current user: public

If you have questions about the server, please let us know.

Query: gi|12044862|ref|NP_072672.1| alpha-L-glutamate ligase (MG_012) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MKKINVVYNPAFNPISSKLNQTQLLKNASEELDIELKFFTSFDINTTKAKANLPFISNKILFMDKNIALARWLESNGFEVINSSIGINNADNKGLSHAIIAQYPFIKQIKTLLGPQNFDREWNPVMLDVFINQIKQSMEFPVIVKSVFGSFGDYVFLCLDEQKLRKTLMSFNQQAIVQKYITCSKGESVRVIVVNNKVIGALHTTNNSDFRSNLNKGAKAERFFLNKEQENLAVKISKVMQLFYCGIDFLFDQDRSLIFCEVNPNVQLTRSSMYLNTNLAIELLKAILast
1 -54.000[HJ] COG0189 Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)  ali follow..  19  24MRIAFFV---NSIETEGPTFATGLLAMAALNRGHDVVYLTPGDFTLRVEEIDALMLRNDPSLDHAGILFGRLAEQRGVVVLNDPEGLALAQNKLYFQSFPE----IVRPTTLISRNV-----------EEIRAFADTHPKGVIVKPLQGSGGKNVFKIGSSKETNFEAVSLEGYLIAQAYLPAAKEGDVRFFMMNGRPLMRDGQYAKGDLRSNIHANGTAEAVKVTDEIVELAEMMRPKLGMFLVGLDIV---GDKILEVNVFSPGGLSNILELTNVDFSDTIIEAV 349
2 -25.700[R] COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily)  ali follow..  15  58....................SMDSMEKYLEKSDAFLIIAPEDDFLL--------------------YTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGE--VQVPQTSL----------------------RPLDCKFIIKPRTACAGEGIGFSDEVPD----------GHIAQEFIE---GINLSVSLAVGE-CLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVENGYVGVDIVY--SDQPYVIEINATTPVVAFSRAYGASVADLLAGGE 271
3 -23.900[R] COG3919 Predicted ATP-grasp enzyme  ali follow..  15  1MTIPGVVIIGGAHGT--------ALARSLGVLNVPVYYLTHDSPLPGWSRFAMAFLREMAEKPGLKGCLLEELSALYKIILPEWTNLQWLCEKPLLYKRAAELG-VSIPRTYALTSAADIDGL-------------DVMFPVILKPHMGGGNTSVIRADDREELKAAFVDASGNVVVQELIP---GGGESQFSYNGEPIAEFTARRARQYPVDFGYTSTRVEVVDNRQAIEAARKILKSAGHGLVEVEFKLDRDGALKLLDVNPRPSWFGLCSAAGINLGGLLWRVA 310
4 -23.700[M] COG1181 D-alanine-D-alanine ligase and related ATP-grasp enzymes  ali follow..  14  2..KIAVLYGGTSAEREVSLSSGKGIMEALKANGHEVIGIDFHPDQVRDLVDLDVDLVFIGLHGRLG-KVQALLDLLNIPYVGTVQGSALAMDKAKAKLFFEKAG-IRVAEEVVLHS----------FTYDANAFNFTGTYPVVVKPNQEGSTIGLTVAETEEELLQGIERHDDTILIEEFIA---GTEVTVAVLGNKVVEIVPKNKLYDYESKYAPGMSEHIVEHTAYVQQAAVRAHQALGCVYSRVDFIVPNDGDPVILKVNTLPGMTPTSKGVGMSYEEMIQTFV 299
5 -21.600[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  14  90..FTLLVLDDQNTDWSKYFRGRR--VEQAEFRDITVVSSADTGPVVTMARVARSFRPDFVLIRQP--STILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLGFPLIEQTFFPNPRDLVSIRGMMWRTHVLLLRSCFIFPSVLKAGHCHGGVATARLENQSALQDAANDSHCYCTIEPYIDAK--FSVHIQKIGNNYKAFMRKSITGNWKTNQG-SAMLEQITLTEKYKSWVDEISELFGMEVCGLSVVVAKDGREYIISACDST-IGDTQEEDRRQIADLVSGRM 451
6 -21.400[R] COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase  ali follow..  17  4MEEILVI-----------GVNTRPVVESAFRLGYRVYSAGGRFHENFSQEKLLEAASDFIERADGIIPLTGAPPLPGEKVLG-NSRVDHVEDKYRLYRRIRNS--YPTPETHLISDP-----------AEAMEIVAAGEKKYIAKPVSGAGGFGVTEFREGDG----------EFLLQEYIE---GVPVSASVLGEDAITVLTSRQIIDRGVPGFEGQFVYAGNMTGEIEDLASDLILDLSLGSNGVDLIMRDSE-LYVIEVNPQGTFECAEASLGINMVDAHIR.. 283
