSEFVQKYLGEGPRM-----VRDVFRLAKENAPA-----IIFIDEVDAIATARFDALLNQMDDQTVNVKVIMATNRADTLDPALL-RPGRLDRKRRQKRLVFQVCTSKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAVRKNRYVILPKDFEKGYRANVKKPDTDF........................................ 404
34 -9.960[O] KOG0741 AAA+-type ATPase  ali follow..  11  255......GILLYGPPGCGKTLLARQIGKML------------NAREPKVVNGPEILKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAIHDTVVNQLLSKIDEQLNNILVIGMTNRPDLIDEALLR-----RLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSAD---DIKELAVETKNFSG-----AELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLE........... 485
35 -9.900[G] COG3265 Gluconate kinase  ali follow..  3....GKCIIVMGVSGTGKSCVGQALALALGAKDGDDLHPRANIQKMAAGQPLNFLVCSALKKQYRDRLREGNEGIRFLWLTGDYDLVL--RAGHFMPESLLKSQFATLEAPEPDVIPIDISSSIADVVEHCIAALSL..................................................................................................................... 168
36 -9.850[L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member  ali follow..  58....SQLFRLFGYAGTGKTTLARHFAENVDGEVVFAAFTGKAAQVLRSKGATNAKTIEEVEDEETGKTSIAPMFAINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTP-------ILVLGDPGQLPPVSGGGYFTNHEPDFLLTDIHRQARDNPIIQLAMQVRE........................................................................................ 222
37 -9.770[R] COG1373 Predicted ATPase (AAA+ superfamily)  ali follow..  48....DRIYTLRGPRQVGKTTLVKLIIRELLETIEHS----------------SIFYFTCDLVADEKELFEVLDLYLKWAAAFRLERKYILDEISSV--RDWEKGLKYLVD--NNATVVLTGSHSIDIIERLPGRTLDKIFFPMKFSEYEAEKRQEILSNLSEGRADPLLNMLLLYQPELDRLFDQYLLTGG-VNEFFSKNKIDSSIYEIYIQSLIGDLARNIPEMPVKQTLRSIAGKLTTPVSWRSITDET... 311
38 -9.700[R] COG0645 Predicted kinase  ali follow..  4.......AVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLFGEQPEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAGY----VVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGDPSDATLDVIRTQQATREPLTAAETVQSKVDTHDAASLDGLVDGIRQRLP.................................................................. 183
39 -9.610[O] KOG2004 Mitochondrial ATP-dependent protease PIM1/LON  ali follow..  10  508.......LCFHGPPGVGKTSIAKSIATALN----------REYFRFSVGGMTDVAEIKGHRRTYVGAM----KMIQCMKKVKTENPLVLIDEVDKIGGAGFHALLELL-DPEQNVLFICTANEISKIPGPLRDRMEMIDVSGYL---------AEEKVEIAHQHLIPQLRKDTSLATEQLKILEELIKHYCRESGVRNLQQHIERIFRKAALQIAE...................................... 719
40 -9.570[O] COG0466 ATP-dependent Lon protease, bacterial type  ali follow..  11  354.......LLLTGPPGTGKTSLGKSIADALG----------REYVRISLGGVRDEAEIRGHRRTYIGAL----RIIQGMRKAGTKNPVFILDEVDKLSTSPASALLEVL-DPEQNVFFIATANSLASIPWPLLDRMETIEISGYTKNE-KLAIAKDHLLPCILEE----HGLDADKLKIEDEALKGIIDKYTREAGVRGLKKQLARTARFVSEKIVSGKTDLPYVVRADMLKEVL.................... 582
41 -9.470[O] KOG0726 26S proteasome regulatory complex, ATPase RPT2  ali follow..  12  216..KPPKGVILYGPPGTGKTLLAKAVANQTSAT-----------LRVVGSELIQKYLGDGPKL-----VRELFRVAEEHAPS-----IVFIDEIDAVGTKRYDSLLNQLDDSRGDVKVIMATNRIETLDPALI-RPGRIDRKEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEA--------GLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGL........................ 437
42 -9.370[O] KOG0652 26S proteasome regulatory complex, ATPase RPT5  ali follow..  203..RPPKGVLLYGPPGTGKTLMARACAAQTNAT-----------LKLAGPQLVQMFIGDGAKL-----VRDAFQLAKEKAPC-----IIFIDEIDAIGTKRFDSLLNQLDSSDERIKVIAATNRADILDPALM-RSGRLDRKEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEALRRDATEVNHEDFNEGIIQVQAKKKASL........................................ 420
43 -9.070[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  14......FLIVAGPNGSGKSSVYANADLELEGRSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQ----------SSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAK---HDVPADKVRARYAR-----------------SLDQLPWFLERADRAWIWDNSGATPKLIGEK.................................................... 181

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.