current user: public

If you have questions about the server, please let us know.

Query: gi|12044859|ref|NP_072669.1| TatD family deoxyribonuclease (MG_009) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MEYFDAHCHLNCEPLLSEIEKSIANFKLINLKANVVGTDLDNSKIAVELAKKYPDLLKATIGIHPNDVHLVDFKKTKKQLNELLINNRNFISCIGEYGFDYHYTTEFIELQNKFFEMQFEIAETNKLVHMLHIRDAHEKIYEILTRLKPTQPVIFHCFSQDINIAKKLLSLKDLNIDIFFSIPGIVTFKNAQALHEALKIIPSELLLSETDSPWLTPSPFRGKVNWPEYVVHTVSTVAEIKKIEIAEMKRIIVKNAKKLFWHLast
1 -107.000[L] COG0084 Mg-dependent DNase  ali follow..  27  1MQIFDTHAHIGLIHPDPERLRVVQEARRASVTRIMICNSLHDFAAVYETLQFSPS-VYHAVGVSPSEVMAPG-KDWIDTIQKSLQLPQ--VVALGETGLDYCKKYGDKRSQIGLFITQLDIASKAKKPVIIHNRGAGQDILDILSERIPDQGGVFHCYSEDAEYARMALDL-----PVYFSFAGNLTYRNARNLHETVLALPLDRILVESESPFMSPATYRNKRNRPAHTVETVEFMAELLDMDMLELADQLWKNSCACFH. 254
2 -81.900[L] KOG3020 TatD-related DNase  ali follow..  24  139VPYIDSHCHTDYNEGLLDWIEKYPRAFPKCFFGLIAGNSSYDVEWIVKELASPLY-LGTTWGCHPHFAQHWGRMTTMEYILSDAEEWK--VLAVGECGIDLHRCESELEVQKDVFEKHVALAFKFKLPLVIHCRNAEEECLQILKKKMDVLKIHRHCFTENWEVAQMWLKQC---PDVHFGFTPAVFTMGA-PQIQAIRNIPLDRILLETDGPYFKPKCYDGKVCLPGMAIATASKIAEIKNLPIEEVLRATFNNTRRVYQ. 433
3 -65.700[R] COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold  ali follow..  15  2..YFDSHLHSEGLGFSE-----LVKLKENGIKEVCLAFFPVKPKYPQTMIDVFRKLMHPAVGIHPRCI-----PPDYEFVLGYLEEGE--WVAFGEIGLELVT-----DEEIEVLKSQLELAKRMDVPCIIHTPKATRKTLEILESLDFP-ADLAVIDHVNFETLDMVLET-----EYWIGLTVQPGKLSAEDAARIVAEHGPERFMLNSDAGY--------RDVEITTVAEAAVKIEE--AVGREEMEKVARENARKFLR. 247
4 -61.300[R] COG1831 Predicted metal-dependent hydrolase (urease superfamily)  ali follow..  18  1MIILDNHFHVD--PINGLFLEAVKQFHRAGGTHLVVYKSAHDYGFGGMKGEDFMRAAYAVVGVHPAEFDYLARARGIEYAKREVMKLDGKAIGIGEVGRPHYPPEEIWEASIEIMKYAMALAKEADCAVQLHTESFDEEKFRELREVGIKPYRVVKHFSPP--LVKVAEEV-----GIFPSI-----IASRKNIEEAIKQGT--RFLMETDYIDDKRRP--GAVLGPKTVPRRTKELLQKGILTEDDVYRIHVENPEKVYG. 276
5 -17.200[R] KOG4245 Predicted metal-dependent hydrolase of the TIM-barrel fold  ali follow..  16  12SRKIDVHAHVLPKNIPDDTETRIADMNRANVNVQCLSTVPVKPADTEIVARFVNDDLLAECQKFPDRLVPLGTLPMNDV--QRAVEEVKRCVSMGIKGFEVGSHVAEKSLDHRDFWPLYKICEELSVVLFVH--ETAQAICSVL-VLFPKLKLCFAHGGGAYPQIRGRVSCKVAPNKLDGLLWTDSLVHDPKALELLINTVGKEHIVLGTDYPF------------PLGELEVGRVVEEYKPFSAKDREDLLWKNAVKMLD. 341