7 -21.100[F] COG0027 Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)  ali follow..  13  25......................KEVVIELQRLGVEVIAVDRYANAPAQQVAHRAYTISML-VEAIATATLVELEQAGFTVIPTAKATQLTMNREGIRRLAAEELGLPTSNYQFVDN-----------FDDFKRAVEKIGIPCVVKPIMSSSGHGQSILKSVEQIPSAWEYAQQRVIVEGFVKFD--YEITLLTVHGTSFLAPIGHIQIDGDYRESWQPQAMSAVALEKAQAIAEKITGALGRGIFGVEMFVCGDE-VIFNEVSPRPHDTGTLISQELSEFALHARAI 307
8 -19.600[R] COG1759 ATP-utilizing enzymes of ATP-grasp superfamily (probably carboligases)  ali follow..  113......................................................................RVENEFLVPMFRSLLRTEERSEEKSYYWLLEKAK-LPYPEPV-----------------SPEEIDDVGLVIVKLPHAKKRLERGFFTAASYKEFKEKSEKLLAKARIERYIIGPVDGEIELLGIDAAQQLTLPEWQFEPEYTVCGHASSTLRESLLEKVFDMAEKYVEATKKGIIGLQTAVDKDLNFYIYDVAPRGGGTNIHMAMGHPYGNSLWR.. 353
9 -19.300[I] COG0439 Biotin carboxylase  ali follow..  16  1MFKKILIANRGEIAL--------RVIRTAREMGIQTSYLNIPNILSAALMTGAEAIHPGYGFMAENPDFAEMCREHGIVFIGTPESMRALGSKAGGREIAAQSNVPTVPGTGVLESV-----------DAALLAAKQIGYPVLLKASAGGGGRGQKVIRTQEELQKGFNQAQEEIIMEKFLEEFRHIEVQVM---GHVIHIGERDCSIQRRNQIEEAPSTLPESLRQEILAAGVRLAQFVNYAGAGLEFIMDRDGNYYFMEMNTRIQVEHSEMISSLDLVRLQIE.. 312
10 -18.400[I] COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit  ali follow..  13  15.......................RIIRACRDYGLQSTYLDISKLIAIAKRAGADAVHPGYGFLSERAEFAQAVIDAGLIWIGDPDVIEALGDKVMARRIATGVGAPLVAGS----------DGPVSSAAEVTAFAEQHGLPVAIKAAHGGGGRGLKVAWKMEEIAELYESAVRECFLERFLDRPRHIEAQVI---GNVLVLGTRDCSLQRRNQ-EAPAPFLSDEQRQKIHDAAKAICAAAGYSGAGVEFLLGVDGTISFLEVNTRLQVEHTEETTGIDLVIEQFR.. 313
11 -18.100[F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)  ali follow..  11  24......................RMLAMAAARLNHRTIVLEPQADCPAAQVCNDQIVAETYEFENVPVAAAEKLSAS-VPVYPPAQALSASQDRLTEKRFLNGCG-IPTADFRAVDS-----------QDELEAALTAFGGKGVLKTRRGYDGKGQRLFRGGENLTGAFAALGGPLILESFVAFE--REISIIAAGTVTCYDPAENVHLNGILHTSTVPAALSDAAKAVAVQSAEKLLAALEVGVIGIEFFVLPDGSLVANEMAPRVHNTGTEAACAISQFEQHIRAV 299
12 -17.000[EF] COG0458 Carbamoylphosphate synthase large subunit (split gene in MJ)  ali follow..  13  7IQKIMVIGSGPIIQAAEFDYAGTQACLSLKEEGYEVVLVNSNPATIMTDALLPTLGGQTGLNMAMELSKNGILDELGVELLGKLSAIDQAEDRDLFKQLMEELE-QPIPESEIVNTVEEAV-----------AFAATIGYPVIVRPAFTLGGTGGGMCANEKELREITENGVTQCLIERSIAGFKEIEYEV-MRDSADNALVVCNMENFDPVGIHTGDSIVFAPAQQMLRDASLSIIRALKIGGCNVQLLDPNSFKYYVIEVNPRVSRSSASKATGYPIAKLAAKIA 326
13 -16.100[IE] KOG0238 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit  ali follow..  14  63.......................RVIKTARAMGIKTSYLRADRILQAVEDTGAQAVHPGYGFLSENTKFAAELEKAGAKFIGNSKAILDMGDKIHSKKIATAARVSMIP----------GYDGEIADEDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQAREGYRLSKQEMLVEKFIDNPRHIEMQVL---GNALWLNERECSIQRRNQ-EAPSSFVPPEMRRKMGEQAVQLAKAVGYDSAGVEFLVDSQRNFYFLEMNTRLQVEHTECITGIDIVQQMLR.. 361
14 -15.700[C] COG1038 Pyruvate carboxylase  ali follow..  12  24ISKILVANRSEIA----------RVFRAANELGIKTSYLSIEEVIRVAKLSGADAIHPGYGLLSESPEFVEACNKAGITFIGTPDTMRQLGNKVAARNLAISVDVPVVPAT----------NPLPDDIAEVERMAEEIGYPVMLKASWGGGGRGMRAIRKKEDLAREVTEAKREVYLEKLVERARHVESQIL---GNVVHLFERDCSIQRRNQ-RAPAPYLSEAQRQELAAYSLKIAAATNYIGAGVEYLMDADGKFYFIEVNPRIQVEHTEVVTGIDIVKAQIH.. 344
15 -14.300[F] KOG2835 Phosphoribosylamidoimidazole-succinocarboxamide synthase  ali follow..  12  16......................RMIVEAANRLNIKTVILDAENSPAKQISNSNDHVNGSFSNPLDIEKLAEKCKHPKLKIYPSPETIRLIQDKYIQKEHLIKNG-IAVTQSVPVEQA---------SETSLLNVGRDLGFPFVLKSRTAYDGRGNFVVKNKEMIPEALEVLDRPLYAEKWAPFT--KELAVMIVGLVFSYPIVETIHKDNICDLCYAPARVPDSVQLKAKLLAENAIKSFPCGIFGVEMFYLETGELLINEIAPRPHNSGTIDACVTSQFEAHLRSI 297
16 -13.900[O] KOG2158 Tubulin-tyrosine ligase-related protein  ali follow..  15  199................................................................................INHFPGMIEICRKDLLSRNLNRMLKI-FPKTWMLPADY----------GDAMNYALNHKRTFILKPDSGAQGRGIWLTNDLKTIGP-----HERLICQTYIHDGYKFDLRVYTL------GLARFATNKYVTNYSVNKRNSHYEFWSNVDDVIIKTVLSAWFEILGFDILVDWKLKPYILEVNHSPSF-HTNEQVDREVKRPLIRDT 471
17 -13.800[F] COG0151 Phosphoribosylamine-glycine ligase  ali follow..  12  52....................DIPALVKFAQDKQIGLTIVGPEA--------------------PLVIGVVDAFREAGLKIFGAKAAAQLEGSKAFTKDFLARHK-IPTAEYQNFTEVEPALTYL-----------REKGTPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMGSRVVIEEFLD---GEEASFIVMDGKNVEPMKRVGENDTGLNT--GGMGAYSPAPVITPEIHSRIMKEVGNVYTGFGLMIMPNGQPKVIEFNGDPETQPIMLRLKSDLVELCLKAC 315
18 -13.100[O] KOG2157 Predicted tubulin-tyrosine ligase  ali follow..  16  270................................................................................VNHFPRSYEMTRKDRLYKNIERMQHL-VPQTFVLPIES----------RDLVVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQ-----DEQAVVSKYIVDGHKCDLRVYVL------GIVRLATVKYDCNYSINKYHSDYQLMLNIEDLIIKAVLACAFELYGFDILIDNALKPWLLEINLSPSM-GVDSPLDTKVKSCLMADL 542
19 -12.200[F] KOG0237 Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS)  ali follow..  11  58....................DFEQLVKFALDKDVNLVIPGPELPLVE---------------------IEGHFRRVGIPCFGSALAARMEGSKVFSKDFMHRNN-IPTAVYKSFSNYDHAKSFL-----------DTCTFDVVIKADGLAAGKGVIIPKTKKEAFEALESIGKNVVIEELLE---GEELSILTFDGYTCRSLKRAFDGDKGPNT--GGMGCYAPTPVASPKLLETVQSTIGYPLVGIGLMLTPSG-PRVLEYNGDPETQAVLPLLESDLAEIILACV 320
20 -10.100[E] COG0754 Glutathionylspermidine synthase  ali follow..  15  181.............DTVEDRGTIQYLQDCAAEAEIATEFLYIDDIGLGEKGQFTNLFKLYPWEFMLREMFSTKLEDAGVRWLEPAWKS-IISNK----ALLPLLWEMFPDHPNLLPAYFAEDEHPPMDK-------------YVVKPIFSREGANVSIIENGKTIESVEGPYEEGMIVQQFYPLPKFGDIGSWLINDQPAGIGIREDRALITQDLSR....................................................................... 378
21 -9.090[S] COG2308 Uncharacterized conserved protein  ali follow..  10  286....................NSAYYEHAYLARLMGVPLVEGRDLVVHVDDDFIDPLTFRRDSSLGAAGLFNAYRAGNVVICNAPGT-GVADDKAVYAYVPDIIRYYLGEDAILPNIETYLCREPRQLSHVLANLDK-----LVVKAVGASGGYGMLV-KERDDFALAIKADPENYIAQPTIQEPRHVDLRPFILSGETPGALTRVARGSLVVNSSQGGGSKDTWVLADDAPSNGNGHGS................................................ 542

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.