6 -13.500[R] COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold  ali follow..  14  2..IIDTHLHLDRDFLYATYAAEAKRVGVAASLHMEVDVDELETREVARLAGEPGSLLKGAIA-------RPEDEGFAAYLERQEENAFVK-------GFRRVLHVVTDDSEQPLFRENVKRLSGTRFTFDLCVLPHQIPKAIALADLAPDVQFILHC-GHAEHPWRDHMTEIARHPNVVAKISGVVAYAEED-VEHTISVFGWDRVVWGSDWPVCT---------GGNLSTWVAATQALIEGCSPQERRKLLSGNAQRIWN. 276
7 -13.200[R] COG1735 Predicted metal-dependent hydrolase with the TIM-barrel fold  ali follow..  10  89....................AELKDFVAAGGQTVVEPTCQRNPLAMRRISQATGLNIVMGAGYYPEKVAGLTVDAIADEIQEARHGVDGTDVRIGLIGE----SADFTAAEEKSLRGAAQAHVRTGLPLMVHLLRLGHRVLDVVAEEGADLNHTVLCHMNPSHADIAYQ-SELAGRGAFIEYDMI-DEDAARSIVTLVEGGYLDRILLSHDVFLKMMLTRYGGNGYAYILKHFLPRLKR-HGLDDVTLQTLMRDNPRSVF.. 351
8 -13.000[F] COG0418 Dihydroorotase  ali follow..  9..PDDWHLHLRDGAALKAVLPHTVRQFARAIVMPNLKPPVRSVADAAAYRERILAAIPAGGQFEPLMTLYLTDNTNPEEIIAAKA--SQFVKAVKYYPAGATTNSDFGVTDIHRCDAVLAAMEQVDLPLLLHGEVTDSNLIPLREKFPRLRVVLEHITTDAVQFVLSANNIAATITPQHLLFS-LKREEHRLSLLHAATSGNPKFFLGTDSAPHARNSK--GCYSALHAMELYAEAFES--VNSLDKLEAFASFYGPDFYQ. 300
9 -12.200[F] KOG2902 Dihydroorotase  ali follow..  14  8..LADMHVHLRQD---NMLKAVVPTVAEGGVSVAYVMPNLIPPITTVDACLQYKKEIEQL-------DSKTTYLMSLYLSPETTPEVIYEAAKKGIRGVKSYPKGATTNESYEPFYPTFAAMQETGMILNIHGEVFLPTLLDLHQRFPKLKIVLEHCTTDAVEAVKAYLTQKDWQDDPYCFCKPVA--KTERDRRALIEAATSKNPKFGSDS---APHPRSSKLKTPP-QPFAASYLAEVKEGRLDALKDFACIFGRKFYC. 294
10 -10.700[R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold  ali follow..  12  7LFIVDSDCHNYWCSATNYAIMKEKHLDKYNIDVAILTGDLANAHYANALCRAYNDYMIDYWLPKDSRVAPQDPKLAAEEIRRLGSHPRIVQVLVSHGA--------QRPYGDPFYHPIYEACAEMGLPFAMHL-SAMTHMASLI------AQGVFEKWECGVAWVPSVLWRLDANYKALRKETPWLKRLPSEYFKTLEAMDGENTLLFASDYPH--------------------YDDVTKLHIPPAWREKVLGLNALDVYR. 355
11 -10.400[F] COG0044 Dihydroorotase and related cyclic amidohydrolases  ali follow..  119..RTDYSFHIAITGWNERTFNEMVEVVKRGINTFKHFMAYKGNDDEMFASFQRCAELGAMPLVHAEN-------------GDIVAQLQAKLMAEGNDGPEAHAYSRPPEVEGEATNRAIMIADQAGVPLYVVHVSCEQSHEAIRRARQKGIRVFGEPLIQHLTLDESEYHNRDWDYAARRVMSPPF--RDKLNQDSLWAGLAAGSLCVATDCAFTTEQKRYGIGN-EERMPVLWTRGVRTGRLTPNEFVAVTSTNIAKILN. 378
12 -9.720[F] KOG2584 Dihydroorotase and related enzymes  ali follow..  12  70...VDVHTRLQMPTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYERWDSAACCDYSLH-KDRCQCSDSQMYEIFSDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLVTKV--MSKGAADAIAQAKRRGVVVF------GEPITASLGTDGAKAAAFVTSPPVN--PDPTTADHLTCLLSSGDLVTGSACTFTTAQKAVGKDN-EERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFN. 393

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.